>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group

Probab=99.24 E-value=6e-11 Score=86.21 Aligned_cols=123 Identities=20% Similarity=0.308 Sum_probs=77.4 Q ss_pred CEEEEECCCCCCCEEEEEE---CCC---CCHH------HHHH------HCCCEECCEEEEECCEEEEEECCCCCCCCCCC Q ss_conf 1124421677753035410---145---4012------1211------00000010266329868998226421247311 Q gi|254780648|r 161 DIGIIGLPNAGKSTFLASV---TRA---KPKI------ADYP------FTTLYPNLGIVKEGYKEFILADIPGIIKNAHQ 222 (335) Q Consensus 161 DVglVG~PNaGKSTLln~l---s~a---k~kI------a~yp------FTT~~P~lGvv~~~~~~~~i~D~PGlIegA~~ 222 (335) T Consensus 1 Ni~iigH~~aGKTtL~E~lL~~~g~i~~~G~V~~g~t~~D~~~~E~~RgiSi~s~~~~~~w~~~~inliDTPG~------ 74 (268) T cd04170 1 NIALVGHSGSGKTTLAEALLYATGAIDRLGSVEDGTTVSDYDPEEIKRKMSISTSVAPLEWKGHKINLIDTPGY------ 74 (268) T ss_pred CEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEECCEEEEEECCEEEEEEECCCC------ T ss_conf 98999089999899999999966996657654589735778788986796751355788889979999869897------ Q ss_pred CCCCHHHHHHHHHHH----HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHH Q ss_conf 677512344333335----7887520222211013466678998777667505988999974658998899999999998 Q gi|254780648|r 223 GAGIGDRFLKHTERT----HVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELAT 298 (335) Q Consensus 223 ~~glG~~FLrhIer~----~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~~~~~~~l~~ 298 (335) T Consensus 75 -----~DF~~e~~~aL~v~D~Av~Vida~~G-Ve~~T~~~w~~~~~-----~~iP~i~fINKmDr~~ad-~~~~l~~i~~ 142 (268) T cd04170 75 -----ADFVGETRAALRAADAALVVVSAQSG-VEVGTEKLWEFADE-----AGIPRIIFINKMDRERAD-FDKTLAALQE 142 (268) T ss_pred -----HHHHHHHHHHHCCCCEEEEEECCCCC-HHHHHHHHHHHHHH-----CCCCEEEEEECCCCCCCC-HHHHHHHHHH T ss_conf -----57999999984047839999418754-76879999999998-----599989999787878996-4779999999 Q ss_pred HCC Q ss_conf 629 Q gi|254780648|r 299 QCG 301 (335) Q Consensus 299 ~~~ 301 (335) T Consensus 143 ~lg 145 (268) T cd04170 143 AFG 145 (268) T ss_pred HHC T ss_conf 868

HHsearch alignment for GI: 254780648 and conserved domain: cd04170