HHsearch alignment for GI: 254780648 and conserved domain: pfam00503

>pfam00503 G-alpha G-protein alpha subunit. G proteins couple receptors of extracellular signals to intracellular signaling pathways. The G protein alpha subunit binds guanyl nucleotide and is a weak GTPase.
Probab=96.97  E-value=0.003  Score=39.48  Aligned_cols=130  Identities=14%  Similarity=0.145  Sum_probs=78.1

Q ss_pred             CEECCEEEE----ECCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC--HHHH--HHHHHHHHHHH
Q ss_conf             000102663----298689982264212473116775123443333357887520222211--0134--66678998777
Q gi|254780648|r  194 LYPNLGIVK----EGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSALEEN--VQAA--YQCILDELSAY  265 (335)
Q Consensus       194 ~~P~lGvv~----~~~~~~~i~D~PGlIegA~~~~glG~~FLrhIer~~vLl~VVD~s~~d--~~~~--~~~I~~EL~~y  265 (335)
T Consensus       174 R~~TtGI~e~~F~~~~~~~~l~DVGGq---r~eRrKWi~----~Fe~V~aIiFvvsLS~yDq~l~ED~~~NRl~eSl~LF  246 (350)
T pfam00503       174 RVKTTGIVETTFSVKKVTFRMFDVGGQ---RSERKKWIH----CFEDVTAIIFLVALSEYDQVLFEDESTNRMQESLKLF  246 (350)
T ss_pred             CCCCCCCEEEEEEECCEEEEEECCCCC---CCCCCCHHH----HHCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             165578426898747867997248888---333555566----6167646999843530132433586440899999999


Q ss_pred             -----HHHHCCCCEEEEEECCCCCCHH------------------HHHHHHH----HHHHHC----CCCE--EEEECCCC
Q ss_conf             -----6675059889999746589988------------------9999999----999862----9948--99988878
Q gi|254780648|r  266 -----NSELRKKIEIVGLSQIDTVDSD------------------TLARKKN----ELATQC----GQVP--FEFSSITG  312 (335)
Q Consensus       266 -----~~~L~~Kp~IIVlNKiDl~~~e------------------~~~~~~~----~l~~~~----~~~v--i~ISA~tg  312 (335)
T Consensus       247 ~~i~n~~~f~~t~iiLfLNK~Dlf~eKl~~~~l~~~Fpdy~g~~~~~~~~~~fi~~kF~~~~~~~~~r~iy~h~T~AtDt  326 (350)
T pfam00503       247 DSICNNRWFKNTSIILFLNKKDLFEEKIKKSPISDYFPEYKGPPQDYEAAKEFIKKKFVSLNRNNPKKEIYSHFTCATDT  326 (350)
T ss_pred             HHHHCCHHHCCCCEEEEEECHHHHHHHCCCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCH
T ss_conf             99964852457987999767788998648994341089999998899999999999999756798898266521532050


Q ss_pred             CCHHHHHHHHHHHHHHHH
Q ss_conf             899999999999998545
Q gi|254780648|r  313 HGIPQILECLHDKIFSIR  330 (335)
Q Consensus       313 ~GI~eL~~~I~e~L~~~r  330 (335)
T Consensus       327 ~~i~~vf~~v~d~Il~~~  344 (350)
T pfam00503       327 ENIRFVFDAVKDIILQEN  344 (350)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             889999999999999999