RPSBLAST alignment for GI: 254780648 and conserved domain: TIGR03594

>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability. Length = 429
 Score = 41.7 bits (99), Expect = 3e-04
 Identities = 45/171 (26%), Positives = 76/171 (44%), Gaps = 20/171 (11%)

Query: 162 IGIIGLPNAGKSTFLASVTRAKPKIA-DYPFTTLYPNLGIVKEGYKEFILADIPGIIKNA 220
           I IIG PN GKST + ++   +  I  D   TT        +   K+++L D  GI +  
Sbjct: 175 IAIIGRPNVGKSTLVNALLGEERVIVSDIAGTTRDSIDIPFERNGKKYLLIDTAGIRRKG 234

Query: 221 HQGAGIGDRF-----LKHTERTHVLLHIVSALEENVQAAYQCILDE-LSAYNSELRKKIE 274
               G+ +++     LK  ER  V+L ++ A E   +       D  ++    E   K  
Sbjct: 235 KVTEGV-EKYSVLRTLKAIERADVVLLVLDATEGITE------QDLRIAGLILE-AGKAL 286

Query: 275 IVGLSQIDTV-DSDTLARKKNELATQ---CGQVPFEF-SSITGHGIPQILE 320
           ++ +++ D V D  T    K EL  +       P  F S++TG G+ ++L+
Sbjct: 287 VIVVNKWDLVKDEKTREEFKKELRRKLPFLDFAPIVFISALTGQGVDKLLD 337