RPSBLAST alignment for GI: 254780648 and conserved domain: PRK09602

>gnl|CDD|181982 PRK09602, PRK09602, translation-associated GTPase; Reviewed. Length = 396
 Score = 86.0 bits (214), Expect = 1e-17
 Identities = 39/110 (35%), Positives = 59/110 (53%), Gaps = 26/110 (23%)

Query: 162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGI--------------------- 200
           IG++G PN GKSTF  + T A  +IA+YPFTT+ PN+G+                     
Sbjct: 4   IGLVGKPNVGKSTFFNAATLADVEIANYPFTTIDPNVGVAYVRVECPCKELGVKCNPRNG 63

Query: 201 -VKEGYKEFI---LADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSA 246
              +G + FI   L D+ G++  AH+G G+G++FL    +   L+H+V A
Sbjct: 64  KCIDGTR-FIPVELIDVAGLVPGAHEGRGLGNQFLDDLRQADALIHVVDA 112