RPSBLAST alignment for GI: 254780648 and conserved domain: COG0370

>gnl|CDD|30719 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism]. Length = 653
 Score = 52.2 bits (125), Expect = 2e-07
 Identities = 38/175 (21%), Positives = 74/175 (42%), Gaps = 27/175 (15%)

Query: 161 DIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIK-N 219
            + ++G PN GK+T   ++T A  K+ ++P  T+    G +K    E  + D+PG     
Sbjct: 5   TVALVGNPNVGKTTLFNALTGANQKVGNWPGVTVEKKEGKLKYKGHEIEIVDLPGTYSLT 64

Query: 220 AHQG-AGIGDRFLKHTERTHVLLHIVSA--LEENVQAAYQCILDELSAYNSELRKKIEIV 276
           A+     +   FL    +  +++++V A  LE N+    Q +         EL   + I+
Sbjct: 65  AYSEDEKVARDFLL-EGKPDLIVNVVDATNLERNLYLTLQLL---------ELGIPM-IL 113

Query: 277 GLSQIDTVDSDTLARKKN------ELATQCGQVPFEFSSITGHGIPQILECLHDK 325
            L+ ID       A+K+       +L+   G       +  G G+ ++   + + 
Sbjct: 114 ALNMID------EAKKRGIRIDIEKLSKLLGVPVVPTVAKRGEGLEELKRAIIEL 162