RPSBLAST alignment for GI: 254780648 and conserved domain: COG1159

>gnl|CDD|31353 COG1159, Era, GTPase [General function prediction only]. Length = 298
 Score = 57.5 bits (139), Expect = 5e-09
 Identities = 47/173 (27%), Positives = 74/173 (42%), Gaps = 20/173 (11%)

Query: 162 IGIIGLPNAGKSTFLASVTRAKPKI-ADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNA 220
           + IIG PN GKST L ++   K  I +  P TT     GIV     + I  D PGI K  
Sbjct: 9   VAIIGRPNVGKSTLLNALVGQKISIVSPKPQTTRNRIRGIVTTDNAQIIFVDTPGIHKPK 68

Query: 221 HQGAGIGDRFLKHTERT----HVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIV 276
           H    +G+   K          ++L +V A +E      + IL++L        K   I+
Sbjct: 69  HA---LGELMNKAARSALKDVDLILFVVDA-DEGWGPGDEFILEQLKK-----TKTPVIL 119

Query: 277 GLSQIDTVDSDTLARKKNELATQCGQVPF----EFSSITGHGIPQILECLHDK 325
            +++ID V   T+  K      +   +PF      S++ G  +  +LE + + 
Sbjct: 120 VVNKIDKVKPKTVLLKLIAFLKK--LLPFKEIVPISALKGDNVDTLLEIIKEY 170