RPSBLAST alignment for GI: 254780648 and conserved domain: KOG1486

>gnl|CDD|36699 KOG1486, KOG1486, KOG1486, GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms]. Length = 364
 Score = 65.3 bits (159), Expect = 2e-11
 Identities = 36/113 (31%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 160 ADIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKN 219
           A + +IG P+ GKST L+ +T    + A Y FTTL    G++        L D+PGII+ 
Sbjct: 63  ARVALIGFPSVGKSTLLSKITSTHSEAASYEFTTLTCIPGVIHYNGANIQLLDLPGIIEG 122

Query: 220 AHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKK 272
           A QG G G + +       ++L ++ A +   Q   + +  EL A    L K+
Sbjct: 123 ASQGKGRGRQVIAVARTADLILMVLDATKSEDQR--EILEKELEAVGIRLNKR 173