RPSBLAST alignment for GI: 254780648 and conserved domain: KOG1487

>gnl|CDD|36700 KOG1487, KOG1487, KOG1487, GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms]. Length = 358
 Score = 49.2 bits (117), Expect = 1e-06
 Identities = 32/86 (37%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 159 IADIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIK 218
            A +G +G P+ GKST L+ +T    ++A Y FTTL    G+++    +  L D+PGII+
Sbjct: 59  DARVGFVGFPSVGKSTLLSKLTGTFSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIE 118

Query: 219 NAHQGAGIGDRFLKHTERTHVLLHIV 244
            A  G G G + +    RT  L+ IV
Sbjct: 119 GAKDGKGRGKQVIA-VARTCNLIFIV 143