BLAST/BLAST alignment of GI: 254780648 and GI: 254780941
>gi|254780941|ref|YP_003065354.1| GTP-binding protein Era [Candidatus Liberibacter asiaticus str. psy62] Length = 311
 Score = 39.7 bits (91), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 78/168 (46%), Gaps = 17/168 (10%)

Query: 162 IGIIGLPNAGKSTFLASVTRAKPKIADYPF-TTLYPNLGIVKEGYKEFILADIPGII--K 218
           + ++G  NAGKST +     AK  I  +   TT     GIV E   + +  D PGI   K
Sbjct: 25  VALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAK 84

Query: 219 NAHQGAGIGDRF--LKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIV 276
           +++    I   +  +KH +   +++     L+ N+      +L E++  +S L     I+
Sbjct: 85  DSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHD----LLKEIAKRSSRL-----IL 135

Query: 277 GLSQIDTVDSDTLARKKNELATQCGQV--PFEFSSITGHGIPQILECL 322
            L++ID V  + L  ++ E+A +   +   F  S+  GHG   +L  L
Sbjct: 136 ILNKIDCVKPERLL-EQAEIANKLVFIEKTFMVSATKGHGCDDVLNYL 182