BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780649|ref|YP_003065062.1| nicotinic acid mononucleotide adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] (216 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780649|ref|YP_003065062.1| nicotinic acid mononucleotide adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 216 Score = 445 bits (1145), Expect = e-127, Method: Compositional matrix adjust. Identities = 216/216 (100%), Positives = 216/216 (100%) Query: 1 MQQSQSLQDIMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFN 60 MQQSQSLQDIMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFN Sbjct: 1 MQQSQSLQDIMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFN 60 Query: 61 SVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWI 120 SVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWI Sbjct: 61 SVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWI 120 Query: 121 MGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCT 180 MGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCT Sbjct: 121 MGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCT 180 Query: 181 TSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLGI 216 TSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLGI Sbjct: 181 TSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLGI 216 >gi|254780181|ref|YP_003064594.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 182 Score = 30.0 bits (66), Expect = 0.033, Method: Compositional matrix adjust. Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 8/80 (10%) Query: 20 MKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQ 79 M+ ++ G+F+P +GH++ I I+ L+ + I NSVK S E+ + Q Sbjct: 2 MRKAVYTGSFDPITNGHMD---IIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQ 58 Query: 80 SLI-----KNPRIRITAFEA 94 S+ + R+ + +FE Sbjct: 59 SIFHFIPDSSNRVSVISFEG 78 >gi|254781101|ref|YP_003065514.1| UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 472 Score = 25.8 bits (55), Expect = 0.67, Method: Compositional matrix adjust. Identities = 11/43 (25%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Query: 95 YLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKR 137 +LN+ ++F +L+ K H + ++ G F Q WK+ Sbjct: 224 FLNYDDSFFELLKAKSHALGIKTIYSFGKSKNADF-QLRKWKQ 265 >gi|254780156|ref|YP_003064569.1| putative inositol-1-monophosphatase [Candidatus Liberibacter asiaticus str. psy62] Length = 256 Score = 24.3 bits (51), Expect = 1.8, Method: Compositional matrix adjust. Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 7/39 (17%) Query: 54 WIITPFNSVKN-------YNLSSSLEKRISLSQSLIKNP 85 WI+ P N + N + +S +LE+ + S+I NP Sbjct: 82 WIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNP 120 >gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Score = 23.5 bits (49), Expect = 2.7, Method: Compositional matrix adjust. Identities = 9/27 (33%), Positives = 19/27 (70%) Query: 63 KNYNLSSSLEKRISLSQSLIKNPRIRI 89 + LS ++R+S++++++KNP I I Sbjct: 490 RGLKLSGGEKQRVSIARAILKNPPIII 516 >gi|254780249|ref|YP_003064662.1| 50S ribosomal protein L5 [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 23.1 bits (48), Expect = 3.8, Method: Compositional matrix adjust. Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 1 MQQSQSLQDIMRMPKVE 17 MQQ S +++M++PK+E Sbjct: 22 MQQEFSYKNVMQIPKIE 38 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.135 0.419 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 139,599 Number of Sequences: 1233 Number of extensions: 5338 Number of successful extensions: 21 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 8 length of query: 216 length of database: 328,796 effective HSP length: 70 effective length of query: 146 effective length of database: 242,486 effective search space: 35402956 effective search space used: 35402956 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 36 (18.5 bits)