RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780650|ref|YP_003065063.1| hypothetical protein CLIBASIA_02685 [Candidatus Liberibacter asiaticus str. psy62] (170 letters) >d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]} Length = 549 Score = 28.2 bits (63), Expect = 0.39 Identities = 11/52 (21%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Query: 114 TELPCFFKNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLLEA 165 P F L ++ +I + EIY AD + I+ E+ Sbjct: 423 ESRPSNFHVLYNLDLSIKDKIAKIATEIYGADGVNYTAE---ADKAIQRYES 471 >d2bmoa1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]} Length = 150 Score = 25.9 bits (56), Expect = 2.1 Identities = 7/30 (23%), Positives = 18/30 (60%) Query: 120 FKNLVERSSQLQRRIVLLDQEIYRADFDEI 149 ++NLV + Q+ ++ D+E+++ + I Sbjct: 1 YQNLVSEAGLTQKLLIHGDKELFQHELKTI 30 >d1zhxa1 d.338.1.1 (A:2-434) Oxysterol-binding protein homolog 4, KES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 433 Score = 25.8 bits (56), Expect = 2.3 Identities = 16/104 (15%), Positives = 28/104 (26%), Gaps = 13/104 (12%) Query: 2 SNRVSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDR---EGHLLSKTLPRAISKLY 58 N I + + + K LY S + E L L Sbjct: 242 KNSFKARI-YKDSKDSKDKEKALYTISGQWSGSSKIIKANKKEESRLFYDAARIPAEHLN 300 Query: 59 T---SESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKI 99 E L +R W + A++ G+ + K ++ Sbjct: 301 VKPLEEQHPLESRKA----WYDVAGAIKLGDF--NLIAKTKTEL 338 >d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Length = 484 Score = 25.3 bits (55), Expect = 2.7 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Query: 78 LQRALEDGN---MTLE-QVMSEKEKIKFDYSGLDSTVPGWTELP 117 L A++ G+ L QV+ +E KFD+ LD+T W ++P Sbjct: 241 LVGAIKKGDFPKWDLYVQVLKPEELAKFDFDPLDATKI-WPDVP 283 >d1q90b_ f.21.1.2 (B:) Cytochrome b6 subunit of the cytochrome b6f complex {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 212 Score = 24.6 bits (53), Expect = 4.8 Identities = 7/35 (20%), Positives = 16/35 (45%) Query: 44 HLLSKTLPRAISKLYTSESVLLTTRLMQMVSWLFL 78 + SK +P ++ Y + T L+Q+ + + Sbjct: 17 DITSKYVPPHVNIFYCIGGITFTCFLVQVATGFAM 51 >d2af4c1 c.77.1.5 (C:2-333) Phosphotransacetylase Pta {Methanosarcina thermophila [TaxId: 2210]} Length = 332 Score = 24.3 bits (52), Expect = 5.8 Identities = 8/29 (27%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Query: 119 FFKNLVERSSQLQRRIVL---LDQEIYRA 144 F + + ER+ +L + I L D +A Sbjct: 3 FLEKISERAKKLNKTIALPETEDIRTLQA 31 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.322 0.135 0.387 Gapped Lambda K H 0.267 0.0485 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 595,569 Number of extensions: 25103 Number of successful extensions: 51 Number of sequences better than 10.0: 1 Number of HSP's gapped: 51 Number of HSP's successfully gapped: 9 Length of query: 170 Length of database: 2,407,596 Length adjustment: 79 Effective length of query: 91 Effective length of database: 1,322,926 Effective search space: 120386266 Effective search space used: 120386266 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.6 bits)