BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780651|ref|YP_003065064.1| hypothetical protein CLIBASIA_02690 [Candidatus Liberibacter asiaticus str. psy62] (30 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780651|ref|YP_003065064.1| hypothetical protein CLIBASIA_02690 [Candidatus Liberibacter asiaticus str. psy62] Length = 30 Score = 62.0 bits (149), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 30/30 (100%), Positives = 30/30 (100%) Query: 1 MADSFGKRIKGYLKIMESGLVLRNGSFYRF 30 MADSFGKRIKGYLKIMESGLVLRNGSFYRF Sbjct: 1 MADSFGKRIKGYLKIMESGLVLRNGSFYRF 30 >gi|254780533|ref|YP_003064946.1| 3-oxoacyl-(acyl carrier protein) synthase II [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Score = 21.6 bits (44), Expect = 2.5, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 5 FGKRIKGYLKIMESGLVLRNG 25 FG + G +I+ES VLR+G Sbjct: 112 FGSGMGGLNRIVESSNVLRDG 132 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.329 0.147 0.423 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,736 Number of Sequences: 1233 Number of extensions: 310 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 30 length of database: 328,796 effective HSP length: 5 effective length of query: 25 effective length of database: 322,631 effective search space: 8065775 effective search space used: 8065775 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.3 bits) S2: 31 (16.5 bits)