HHsearch alignment for GI: 254780655 and conserved domain: PRK08199

>PRK08199 acetolactate synthase 2 catalytic subunit; Validated.
Probab=96.85  E-value=0.0043  Score=41.46  Aligned_cols=100  Identities=15%  Similarity=0.111  Sum_probs=50.0

Q ss_pred             HHHHHHHCCCCCCEECCC--HHHHHHHHHHHHHHHHHHCCCEEEC-CCCCCCC-------CCCCCHH---HHCCCCCHHH
Q ss_conf             787998728876220010--0355530012454111100001302-4543333-------3333101---0002221011
Q gi|254780655|r  427 AMNGIALHKGLAPYSGTF--MVFSDYSRPAIRLASLMGIRVIHVL-THDSIGL-------GEDGPTH---QPVEHLAALR  493 (673)
Q Consensus       427 ~aaGla~~~g~~p~~~tf--~~F~~~~~~~ir~~al~~~~v~~v~-th~gi~~-------G~DGpTH---q~iedia~lr  493 (673)
T Consensus       417 aAiGa~la~p~r~Vv~i~GDG~f~-m~~~eL~Ta~~~~lpv~ivV~NN~~yg~i~~~q~~~~~~r~~~~~l~~~df~~lA  495 (553)
T PRK08199        417 AAIAAKLLYPERTVVAFAGDGCFL-MNGQELATAVQYGLPIIVIVVNNGMYGTIRMHQEREYPGRVSGTDLTNPDFAALA  495 (553)
T ss_pred             HHHHHHHHCCCCEEEEEECCHHHH-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHH
T ss_conf             999999829998189998862765-4199999999978796899996895179999999746996455869998999999


Q ss_pred             HHCCCCEEEECCHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             10122112112012457777652025678349995
Q gi|254780655|r  494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSL  528 (673)
Q Consensus       494 ~iPnl~v~~P~d~~E~~~~~~~al~~~~gP~~ir~  528 (673)
T Consensus       496 ~a~G~~~~~V~~~~el~~al~~a~~~-~gp~lIeV  529 (553)
T PRK08199        496 RAYGGHGERVERTEDFAPAFERALAS-GKPALIEI  529 (553)
T ss_pred             HHCCCEEEEECCHHHHHHHHHHHHHC-CCCEEEEE
T ss_conf             97799799969999999999999858-99599999