HHsearch alignment for GI: 254780655 and conserved domain: PRK09628

>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed.
Probab=96.80  E-value=0.0095  Score=38.97  Aligned_cols=111  Identities=16%  Similarity=0.097  Sum_probs=68.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCC-CCHHHHHHHHHHHHHCCCCEEEEEECCCCC-----CCCCC
Q ss_conf             147999999999999853426887678459998436211-434455788765220223306999627632-----23223
Q gi|254780655|r  133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCL-MEGISQEAISFAGHLGLSKLIVLWDNNGIS-----IDGPI  206 (673)
Q Consensus       133 G~gis~a~G~A~a~k~~~~~~~~~~~d~~v~~iiGDG~l-~eG~~~EAl~~A~~~~l~nli~i~d~N~~s-----i~~~~  206 (673)
T Consensus        71 GRala~AtGiK~AnP-----------dl~Viv~~GDGD~~aIGg--nH~iHAaRRN~dit~Iv~NN~iYGmTgGQ~SPTT  137 (281)
T PRK09628         71 GRAVAYATGIKLANP-----------SKHVIVVSGDGDGLAIGG--NHTIHGCRRNIDLNHILINNFIYGLTNSQTSPTT  137 (281)
T ss_pred             CCHHHHHHHHHHHCC-----------CCEEEEEECCCHHHHCHH--HHHHHHHHHCCCCEEEEECCEEEECCCCCCCCCC
T ss_conf             250888999998689-----------976999815740420308--8999999808992899987772303788569899


Q ss_pred             CCC------------CCCCHHHHHHHCCCCCC-CCCCCCHHHHHHHHHHHHHCCCCHHHHHCC
Q ss_conf             556------------78217998864144444-444440678888888751102210222013
Q gi|254780655|r  207 SLA------------DSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACET  256 (673)
Q Consensus       207 ~~~------------~~~~~~~~~~a~Gw~~~-~vdG~d~~~i~~a~~~ak~~~kP~~I~~~T  256 (673)
T Consensus       138 p~G~~T~TtP~G~~e~p~d~~~la~aaGatfVAR~~~~~~~~l~~~ik~Ai~hkGfS~Vevls  200 (281)
T PRK09628        138 PKGMWTVTAQWGNIDPNFDACKLATAAGASFVARESVIDPKKLEKLLVKGFSHKGFSFFDVFS  200 (281)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             998756668999878996999999876997899870489999999999996599967999956