>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes. Thiamine pyrophosphate (TPP) family, pyrimidine (PYR) binding domain; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor. TPP binds in the cleft formed by a PYR domain and a PP domain. The PYR domain, binds the aminopyrimidine ring of TPP, the PP domain binds the diphosphate residue. A polar interaction between the conserved glutamate of the PYR domain and the N1' of the TPP aminopyrimidine ring is shared by most TPP-dependent enzymes, and participates in the activation of TPP. The PYR and PP domains have a common fold, but do not share strong sequence conservation. The PP domain is not included in this group. Most TPP-dependent enzymes have the PYR and PP domains on the same subunit although these domains can be alternatively arranged in the primary structure. In the case of 2-oxoisovalerate dehydrogenase (2OXO), sulfopyruvate deca

Probab=97.60 E-value=0.00018 Score=51.46 Aligned_cols=117 Identities=21% Similarity=0.204 Sum_probs=82.2 Q ss_pred HHHCCCCCCCHHHHHHHHHHHHHCCCCCCEE-CCCHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCHHHHCCCC Q ss_conf 0100325762002356787998728876220-010035553001245411110000130245433333333101000222 Q gi|254780655|r 411 SGRYLHYGVREHAMAAAMNGIALHKGLAPYS-GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489 (673) Q Consensus 411 p~r~i~~GIaE~~~~~~aaGla~~~g~~p~~-~tf~~F~~~~~~~ir~~al~~~~v~~v~th~gi~~G~DGpTHq~iedi 489 (673) T Consensus 34 ~~~~~v~~~hE~~A~~mAdgyar~~g-~~v~~~t~GpG~~n~~~gl~~A~~~~~Pvl~i~g~~~~~-~~~~~~~q~~d~~ 111 (154) T cd06586 34 DKRIIDTVIHELGAAGAAAGYARAGG-PPVVIVTSGTGLLNAINGLADAAAEHLPVVFLIGARGIS-AQAKQTFQSMFDL 111 (154) T ss_pred CCCEEEEECCHHHHHHHHHHHHHHHC-CCEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHH-HCCCCCCCCHHHH T ss_conf 99579912858899999999999749-948996379579989999999987569889996688876-6278988311399 Q ss_pred CHHHHHCCCCEEE--ECCH-HHHHHHHHHHHCCCCCCEEEEECC Q ss_conf 1011101221121--1201-245777765202567834999524 Q gi|254780655|r 490 AALRAIPDLLVLR--PADS-IETLECWQVALKEKNRPSVLSLSR 530 (673) Q Consensus 490 a~lr~iPnl~v~~--P~d~-~E~~~~~~~al~~~~gP~~ir~~R 530 (673) T Consensus 112 ~~~~~~tk~~~~v~~~~~~~~~l~~A~~~a~~~-pGPv~l~iP~ 154 (154) T cd06586 112 GMYRSIPEANISSPSPAELPAGIDHAIRTAYAS-QGPVVVRLPR 154 (154) T ss_pred HHHHHHHHEEEECCCHHHHHHHHHHHHHHHHCC-CCCEEEECCC T ss_conf 999999864899499999999999999998549-9878986288

HHsearch alignment for GI: 254780655 and conserved domain: cd06586