HHsearch alignment for GI: 254780655 and conserved domain: cd07033

>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins. Thiamine pyrophosphate (TPP) family, pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and the beta subunits of the E1 component of the human pyruvate dehydrogenase complex (E1- PDHc), subfamily. The PYR domain is found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor. TPP binds in the cleft formed by a PYR domain and a PP domain. The PYR domain, binds the aminopyrimidine ring of TPP, the PP domain binds the diphosphate residue. A polar interaction between the conserved glutamate of the PYR domain and the N1' of the TPP aminopyrimidine ring is shared by most TPP-dependent enzymes, and participates in the activation of TPP. The PYR and PP domains have a common fold, but do not share strong sequence conservation. The PP domain is not included
Probab=100.00  E-value=4.2e-36  Score=280.41  Aligned_cols=155  Identities=39%  Similarity=0.573  Sum_probs=144.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHCCCCCCEECCCHHH
Q ss_conf             34678889988655433220345556740002666344543200100325762002356787998728876220010035
Q gi|254780655|r  368 KSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVF  447 (673)
Q Consensus       368 ~a~g~~l~~i~~~~p~iv~~sADl~~St~~~~~~~~~~~~~~~p~r~i~~GIaE~~~~~~aaGla~~~g~~p~~~tf~~F  447 (673)
T Consensus         1 ~a~~~~l~~~~~~d~~vv~l~~Dl~~~~~~~------~f~~~~p~r~in~GIaE~~~vg~a~GlA~-~G~~pi~~~~~~F   73 (156)
T cd07033           1 KAFGEALLELAKKDPRIVALSADLGGSTGLD------KFAKKFPDRFIDVGIAEQNMVGIAAGLAL-HGLKPFVSTFSFF   73 (156)
T ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCCCCHH------HHHHHCCCCEECCCCHHHHHHHHHHHHHH-CCCCCCHHHHHHH
T ss_conf             9799999999977979999968767887758------99987897844477019999999999997-5999811357988


Q ss_pred             HHHHHHHHH-HHHHHHCCCEEECCCCCCCCCCCCCHHHHCCCCCHHHHHCCCCEEEECCHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             553001245-4111100001302454333333331010002221011101221121120124577776520256783499
Q gi|254780655|r  448 SDYSRPAIR-LASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVL  526 (673)
Q Consensus       448 ~~~~~~~ir-~~al~~~~v~~v~th~gi~~G~DGpTHq~iedia~lr~iPnl~v~~P~d~~E~~~~~~~al~~~~gP~~i  526 (673)
T Consensus        74 ~~r~~eqi~~~~a~~~~~v~~v~~~~g~~~~~~G~tH~~~ed~~~~~~~Pgl~i~~P~~~~e~~~ll~~a~~~~-~P~~i  152 (156)
T cd07033          74 LQRAYDQIRHDVALQNLPVKFVGTHAGISVGEDGPTHQGIEDIALLRAIPNMTVLRPADANETAAALEAALEYD-GPVYI  152 (156)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHCC-CCEEE
T ss_conf             75109999999775279965997688547778978805500587872389948996199999999999998289-98899


Q ss_pred             EECC
Q ss_conf             9524
Q gi|254780655|r  527 SLSR  530 (673)
Q Consensus       527 r~~R  530 (673)
T Consensus       153 rl~r  156 (156)
T cd07033         153 RLPR  156 (156)
T ss_pred             EEEC
T ss_conf             9769