BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780655|ref|YP_003065068.1| transketolase [Candidatus
Liberibacter asiaticus str. psy62]
         (673 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780655|ref|YP_003065068.1| transketolase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040332|gb|ACT57128.1| transketolase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 673

 Score = 1398 bits (3618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/673 (100%), Positives = 673/673 (100%)

Query: 1   MGHPVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCM 60
           MGHPVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCM
Sbjct: 1   MGHPVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCM 60

Query: 61  VFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYG 120
           VFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYG
Sbjct: 61  VFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYG 120

Query: 121 SCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAI 180
           SCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAI
Sbjct: 121 SCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAI 180

Query: 181 SFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTL 240
           SFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTL
Sbjct: 181 SFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTL 240

Query: 241 RKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDD 300
           RKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDD
Sbjct: 241 RKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDD 300

Query: 301 IMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHS 360
           IMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHS
Sbjct: 301 IMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHS 360

Query: 361 KPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVR 420
           KPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVR
Sbjct: 361 KPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVR 420

Query: 421 EHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDG 480
           EHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDG
Sbjct: 421 EHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDG 480

Query: 481 PTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQY 540
           PTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQY
Sbjct: 481 PTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQY 540

Query: 541 ESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFE 600
           ESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFE
Sbjct: 541 ESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFE 600

Query: 601 QSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINA 660
           QSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINA
Sbjct: 601 QSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINA 660

Query: 661 IAIVDMVERKLSV 673
           IAIVDMVERKLSV
Sbjct: 661 IAIVDMVERKLSV 673


>gi|315122159|ref|YP_004062648.1| transketolase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495561|gb|ADR52160.1| transketolase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 660

 Score = 1155 bits (2988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/655 (84%), Positives = 608/655 (92%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           D YKKMA+AIRFLSMDAIENVNSGHPGLPMGMADV+T LF+Q M FDP+CP WPNRDRFV
Sbjct: 4   DGYKKMANAIRFLSMDAIENVNSGHPGLPMGMADVITVLFSQFMAFDPKCPSWPNRDRFV 63

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSMLYY+LLYLLGYQD+TI+DIK FRTIGSKTAGHPEYG  +GIEATTGPLGQGI
Sbjct: 64  LSAGHGSMLYYSLLYLLGYQDITIDDIKKFRTIGSKTAGHPEYGFLSGIEATTGPLGQGI 123

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           ANAVGMAIAERKLR+EF D LI+HYTYVLVGDGCLMEGISQEAIS AGHLGL+KLIVLWD
Sbjct: 124 ANAVGMAIAERKLRDEFSDALINHYTYVLVGDGCLMEGISQEAISLAGHLGLNKLIVLWD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           NNGISIDG ISLADSTDQ+ARFRASGWNTLSVNGHD++AI S LR+AQ S+KPTMIACET
Sbjct: 184 NNGISIDGSISLADSTDQHARFRASGWNTLSVNGHDYNAIASILREAQESNKPTMIACET 243

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIGFGSPN+AGTNKVHGSALG+EEIKATRKALNW+LDPF IPD+IMK+WR  GLRSSQ R
Sbjct: 244 VIGFGSPNKAGTNKVHGSALGKEEIKATRKALNWNLDPFLIPDEIMKEWRSVGLRSSQIR 303

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           ADWQ  LSS++S ++KEF RRFSD LPDCFDN  + LKKK   SKP +ATRKSSE+VLEV
Sbjct: 304 ADWQSHLSSIESDVQKEFNRRFSDELPDCFDNTIMQLKKKIGESKPEVATRKSSEMVLEV 363

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +NDCLPE+IGGSADLTGSNGTKTSQMK+IS+SDFSGRYLHYGVREHAMAA MNGIALHKG
Sbjct: 364 INDCLPEIIGGSADLTGSNGTKTSQMKSISRSDFSGRYLHYGVREHAMAAVMNGIALHKG 423

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           L PYSGTFMVFSDYSRP+IRLASLMGIRV+HVLTHDSIG+GEDGPTHQPVEH+AALRAIP
Sbjct: 424 LVPYSGTFMVFSDYSRPSIRLASLMGIRVVHVLTHDSIGVGEDGPTHQPVEHMAALRAIP 483

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           +LLV RPADSIETLECWQVALK+K+ PSVLSLSRQNLPFLRTQYE  NLC+LGAYDYI+ 
Sbjct: 484 NLLVFRPADSIETLECWQVALKKKSCPSVLSLSRQNLPFLRTQYEEKNLCSLGAYDYIAC 543

Query: 557 PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
           PNAQV IF+SGSELKIAVEA  +LS+RNIS RV+SVPCFELFFEQSD+YRAQIIG+SP+K
Sbjct: 544 PNAQVAIFASGSELKIAVEARNLLSARNISARVISVPCFELFFEQSDAYRAQIIGTSPVK 603

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           IA+EAGLRQGWD+ IGSDG F+GM+GFG+SGSCDLLYQHFGI A AIV +VERKL
Sbjct: 604 IAVEAGLRQGWDSLIGSDGDFVGMKGFGSSGSCDLLYQHFGITATAIVALVERKL 658


>gi|17986594|ref|NP_539228.1| transketolase [Brucella melitensis bv. 1 str. 16M]
 gi|17982205|gb|AAL51492.1| transketolase [Brucella melitensis bv. 1 str. 16M]
          Length = 707

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/671 (62%), Positives = 536/671 (79%), Gaps = 1/671 (0%)

Query: 4   PVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFD 63
           P  G+    M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  D
Sbjct: 36  PSQGKTAETMTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHD 95

Query: 64  PQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCA 123
           P+ P+WP+RDRFVLSAGHGSML Y+LLYL GY+D+TI++IK FR +GS+TAGHPEYG  A
Sbjct: 96  PKNPHWPDRDRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAA 155

Query: 124 GIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFA 183
           GIE TTGPLGQGIANAVGMAI+ER L  +FGD L++HYTY LVGDGCLMEGISQEAI+ A
Sbjct: 156 GIETTTGPLGQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALA 215

Query: 184 GHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKA 243
           GHL L+KLIVLWD+N ISIDGPI+L+D+TDQ ARF ASGWNT++V+GHD  AI   +  A
Sbjct: 216 GHLKLNKLIVLWDDNNISIDGPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELA 275

Query: 244 QLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMK 303
           ++SD+PT+IAC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++ 
Sbjct: 276 RVSDRPTLIACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSSEPFVVPAEVLD 335

Query: 304 KWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPM 363
            WR+AGL +++ R +W++RLS++++  R EFERR    LP  FD A +  KKK    KP 
Sbjct: 336 AWRVAGLNAAKKRLEWEKRLSAVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSADKPK 395

Query: 364 IATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHA 423
           +ATRKSSE+ LEV+N  +PE +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  
Sbjct: 396 VATRKSSEMALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELG 455

Query: 424 MAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTH 483
           MAAAMNGI LH GL PYSGTF+ FSDY+RPA+RL+SLMGIRV++V+THDSIGLGEDGPTH
Sbjct: 456 MAAAMNGITLHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTH 515

Query: 484 QPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESN 543
           QPVEHLAALRAIP+  V RPAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   
Sbjct: 516 QPVEHLAALRAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREE 575

Query: 544 NLCALGAYDY-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQS 602
           NLCA GAY+   ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QS
Sbjct: 576 NLCAFGAYELAAASSDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQS 635

Query: 603 DSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIA 662
           D+Y+   IG +P+K+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A  
Sbjct: 636 DTYKEATIGDAPVKLAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEH 695

Query: 663 IVDMVERKLSV 673
            V+  E+KL+ 
Sbjct: 696 AVEAAEKKLNA 706


>gi|297248996|ref|ZP_06932704.1| transketolase [Brucella abortus bv. 5 str. B3196]
 gi|297174129|gb|EFH33486.1| transketolase [Brucella abortus bv. 5 str. B3196]
          Length = 707

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/671 (62%), Positives = 536/671 (79%), Gaps = 1/671 (0%)

Query: 4   PVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFD 63
           P  G+    M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  D
Sbjct: 36  PSQGKTAETMTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHD 95

Query: 64  PQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCA 123
           P+ P+WP+RDRFVLSAGHGSML Y+LLYL GY+D+TI++IK FR +GS+TAGHPEYG  A
Sbjct: 96  PKNPHWPDRDRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAA 155

Query: 124 GIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFA 183
           GIE TTGPLGQGIANAVGMAI+ER L  +FGD L++HYTY LVGDGCLMEGISQEAI+ A
Sbjct: 156 GIETTTGPLGQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALA 215

Query: 184 GHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKA 243
           GHL L+KLIVLWD+N ISIDGPI+L+D+TDQ ARF ASGWNT++V+GHD  AI   +  A
Sbjct: 216 GHLKLNKLIVLWDDNNISIDGPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELA 275

Query: 244 QLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMK 303
           ++SD+PT+IAC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++ 
Sbjct: 276 RVSDRPTLIACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSSEPFVVPAEVLD 335

Query: 304 KWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPM 363
            WR+AGL +++ R +W++RLS++++  R EFERR    LP  FD A +  KKK    KP 
Sbjct: 336 AWRVAGLNAAKKRLEWEKRLSAVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSADKPK 395

Query: 364 IATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHA 423
           +ATRKSSE+ LEV+N  +PE +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  
Sbjct: 396 VATRKSSEMALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELG 455

Query: 424 MAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTH 483
           MAAAMNGI LH GL PYSGTF+ FSDY+RPA+RL+SLMGIRV++V+THDSIGLGEDGPTH
Sbjct: 456 MAAAMNGITLHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTH 515

Query: 484 QPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESN 543
           QPVEHLAALRAIP+  V RPAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   
Sbjct: 516 QPVEHLAALRAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREE 575

Query: 544 NLCALGAYDY-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQS 602
           NLCA GAY+   ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QS
Sbjct: 576 NLCAFGAYELAAASSDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQS 635

Query: 603 DSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIA 662
           D+Y+   IG +P+K+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A  
Sbjct: 636 DAYKEATIGDAPVKLAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEH 695

Query: 663 IVDMVERKLSV 673
            V+  E+KL+ 
Sbjct: 696 AVEAAEKKLNA 706


>gi|148559589|ref|YP_001259578.1| transketolase [Brucella ovis ATCC 25840]
 gi|225628295|ref|ZP_03786329.1| transketolase [Brucella ceti str. Cudo]
 gi|237816102|ref|ZP_04595098.1| transketolase [Brucella abortus str. 2308 A]
 gi|148370846|gb|ABQ60825.1| transketolase [Brucella ovis ATCC 25840]
 gi|225616141|gb|EEH13189.1| transketolase [Brucella ceti str. Cudo]
 gi|237788765|gb|EEP62977.1| transketolase [Brucella abortus str. 2308 A]
          Length = 738

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/671 (62%), Positives = 536/671 (79%), Gaps = 1/671 (0%)

Query: 4   PVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFD 63
           P  G+    M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  D
Sbjct: 67  PSQGKTAETMTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHD 126

Query: 64  PQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCA 123
           P+ P+WP+RDRFVLSAGHGSML Y+LLYL GY+D+TI++IK FR +GS+TAGHPEYG  A
Sbjct: 127 PKNPHWPDRDRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAA 186

Query: 124 GIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFA 183
           GIE TTGPLGQGIANAVGMAI+ER L  +FGD L++HYTY LVGDGCLMEGISQEAI+ A
Sbjct: 187 GIETTTGPLGQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALA 246

Query: 184 GHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKA 243
           GHL L+KLIVLWD+N ISIDGPI+L+D+TDQ ARF ASGWNT++V+GHD  AI   +  A
Sbjct: 247 GHLKLNKLIVLWDDNNISIDGPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELA 306

Query: 244 QLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMK 303
           ++SD+PT+IAC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++ 
Sbjct: 307 RVSDRPTLIACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSSEPFVVPAEVLD 366

Query: 304 KWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPM 363
            WR+AGL +++ R +W++RLS++++  R EFERR    LP  FD A +  KKK    KP 
Sbjct: 367 AWRVAGLNAAKKRLEWEKRLSAVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSADKPK 426

Query: 364 IATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHA 423
           +ATRKSSE+ LEV+N  +PE +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  
Sbjct: 427 VATRKSSEMALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELG 486

Query: 424 MAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTH 483
           MAAAMNGI LH GL PYSGTF+ FSDY+RPA+RL+SLMGIRV++V+THDSIGLGEDGPTH
Sbjct: 487 MAAAMNGITLHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTH 546

Query: 484 QPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESN 543
           QPVEHLAALRAIP+  V RPAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   
Sbjct: 547 QPVEHLAALRAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREE 606

Query: 544 NLCALGAYDY-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQS 602
           NLCA GAY+   ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QS
Sbjct: 607 NLCAFGAYELAAASSDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQS 666

Query: 603 DSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIA 662
           D+Y+   IG +P+K+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A  
Sbjct: 667 DAYKEATIGDAPVKLAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEH 726

Query: 663 IVDMVERKLSV 673
            V+  E+KL+ 
Sbjct: 727 AVEAAEKKLNA 737


>gi|294850976|ref|ZP_06791652.1| transketolase [Brucella sp. NVSL 07-0026]
 gi|294821619|gb|EFG38615.1| transketolase [Brucella sp. NVSL 07-0026]
          Length = 684

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/671 (62%), Positives = 535/671 (79%), Gaps = 1/671 (0%)

Query: 4   PVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFD 63
           P  G+    M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  D
Sbjct: 13  PSQGKTAETMTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHD 72

Query: 64  PQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCA 123
           P+ P+WP+RDRFVLSAGHGSML Y+LLYL GY+D+TI++IK FR +GS+TAGHPEYG  A
Sbjct: 73  PKNPHWPDRDRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAA 132

Query: 124 GIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFA 183
           GIE TTGPLGQGIANAVGMAI+ER L  +FGD L++HYTY LVGDGCLMEGISQEAI+ A
Sbjct: 133 GIETTTGPLGQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALA 192

Query: 184 GHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKA 243
           GHL L+KLIVLWD+N ISIDGPI+L+D+TDQ ARF AS WNT++V+GHD  AI   +  A
Sbjct: 193 GHLKLNKLIVLWDDNNISIDGPITLSDNTDQPARFAASSWNTMAVDGHDQDAIAKAIELA 252

Query: 244 QLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMK 303
           ++SD+PT+IAC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++ 
Sbjct: 253 RVSDRPTLIACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSSEPFVVPAEVLD 312

Query: 304 KWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPM 363
            WR+AGL +++ R +W++RLS++++  R EFERR    LP  FD A +  KKK    KP 
Sbjct: 313 AWRVAGLNAAKKRLEWEKRLSAVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSADKPK 372

Query: 364 IATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHA 423
           +ATRKSSE+ LEV+N  +PE +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  
Sbjct: 373 VATRKSSEMALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELG 432

Query: 424 MAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTH 483
           MAAAMNGI LH GL PYSGTF+ FSDY+RPA+RL+SLMGIRV++V+THDSIGLGEDGPTH
Sbjct: 433 MAAAMNGITLHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTH 492

Query: 484 QPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESN 543
           QPVEHLAALRAIP+  V RPAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   
Sbjct: 493 QPVEHLAALRAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREE 552

Query: 544 NLCALGAYDY-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQS 602
           NLCA GAY+   ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QS
Sbjct: 553 NLCAFGAYELAAASSDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQS 612

Query: 603 DSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIA 662
           D+Y+   IG +P+K+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A  
Sbjct: 613 DAYKEATIGDAPVKLAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEH 672

Query: 663 IVDMVERKLSV 673
            V+  E+KL+ 
Sbjct: 673 AVEAAEKKLNA 683


>gi|254719727|ref|ZP_05181538.1| transketolase [Brucella sp. 83/13]
 gi|265984742|ref|ZP_06097477.1| transketolase [Brucella sp. 83/13]
 gi|306839920|ref|ZP_07472716.1| transketolase [Brucella sp. NF 2653]
 gi|264663334|gb|EEZ33595.1| transketolase [Brucella sp. 83/13]
 gi|306404987|gb|EFM61270.1| transketolase [Brucella sp. NF 2653]
          Length = 663

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/661 (63%), Positives = 532/661 (80%), Gaps = 1/661 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  DP+ P+WP+R
Sbjct: 1   MTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHDPKNPHWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYL GY+D+TI++IK FR +GS+TAGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIANAVGMAI+ER L  +FGD L++HYTY LVGDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VLWD+N ISIDGPI+L+D+TDQ ARF ASGWNT++V+GHD  AI   +  A++SD+PT+I
Sbjct: 181 VLWDDNNISIDGPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELARVSDRPTLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++  WR+AGL +
Sbjct: 241 ACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSSEPFVVPAEVLDAWRVAGLNA 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R +W++RLS++++  R EFERR    LP  FD A +  KKK    KP +ATRKSSE+
Sbjct: 301 AKKRLEWEKRLSAVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSADKPKVATRKSSEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  MAAAMNGI 
Sbjct: 361 ALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELGMAAAMNGIT 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PYSGTF+ FSDY+RPA+RL+SLMGIRV++V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 421 LHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTHQPVEHLAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   NLCA GAY+
Sbjct: 481 RAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREENLCAFGAYE 540

Query: 553 YISTPN-AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
             +  N A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QSD+Y+   IG
Sbjct: 541 LAAASNDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQSDAYKEATIG 600

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +P+K+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A   V+  E+KL
Sbjct: 601 DAPVKLAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEHAVEAAEKKL 660

Query: 672 S 672
           +
Sbjct: 661 N 661


>gi|161619653|ref|YP_001593540.1| transketolase [Brucella canis ATCC 23365]
 gi|260568809|ref|ZP_05839277.1| transketolase [Brucella suis bv. 4 str. 40]
 gi|161336464|gb|ABX62769.1| transketolase [Brucella canis ATCC 23365]
 gi|260154193|gb|EEW89275.1| transketolase [Brucella suis bv. 4 str. 40]
          Length = 663

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/662 (63%), Positives = 534/662 (80%), Gaps = 1/662 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  DP+ P+WP+R
Sbjct: 1   MTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHDPKNPHWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYL GY+D+TI++IK FR +GS+TAGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIANAVGMAI+ER L  +FGD L++HYTY LVGDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VLWD+N ISIDGPI+L+D+TDQ ARF ASGWNT++V+GHD  AI   +  A++SD+PT+I
Sbjct: 181 VLWDDNNISIDGPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELARVSDRPTLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++  WR+AGL +
Sbjct: 241 ACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSSEPFVVPAEVLDAWRVAGLNA 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R +W++RLS++++  R EFERR    LP  FD A +  KKK   +KP +ATRKSSE+
Sbjct: 301 AKKRLEWEKRLSAVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSANKPKVATRKSSEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  MAAAMNGI 
Sbjct: 361 ALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELGMAAAMNGIT 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PYSGTF+ FSDY+RPA+RL+SLMGIRV++V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 421 LHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTHQPVEHLAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   NLCA GAY+
Sbjct: 481 RAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREENLCAFGAYE 540

Query: 553 Y-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QSD+Y+   IG
Sbjct: 541 LAAASSDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQSDAYKEATIG 600

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +PIK+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A   V+  E+KL
Sbjct: 601 DAPIKLAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEHAVEAAEKKL 660

Query: 672 SV 673
           + 
Sbjct: 661 NA 662


>gi|225853181|ref|YP_002733414.1| transketolase [Brucella melitensis ATCC 23457]
 gi|256045334|ref|ZP_05448228.1| transketolase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256114292|ref|ZP_05455037.1| transketolase [Brucella melitensis bv. 3 str. Ether]
 gi|256263329|ref|ZP_05465861.1| transketolase [Brucella melitensis bv. 2 str. 63/9]
 gi|260565774|ref|ZP_05836257.1| transketolase [Brucella melitensis bv. 1 str. 16M]
 gi|265991759|ref|ZP_06104316.1| transketolase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995598|ref|ZP_06108155.1| transketolase [Brucella melitensis bv. 3 str. Ether]
 gi|225641546|gb|ACO01460.1| transketolase [Brucella melitensis ATCC 23457]
 gi|260151147|gb|EEW86242.1| transketolase [Brucella melitensis bv. 1 str. 16M]
 gi|262766882|gb|EEZ12500.1| transketolase [Brucella melitensis bv. 3 str. Ether]
 gi|263002715|gb|EEZ15118.1| transketolase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093327|gb|EEZ17396.1| transketolase [Brucella melitensis bv. 2 str. 63/9]
          Length = 663

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/661 (63%), Positives = 533/661 (80%), Gaps = 1/661 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  DP+ P+WP+R
Sbjct: 1   MTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHDPKNPHWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYL GY+D+TI++IK FR +GS+TAGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIANAVGMAI+ER L  +FGD L++HYTY LVGDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VLWD+N ISIDGPI+L+D+TDQ ARF ASGWNT++V+GHD  AI   +  A++SD+PT+I
Sbjct: 181 VLWDDNNISIDGPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELARVSDRPTLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++  WR+AGL +
Sbjct: 241 ACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSSEPFVVPAEVLDAWRVAGLNA 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R +W++RLS++++  R EFERR    LP  FD A +  KKK    KP +ATRKSSE+
Sbjct: 301 AKKRLEWEKRLSAVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSADKPKVATRKSSEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  MAAAMNGI 
Sbjct: 361 ALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELGMAAAMNGIT 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PYSGTF+ FSDY+RPA+RL+SLMGIRV++V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 421 LHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTHQPVEHLAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   NLCA GAY+
Sbjct: 481 RAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREENLCAFGAYE 540

Query: 553 Y-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QSD+Y+   IG
Sbjct: 541 LAAASSDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQSDTYKEATIG 600

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +P+K+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A   V+  E+KL
Sbjct: 601 DAPVKLAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEHAVEAAEKKL 660

Query: 672 S 672
           +
Sbjct: 661 N 661


>gi|23502584|ref|NP_698711.1| transketolase [Brucella suis 1330]
 gi|254703502|ref|ZP_05165330.1| transketolase [Brucella suis bv. 3 str. 686]
 gi|261754134|ref|ZP_05997843.1| transketolase [Brucella suis bv. 3 str. 686]
 gi|23348586|gb|AAN30626.1| transketolase [Brucella suis 1330]
 gi|261743887|gb|EEY31813.1| transketolase [Brucella suis bv. 3 str. 686]
          Length = 663

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/662 (63%), Positives = 533/662 (80%), Gaps = 1/662 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  DP+ P+WP+R
Sbjct: 1   MTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHDPKNPHWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYL GY+D+TI++IK FR +GS+TAGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIANAVGMAI+ER L  +FGD L++HYTY LVGDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VLWD+N ISIDGPI+L+D+TDQ ARF ASGWNT++V+GHD  AI   +  A++SD+PT+I
Sbjct: 181 VLWDDNNISIDGPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELARVSDRPTLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++  WR+AGL +
Sbjct: 241 ACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSSEPFVVPAEVLDAWRVAGLNA 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R +W++RLS++++  R EFERR    LP  FD A +  KKK    KP +ATRKSSE+
Sbjct: 301 AKKRLEWEKRLSAVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSADKPKVATRKSSEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  MAAAMNGI 
Sbjct: 361 ALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELGMAAAMNGIT 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PYSGTF+ FSDY+RPA+RL+SLMGIRV++V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 421 LHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTHQPVEHLAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   NLCA GAY+
Sbjct: 481 RAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREENLCAFGAYE 540

Query: 553 Y-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QSD+Y+   IG
Sbjct: 541 LAAASSDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQSDAYKEATIG 600

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +PIK+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A   V+  E+KL
Sbjct: 601 DAPIKLAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEHAVEAAEKKL 660

Query: 672 SV 673
           + 
Sbjct: 661 NA 662


>gi|163758822|ref|ZP_02165909.1| transketolase [Hoeflea phototrophica DFL-43]
 gi|162284112|gb|EDQ34396.1| transketolase [Hoeflea phototrophica DFL-43]
          Length = 663

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/647 (65%), Positives = 508/647 (78%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   + + +MA+AIRFLSMDA+E   SGHPGLPMG AD+ T LF++ + FDP+ P WP+R
Sbjct: 1   MNSREKHDRMANAIRFLSMDAVEKAKSGHPGLPMGAADIATVLFSRYLTFDPKQPDWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYLLGY D+++EDIKNFR +GS TAGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLIYSLLYLLGYDDISLEDIKNFRQLGSPTAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+ANAVGMAIAERKL +E+G  L+DH+TYVL GDGCLMEGISQEAIS AGHL L+KLI
Sbjct: 121 GQGLANAVGMAIAERKLADEYGADLVDHHTYVLAGDGCLMEGISQEAISLAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           V WDNN ISIDG ISL DST+Q ARF ASGWNTL ++GHD  AI   +  A+ SD+PT+I
Sbjct: 181 VFWDNNSISIDGAISLTDSTNQPARFAASGWNTLEIDGHDPDAIAQAIESAKASDRPTLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           A +TVIGFG+PN+AG+   HG+ LG +EI+  R AL WD +PF +P DI+  WRLAGLRS
Sbjct: 241 AAKTVIGFGAPNKAGSKDAHGAPLGAKEIEGARAALGWDEEPFVVPSDILDAWRLAGLRS 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            + R  W+ RL+  ++ IR  FERR +  LP  F  A    K+K     P +ATRK+SE+
Sbjct: 301 VKDRKAWEARLAEAENDIRMTFERRMNGELPGGFAPAITAYKEKLAQDLPTVATRKASEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE +GGSADLTGSN T+TSQ  AI+  DFSGRY+HYG+REH MAA MNGIA
Sbjct: 361 ALEVINGAVPETLGGSADLTGSNNTRTSQTLAITPDDFSGRYIHYGIREHGMAAMMNGIA 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PYSG F++FSDY RP++RLA+LMGIRVIHVLTHDSIGLGEDGPTHQPVEH+AAL
Sbjct: 421 LHGGLIPYSGGFLIFSDYCRPSLRLAALMGIRVIHVLTHDSIGLGEDGPTHQPVEHMAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+ L  RPAD +ET ECWQ+AL+++ RPS ++L+RQNLP  RT Y   NLCA GAYD
Sbjct: 481 RAIPNFLTFRPADVVETAECWQIALEQQKRPSGIALTRQNLPVARTDYTEENLCAYGAYD 540

Query: 553 YISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
            IS  +A VTIF+SGSE++IA+EA + L +   +TRVVSVPCFELF EQS  Y++ +IG 
Sbjct: 541 LISASDADVTIFASGSEIEIALEAHKTLEANGHTTRVVSVPCFELFEEQSAEYKSAVIGD 600

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           S +KIAIEAG+RQGWD FIGSDG FIGM GFGAS     LY+HFGI 
Sbjct: 601 SKVKIAIEAGIRQGWDRFIGSDGLFIGMTGFGASAPYKELYEHFGIT 647


>gi|150397848|ref|YP_001328315.1| transketolase [Sinorhizobium medicae WSM419]
 gi|150029363|gb|ABR61480.1| transketolase [Sinorhizobium medicae WSM419]
          Length = 651

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/651 (68%), Positives = 533/651 (81%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T LFT+ + FDP+ P WPNRDRFVLSAGH
Sbjct: 1   MANAIRFLSMDAVEKANSGHPGLPMGAADIATVLFTRYLSFDPKNPAWPNRDRFVLSAGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+LLYL GY D+TI++IKNFR +GS+TAGHPEYG  AGIE TTGPLGQGIAN+VG
Sbjct: 61  GSMLLYSLLYLTGYDDITIDEIKNFRQLGSRTAGHPEYGHAAGIETTTGPLGQGIANSVG 120

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MAIAERKLREEFG  L++HYTYVL GDGCLMEG+SQEAI+ AGHL L+KLIV WD+N IS
Sbjct: 121 MAIAERKLREEFGSELMEHYTYVLAGDGCLMEGVSQEAIALAGHLKLNKLIVFWDDNNIS 180

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDGPISLADSTDQ+ARFRA  W+T++VNGHD  AI + + +AQ SDKPTMIAC+TVIGFG
Sbjct: 181 IDGPISLADSTDQHARFRACKWHTIAVNGHDPEAIAAAIEEAQKSDKPTMIACKTVIGFG 240

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +PN+AGT+KVHGS LG EEI ATRKAL W+ + F +P D++  WR+AGLRS++ R +W+E
Sbjct: 241 APNKAGTHKVHGSPLGAEEIAATRKALGWEAEAFTVPSDVLDAWRIAGLRSAKARKEWEE 300

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           RL + ++  +  F RRFS  L     +A    K+K   +KP  ATRK+SE  LEV+N  L
Sbjct: 301 RLEAAEAEKKAHFIRRFSGELEGSLASAISAYKQKLAETKPSPATRKASEDALEVINGVL 360

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
            E IGGSADLTGSN TKTSQ  +I+  DFSGRY+HYGVREH MAAAMNG+ALH GL PYS
Sbjct: 361 AETIGGSADLTGSNNTKTSQTHSITPDDFSGRYIHYGVREHGMAAAMNGMALHGGLIPYS 420

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           G F++FSDY RP+IRLA+LMGIRVIHVLTHDSIGLGEDGPTHQPVEH+AALRAIP+LL+ 
Sbjct: 421 GGFLIFSDYCRPSIRLAALMGIRVIHVLTHDSIGLGEDGPTHQPVEHMAALRAIPNLLMF 480

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQV 561
           RPAD+ ET ECWQ+AL+ + RPS L+L+RQNL  +RT+YE  NLCA GAYD IS  +AQV
Sbjct: 481 RPADATETAECWQLALENRKRPSGLALTRQNLMAVRTEYEEQNLCARGAYDLISASDAQV 540

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
           TIF++GSE++IAV+AC+ L+++ I+TRVVSVPCFELF EQS+ Y+  IIG+SP+KIA+EA
Sbjct: 541 TIFATGSEVEIAVKACQTLTAKGIATRVVSVPCFELFAEQSEDYQQAIIGTSPVKIAVEA 600

Query: 622 GLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           G+RQGWD FIG+DG FIGM  FGASG    LY+HFGI    +V   E KLS
Sbjct: 601 GIRQGWDHFIGNDGIFIGMSSFGASGPYKDLYKHFGITPEVVVASAEAKLS 651


>gi|15966515|ref|NP_386868.1| transketolase [Sinorhizobium meliloti 1021]
 gi|307300447|ref|ZP_07580227.1| transketolase [Sinorhizobium meliloti BL225C]
 gi|307318312|ref|ZP_07597747.1| transketolase [Sinorhizobium meliloti AK83]
 gi|15075786|emb|CAC47341.1| Probable transketolase [Sinorhizobium meliloti 1021]
 gi|306895994|gb|EFN26745.1| transketolase [Sinorhizobium meliloti AK83]
 gi|306904613|gb|EFN35197.1| transketolase [Sinorhizobium meliloti BL225C]
          Length = 660

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/656 (67%), Positives = 537/656 (81%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + + +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T LFT+ + FDP+ P WPNRDRFV
Sbjct: 5   EKHDRMANAIRFLSMDAVEKANSGHPGLPMGAADIATVLFTRYLSFDPKNPAWPNRDRFV 64

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSML Y+LLYL GY D+TI++IKNFR +GS+TAGHPEYG  AGIE TTGPLGQGI
Sbjct: 65  LSAGHGSMLLYSLLYLTGYDDITIDEIKNFRQLGSRTAGHPEYGHAAGIETTTGPLGQGI 124

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           AN+VGMAIAERKLREEFG  L++HYTYVL GDGCLMEGISQEAI+ AGHL L+KLIV WD
Sbjct: 125 ANSVGMAIAERKLREEFGSELMEHYTYVLAGDGCLMEGISQEAIALAGHLKLNKLIVFWD 184

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +N ISIDGPIS+ADSTDQ+ARFRAS W+T++V+GHD  AI + + +A  SDKPTMIAC+T
Sbjct: 185 DNNISIDGPISIADSTDQHARFRASKWHTIAVDGHDPEAIAAAIEEAHKSDKPTMIACKT 244

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIGFG+PN+AGT+KVHGS LG EEI ATRKAL W+ + F +P D++  WR+AGLRS++ R
Sbjct: 245 VIGFGAPNKAGTHKVHGSPLGAEEIAATRKALGWEAEAFTVPSDVLDAWRIAGLRSAKAR 304

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
            +W+ERL + ++  + +F RRFS  L     +A    K+K   +KP  ATRK+SE  LEV
Sbjct: 305 KEWEERLEAAEAEKKAQFVRRFSGELEGSLASAIGAYKQKLAETKPSPATRKASEDALEV 364

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +N  L E IGGSADLTGSN TKTSQ  +I+  DFSGRY+HYGVREH MAAAMNG+ALH G
Sbjct: 365 INGVLAETIGGSADLTGSNNTKTSQTHSITPDDFSGRYIHYGVREHGMAAAMNGMALHGG 424

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           L PYSG F++FSDY RP+IRLA+LMGIRVIHVLTHDSIGLGEDGPTHQPVEH+AALRAIP
Sbjct: 425 LIPYSGGFLIFSDYCRPSIRLAALMGIRVIHVLTHDSIGLGEDGPTHQPVEHMAALRAIP 484

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           +LL+ RPAD+ ET ECWQ+AL+ + RPS L+L+RQNL  +RT+YE  NLCA GAYD IS 
Sbjct: 485 NLLMFRPADATETAECWQLALENRKRPSGLALTRQNLMAVRTEYEEQNLCARGAYDLISA 544

Query: 557 PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
            +AQVTIF++GSE++IAV+AC+ L+++ I+TRVVSVPCFELF EQS+ Y+  IIG+SP+K
Sbjct: 545 SDAQVTIFATGSEVEIAVKACQTLTAKGIATRVVSVPCFELFAEQSEDYQQAIIGTSPVK 604

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           IA+EAG+RQGWD FIG+DG FIGM  FGASG    LY+HFGI    +V   E KLS
Sbjct: 605 IAVEAGIRQGWDHFIGNDGIFIGMSSFGASGPYKDLYKHFGITPEVVVASAEAKLS 660


>gi|49476166|ref|YP_034207.1| transketolase [Bartonella henselae str. Houston-1]
 gi|49238974|emb|CAF28272.1| Transketolase [Bartonella henselae str. Houston-1]
          Length = 668

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/660 (65%), Positives = 521/660 (78%), Gaps = 2/660 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   +  K+MA+AIRFL++DAIE  NSGHPGLPMG AD+ T L+T+ +  DP+ P+WPNR
Sbjct: 1   MTNTETKKQMANAIRFLAIDAIEKANSGHPGLPMGAADIATVLYTKFLAHDPKNPHWPNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML YALLYL GY+D+++ED+KNFR IGSK AGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYALLYLSGYEDISLEDLKNFRQIGSKVAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIANAVGMA+ ER L   FGD LI+HYTY LVGDGCLMEGISQEA+S AGHL L+KLI
Sbjct: 121 GQGIANAVGMALGERLLNARFGD-LINHYTYALVGDGCLMEGISQEALSLAGHLKLNKLI 179

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VLWD+N ISIDG ISLADSTDQ ARF+ASGWNT  V+GHD  AI   +  A+ SDKPT+I
Sbjct: 180 VLWDDNNISIDGEISLADSTDQIARFKASGWNTHKVDGHDQAAIARAIEAARNSDKPTLI 239

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+AGTNK+HG+ LG  EI  TR AL W+ +PF IP DI+  WRLAGL +
Sbjct: 240 ACKTTIGFGAPNKAGTNKIHGAPLGASEIAETRIALGWEAEPFVIPADILDNWRLAGLNA 299

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R  W+E+ +++  S R EFER     L   FD A    KKK     P +ATRK+SE+
Sbjct: 300 AKKRQKWKEKFAALPLSERIEFERLMRGDLVGGFDGAIDVYKKKLVEDCPCVATRKASEM 359

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N+ + E IGGSADLTGSN TK+SQMK IS  DFSGRYLHYGVREHAM A MNG+A
Sbjct: 360 ALEVINEVVLETIGGSADLTGSNNTKSSQMKTISAEDFSGRYLHYGVREHAMGAVMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G  PY GTF+ FSDY RPA+RL+SLMG+RVI+V+THDSIGLGEDGPTHQPVEHLA+L
Sbjct: 420 LYGGFIPYGGTFLCFSDYMRPAMRLSSLMGLRVIYVMTHDSIGLGEDGPTHQPVEHLASL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           R +P+ LV RPAD++ET+ECWQ+ALK +  PS L+LSRQNLP LR +YE  NLC LGAY+
Sbjct: 480 RTLPNHLVFRPADAMETVECWQLALKTRGTPSTLALSRQNLPLLRREYEEENLCMLGAYE 539

Query: 553 YIS-TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
            ++ + +AQVT+F+SGSEL+IAV A  +L  + I TRVVSVPCFELF +QS SY+  +IG
Sbjct: 540 LLTASDDAQVTLFASGSELQIAVHAHAVLEEKGIPTRVVSVPCFELFTQQSPSYQRALIG 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +PIKIAIEA LRQGWD FIG++G FIGMQGFGASG+ D LY HFGI    +V  VE+KL
Sbjct: 600 DAPIKIAIEAALRQGWDYFIGTNGVFIGMQGFGASGTIDALYAHFGITCENVVAAVEKKL 659


>gi|62290599|ref|YP_222392.1| transketolase [Brucella abortus bv. 1 str. 9-941]
 gi|82700516|ref|YP_415090.1| transketolase [Brucella melitensis biovar Abortus 2308]
 gi|189024815|ref|YP_001935583.1| transketolase [Brucella abortus S19]
 gi|254689893|ref|ZP_05153147.1| transketolase [Brucella abortus bv. 6 str. 870]
 gi|254694385|ref|ZP_05156213.1| transketolase [Brucella abortus bv. 3 str. Tulya]
 gi|254698043|ref|ZP_05159871.1| transketolase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700385|ref|ZP_05162213.1| transketolase [Brucella suis bv. 5 str. 513]
 gi|254714584|ref|ZP_05176395.1| transketolase [Brucella ceti M644/93/1]
 gi|254717481|ref|ZP_05179292.1| transketolase [Brucella ceti M13/05/1]
 gi|254730927|ref|ZP_05189505.1| transketolase [Brucella abortus bv. 4 str. 292]
 gi|256061763|ref|ZP_05451898.1| transketolase [Brucella neotomae 5K33]
 gi|256160439|ref|ZP_05458128.1| transketolase [Brucella ceti M490/95/1]
 gi|256255645|ref|ZP_05461181.1| transketolase [Brucella ceti B1/94]
 gi|256258146|ref|ZP_05463682.1| transketolase [Brucella abortus bv. 9 str. C68]
 gi|256370134|ref|YP_003107645.1| transketolase [Brucella microti CCM 4915]
 gi|260167939|ref|ZP_05754750.1| transketolase [Brucella sp. F5/99]
 gi|260547160|ref|ZP_05822898.1| transketolase [Brucella abortus NCTC 8038]
 gi|260755425|ref|ZP_05867773.1| transketolase [Brucella abortus bv. 6 str. 870]
 gi|260758647|ref|ZP_05870995.1| transketolase [Brucella abortus bv. 4 str. 292]
 gi|260762479|ref|ZP_05874816.1| transketolase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884441|ref|ZP_05896055.1| transketolase [Brucella abortus bv. 9 str. C68]
 gi|261214695|ref|ZP_05928976.1| transketolase [Brucella abortus bv. 3 str. Tulya]
 gi|261219314|ref|ZP_05933595.1| transketolase [Brucella ceti M13/05/1]
 gi|261222848|ref|ZP_05937129.1| transketolase [Brucella ceti B1/94]
 gi|261322375|ref|ZP_05961572.1| transketolase [Brucella ceti M644/93/1]
 gi|261325765|ref|ZP_05964962.1| transketolase [Brucella neotomae 5K33]
 gi|261750881|ref|ZP_05994590.1| transketolase [Brucella suis bv. 5 str. 513]
 gi|261757379|ref|ZP_06001088.1| transketolase [Brucella sp. F5/99]
 gi|265998807|ref|ZP_06111364.1| transketolase [Brucella ceti M490/95/1]
 gi|306841445|ref|ZP_07474146.1| transketolase [Brucella sp. BO2]
 gi|306844717|ref|ZP_07477302.1| transketolase [Brucella sp. BO1]
 gi|62196731|gb|AAX75031.1| Tkt, transketolase [Brucella abortus bv. 1 str. 9-941]
 gi|82616617|emb|CAJ11696.1| Transketolase, N terminal:Transketolase, central
           region:Transketolase, C terminal:Bacterial transketolase
           [Brucella melitensis biovar Abortus 2308]
 gi|189020387|gb|ACD73109.1| transketolase [Brucella abortus S19]
 gi|256000297|gb|ACU48696.1| transketolase [Brucella microti CCM 4915]
 gi|260095525|gb|EEW79403.1| transketolase [Brucella abortus NCTC 8038]
 gi|260668965|gb|EEX55905.1| transketolase [Brucella abortus bv. 4 str. 292]
 gi|260672905|gb|EEX59726.1| transketolase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675533|gb|EEX62354.1| transketolase [Brucella abortus bv. 6 str. 870]
 gi|260873969|gb|EEX81038.1| transketolase [Brucella abortus bv. 9 str. C68]
 gi|260916302|gb|EEX83163.1| transketolase [Brucella abortus bv. 3 str. Tulya]
 gi|260921432|gb|EEX88085.1| transketolase [Brucella ceti B1/94]
 gi|260924403|gb|EEX90971.1| transketolase [Brucella ceti M13/05/1]
 gi|261295065|gb|EEX98561.1| transketolase [Brucella ceti M644/93/1]
 gi|261301745|gb|EEY05242.1| transketolase [Brucella neotomae 5K33]
 gi|261737363|gb|EEY25359.1| transketolase [Brucella sp. F5/99]
 gi|261740634|gb|EEY28560.1| transketolase [Brucella suis bv. 5 str. 513]
 gi|262553496|gb|EEZ09265.1| transketolase [Brucella ceti M490/95/1]
 gi|306274889|gb|EFM56659.1| transketolase [Brucella sp. BO1]
 gi|306288483|gb|EFM59838.1| transketolase [Brucella sp. BO2]
          Length = 663

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/661 (63%), Positives = 533/661 (80%), Gaps = 1/661 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  DP+ P+WP+R
Sbjct: 1   MTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHDPKNPHWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYL GY+D+TI++IK FR +GS+TAGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIANAVGMAI+ER L  +FGD L++HYTY LVGDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VLWD+N ISIDGPI+L+D+TDQ ARF ASGWNT++V+GHD  AI   +  A++SD+PT+I
Sbjct: 181 VLWDDNNISIDGPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELARVSDRPTLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++  WR+AGL +
Sbjct: 241 ACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSSEPFVVPAEVLDAWRVAGLNA 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R +W++RLS++++  R EFERR    LP  FD A +  KKK    KP +ATRKSSE+
Sbjct: 301 AKKRLEWEKRLSAVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSADKPKVATRKSSEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  MAAAMNGI 
Sbjct: 361 ALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELGMAAAMNGIT 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PYSGTF+ FSDY+RPA+RL+SLMGIRV++V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 421 LHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTHQPVEHLAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   NLCA GAY+
Sbjct: 481 RAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREENLCAFGAYE 540

Query: 553 Y-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QSD+Y+   IG
Sbjct: 541 LAAASSDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQSDAYKEATIG 600

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +P+K+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A   V+  E+KL
Sbjct: 601 DAPVKLAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEHAVEAAEKKL 660

Query: 672 S 672
           +
Sbjct: 661 N 661


>gi|163845304|ref|YP_001622959.1| transketolase [Brucella suis ATCC 23445]
 gi|163676027|gb|ABY40137.1| transketolase [Brucella suis ATCC 23445]
          Length = 663

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/661 (63%), Positives = 533/661 (80%), Gaps = 1/661 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  DP+ P+WP+R
Sbjct: 1   MTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHDPKNPHWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYL GY+D+TI++IK FR +GS+TAGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIANAVGMAI+ER L  +FGD L++HYTY LVGDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VLWD+N ISIDGPI+L+D+TDQ ARF ASGWNT++V+GHD  AI   +  A++SD+PT+I
Sbjct: 181 VLWDDNNISIDGPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELARVSDRPTLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++  WR+AGL +
Sbjct: 241 ACKTTIGFGAPNKAGTNKVHGSPLGVEEIAATRKALGWSSEPFVVPAEVLDAWRVAGLNA 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R +W++RLS++++  R EFERR    LP  FD A +  KKK    KP +ATRKSSE+
Sbjct: 301 AKKRLEWEKRLSAVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSADKPKVATRKSSEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  MAAAMNGI 
Sbjct: 361 ALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELGMAAAMNGIT 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PYSGTF+ FSDY+RPA+RL+SLMGIRV++V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 421 LHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTHQPVEHLAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   NLCA GAY+
Sbjct: 481 RAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREENLCAFGAYE 540

Query: 553 Y-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QSD+Y+   IG
Sbjct: 541 LAAASSDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQSDAYKEATIG 600

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +PIK+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A   V+  E+KL
Sbjct: 601 DAPIKLAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEHAVEAAEKKL 660

Query: 672 S 672
           +
Sbjct: 661 N 661


>gi|326409739|gb|ADZ66804.1| transketolase [Brucella melitensis M28]
 gi|326539450|gb|ADZ87665.1| transketolase [Brucella melitensis M5-90]
          Length = 663

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/661 (63%), Positives = 532/661 (80%), Gaps = 1/661 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  DP+ P+WP+R
Sbjct: 1   MTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHDPKNPHWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYL GY+D+TI++IK FR +GS+TAGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIANAVGMAI+ER L  +FGD L++HYTY LVGDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VLWD+N ISIDGPI+L+D+TDQ ARF ASGWNT++V+GHD  AI   +  A++SD+PT+I
Sbjct: 181 VLWDDNNISIDGPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELARVSDRPTLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++  WR+AGL +
Sbjct: 241 ACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSSEPFVVPAEVLDAWRVAGLNA 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R +W++RLS++++  R EFERR    LP  FD A +  KKK    KP +ATRKSSE+
Sbjct: 301 AKKRLEWEKRLSAVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSADKPKVATRKSSEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  MAAAMNGI 
Sbjct: 361 ALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELGMAAAMNGIT 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PYSGTF+ FSDY+RPA+RL+SLMGIRV++V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 421 LHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTHQPVEHLAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   NLCA GAY+
Sbjct: 481 RAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREENLCAFGAYE 540

Query: 553 Y-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QSD+Y+   IG
Sbjct: 541 LAAASSDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQSDTYKEATIG 600

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +P+K+AIEA +  GW+  IG +G FIGM+GFGASG  + LY+HFGI A   V+  E+KL
Sbjct: 601 DAPVKLAIEAAISLGWERLIGENGIFIGMKGFGASGEINDLYKHFGITAEHAVEAAEKKL 660

Query: 672 S 672
           +
Sbjct: 661 N 661


>gi|319406266|emb|CBI79903.1| Transketolase [Bartonella sp. AR 15-3]
          Length = 668

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/660 (63%), Positives = 519/660 (78%), Gaps = 2/660 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M  ++   +MA AIRFL++DAIE  NSGHPGLPMG AD+VT L+T+ + +DPQ P WPNR
Sbjct: 1   MTNNEKQNQMAHAIRFLAIDAIEAANSGHPGLPMGAADIVTVLYTKFLAYDPQNPRWPNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML YA+LYL GY+DV+ ED++NFR IGSK AGHPEYG  AG+E TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYAVLYLSGYEDVSCEDLRNFRQIGSKLAGHPEYGHVAGVETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+ANAVGMA+ ER L   FG+ LI HYTY LVGDGCLMEGISQEAIS AGHL L+KLI
Sbjct: 121 GQGLANAVGMALGERLLNARFGE-LICHYTYALVGDGCLMEGISQEAISLAGHLKLNKLI 179

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           V WD+N ISIDG ISL DSTDQ ARF+ASGWNT+ VNGH+  A+   +  AQ SDKPT+I
Sbjct: 180 VFWDDNDISIDGAISLTDSTDQIARFKASGWNTIKVNGHNQTALIRAIEAAQASDKPTLI 239

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+ GTNKVHGS LG +EI ATRKAL W+ +PF IP DI+  WRLAGL +
Sbjct: 240 ACKTTIGFGAPNKGGTNKVHGSPLGAKEIDATRKALQWEEEPFVIPADILDSWRLAGLNA 299

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R  W+E+L ++  + R EF+R     L   F+N   + K+K    +P++ATRK+SE+
Sbjct: 300 AKKRKKWEEKLLALSVTERVEFDRLMRGDLIGNFENVIDDYKQKLVVDRPVVATRKASEM 359

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N+ + E IGGSADLTGSN TKTSQMKAIS  DFSGRYLHYG+REHAM+A MNG+A
Sbjct: 360 ALEVINEVVEETIGGSADLTGSNNTKTSQMKAISADDFSGRYLHYGIREHAMSAMMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G  PY GTF+ FSDY RPA+RL+SLMG+RVI+V+THDSIGLGEDGPTHQP+EHLAAL
Sbjct: 420 LYGGFIPYGGTFLCFSDYMRPAMRLSSLMGLRVIYVMTHDSIGLGEDGPTHQPIEHLAAL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RA+P+  V RPAD++ETLECWQ+ALK K  PS L+LSRQNLP +R +Y   NLC  GAY+
Sbjct: 480 RALPNHFVFRPADAVETLECWQLALKAKKTPSTLALSRQNLPLVRQEYTKENLCMFGAYE 539

Query: 553 YIS-TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
            ++ + +AQVT+F+SGSE+ + V+A  +L    I TRVVSVPCFELF +QS +Y+  +IG
Sbjct: 540 LLTASDDAQVTLFASGSEVHVVVKAHSVLEESGIPTRVVSVPCFELFAQQSAAYQKALIG 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +PIKIA+EA ++QGW+ FIG DG FIGM+GFG SG  D LY HFGI   A+V +V+ KL
Sbjct: 600 EAPIKIAVEAAVQQGWERFIGCDGVFIGMKGFGVSGPSDALYNHFGITYEAVVAIVKEKL 659


>gi|254708408|ref|ZP_05170236.1| transketolase [Brucella pinnipedialis M163/99/10]
 gi|254708739|ref|ZP_05170550.1| transketolase [Brucella pinnipedialis B2/94]
 gi|256030264|ref|ZP_05443878.1| transketolase [Brucella pinnipedialis M292/94/1]
 gi|261315907|ref|ZP_05955104.1| transketolase [Brucella pinnipedialis M163/99/10]
 gi|261316231|ref|ZP_05955428.1| transketolase [Brucella pinnipedialis B2/94]
 gi|265987293|ref|ZP_06099850.1| transketolase [Brucella pinnipedialis M292/94/1]
 gi|261295454|gb|EEX98950.1| transketolase [Brucella pinnipedialis B2/94]
 gi|261304933|gb|EEY08430.1| transketolase [Brucella pinnipedialis M163/99/10]
 gi|264659490|gb|EEZ29751.1| transketolase [Brucella pinnipedialis M292/94/1]
          Length = 663

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/661 (63%), Positives = 532/661 (80%), Gaps = 1/661 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  DP+ P+WP+R
Sbjct: 1   MTNTDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHDPKNPHWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYL GY+D+TI++IK FR +GS+TAGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKKFRQLGSRTAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIANAVGMAI+ER L  +FGD L++HYTY LVGDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGIANAVGMAISERILNAQFGDSLVNHYTYALVGDGCLMEGISQEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VLWD+N ISIDGPI+L+D+TDQ ARF ASGWNT++V+GHD  AI   +  A++SD+PT+I
Sbjct: 181 VLWDDNNISIDGPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELARVSDRPTLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++  WR+AGL +
Sbjct: 241 ACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSSEPFVVPAEVLDAWRVAGLNA 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R +W++RLS++++  R EFERR    L   FD A +  KKK    KP +ATRKSSE+
Sbjct: 301 AKKRLEWEKRLSAVEAETRAEFERRMRGELLSGFDAAIVEYKKKLSADKPKVATRKSSEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  MAAAMNGI 
Sbjct: 361 ALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELGMAAAMNGIT 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PYSGTF+ FSDY+RPA+RL+SLMGIRV++V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 421 LHGGLIPYSGTFLCFSDYARPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTHQPVEHLAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   NLCA GAY+
Sbjct: 481 RAIPNHNVFRPADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREENLCAFGAYE 540

Query: 553 Y-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QSD+Y+   IG
Sbjct: 541 LAAASSDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQSDAYKEATIG 600

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +P+K+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A   V+  E+KL
Sbjct: 601 DAPVKLAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEHAVEAAEKKL 660

Query: 672 S 672
           +
Sbjct: 661 N 661


>gi|227823333|ref|YP_002827305.1| transketolase [Sinorhizobium fredii NGR234]
 gi|227342334|gb|ACP26552.1| transketolase [Sinorhizobium fredii NGR234]
          Length = 658

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/656 (67%), Positives = 531/656 (80%), Gaps = 2/656 (0%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + + +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T LFT+ + FDP+ P WPNRDRFV
Sbjct: 5   EKHDRMANAIRFLSMDAVEKANSGHPGLPMGAADIATVLFTRYLSFDPKNPAWPNRDRFV 64

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSML Y+LLYL GY+D+TI++I+NFR +GSKTAGHPEYG  AGIE TTGPLGQGI
Sbjct: 65  LSAGHGSMLLYSLLYLTGYEDITIDEIRNFRQLGSKTAGHPEYGHAAGIETTTGPLGQGI 124

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           ANAVGMA+AERKLR+EFG  LI+HYTYV+ GDGCLMEGISQEAI+ AGHL L+KLIV WD
Sbjct: 125 ANAVGMALAERKLRDEFGSDLIEHYTYVIAGDGCLMEGISQEAIALAGHLKLNKLIVFWD 184

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +N ISIDGPIS+ADSTDQ+ARFRAS W+T++V+GHD  AI + + +AQ SDKPTMIAC+T
Sbjct: 185 DNNISIDGPISIADSTDQHARFRASKWHTIAVDGHDPEAIAAAIEEAQKSDKPTMIACKT 244

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIGFG+PN+AGT+KVHGS LG EEI ATRKAL W+ + F +P D++  WRLAG RS++TR
Sbjct: 245 VIGFGAPNKAGTHKVHGSPLGAEEIAATRKALGWEAEAFTVPADVLDAWRLAGQRSAETR 304

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
             W+E L + +   + EF RRFS  L      A    K+K   +KP  ATRK+SE  LEV
Sbjct: 305 KAWEETLQTAEK--KAEFVRRFSGELEAGLAPAISAYKQKLAETKPSPATRKASEDALEV 362

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +N  L E IGGSADLTGSN TKTSQ  +I+  +FSGRY+HYGVREH MAAAMNG+ALH G
Sbjct: 363 INGVLNETIGGSADLTGSNNTKTSQTHSITPDNFSGRYVHYGVREHGMAAAMNGMALHGG 422

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           + PYSG F++FSDY RP+IRLA+LMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP
Sbjct: 423 VIPYSGGFLIFSDYCRPSIRLAALMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 482

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           +LLV RPAD+ ET ECWQ+AL+ K RPS ++L+RQNL  +RT+Y+  NLCA GAYD I  
Sbjct: 483 NLLVFRPADATETAECWQLALESKKRPSAIALTRQNLMAVRTEYKEVNLCARGAYDLIPA 542

Query: 557 PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
            +A+VTIF++GSE++IAV+A + L+ + ISTRVVSVPC ELF EQSD Y+  +IG SP+K
Sbjct: 543 SDAKVTIFATGSEVEIAVKASQALTEKGISTRVVSVPCIELFAEQSDDYQQAVIGKSPVK 602

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           IAIEAG+RQGWD  IGSDG+F+GM  FGASG    LY+HFGI   A+V   E KLS
Sbjct: 603 IAIEAGVRQGWDHIIGSDGTFVGMSSFGASGPYKELYKHFGITPEAVVAAAEAKLS 658


>gi|319899388|ref|YP_004159485.1| transketolase [Bartonella clarridgeiae 73]
 gi|319403356|emb|CBI76915.1| Transketolase [Bartonella clarridgeiae 73]
          Length = 666

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/660 (63%), Positives = 517/660 (78%), Gaps = 2/660 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M  ++   +MA AIRFL++DAIE  NSGHPGLPMG AD+VT L+T+ + +DP+ P WPNR
Sbjct: 1   MTNNEKQNQMAHAIRFLAIDAIERANSGHPGLPMGAADIVTVLYTKFLAYDPKNPRWPNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML YALLYL GY+DV+++D++NFR IGSK AGHPEYG  AG+E TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYALLYLSGYEDVSLDDLRNFRQIGSKIAGHPEYGHVAGVETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+ANAVGMA+ ER L   FG  LIDHYTY LVGDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGLANAVGMALGERLLNARFGK-LIDHYTYALVGDGCLMEGISQEAITLAGHLKLNKLI 179

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           V WD+N ISIDG ISL DSTDQ ARF+ASGWNT+ VNGH+  A+   +  AQ SDKPT+I
Sbjct: 180 VFWDDNDISIDGAISLTDSTDQIARFKASGWNTIKVNGHNQAALVRAIEAAQASDKPTLI 239

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFGSPN+ GTNKVHGS LG EEI ATRKAL W  +PF IP DI+  WRLAGL +
Sbjct: 240 ACKTTIGFGSPNKGGTNKVHGSPLGAEEIDATRKALGWGEEPFVIPADILDSWRLAGLNA 299

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R  W+E+L ++    R EF+R     L   F++     K+K    +P +ATRK+SE+
Sbjct: 300 AKKRKKWEEKLLALSVVERAEFDRLMRGDLIGNFEDVVDTYKQKLAVDRPAVATRKASEM 359

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N+ + E IGGSADLTGSN TKTSQMK IS +DFSGRYLHYG+REHAM+A MNG+A
Sbjct: 360 TLEVINEAVQETIGGSADLTGSNNTKTSQMKIISANDFSGRYLHYGIREHAMSAVMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G  PY GTF+ FSDY RPA+RL+SLMG+RVI+V+THDSIGLGEDGPTHQP+EHLA L
Sbjct: 420 LYGGFIPYGGTFLCFSDYMRPAMRLSSLMGLRVIYVMTHDSIGLGEDGPTHQPIEHLATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RA+P+  V RPAD++ETLECWQ+ALK K  PS L+LSRQNLP +R +Y   NLC  GAY+
Sbjct: 480 RALPNHFVFRPADAVETLECWQLALKTKKTPSTLALSRQNLPLMRQEYTKENLCMFGAYE 539

Query: 553 YIS-TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
            ++ + +A+VT+F+SGSE+++ V+A  IL    I TRVVSVPCFELF +QS +Y+  +IG
Sbjct: 540 LLTASDDAKVTLFASGSEVEVVVKAHSILEKSGIPTRVVSVPCFELFAQQSAAYQKALIG 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +PIKIA+EA ++QGW+ FIG DG F+GM+GFG SG  D LY+HFGI   A+V +V+ KL
Sbjct: 600 EAPIKIAVEAAIQQGWERFIGCDGVFVGMEGFGVSGPSDALYRHFGITCEAVVAIVKEKL 659


>gi|163869160|ref|YP_001610407.1| transketolase [Bartonella tribocorum CIP 105476]
 gi|161018854|emb|CAK02412.1| Transketolase [Bartonella tribocorum CIP 105476]
          Length = 668

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/641 (66%), Positives = 512/641 (79%), Gaps = 2/641 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
            +MA+AIRFL++DAIE  NSGHPGLPMG AD+ T L+TQ +  DP+ P WPNRDRFVLSA
Sbjct: 8   NQMANAIRFLAIDAIEKANSGHPGLPMGAADIATVLYTQFLAHDPKNPRWPNRDRFVLSA 67

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALLYL GY+D+ IED+K+FR +G+K AGHPEYG  AGIE TTGPLGQG+ANA
Sbjct: 68  GHGSMLLYALLYLSGYEDICIEDLKDFRQLGAKLAGHPEYGHAAGIETTTGPLGQGLANA 127

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+AER     FGD LI+HYTYVLVGDGCLMEGISQEAIS AGHL L KLIVLWD+N 
Sbjct: 128 VGMALAERLQNARFGD-LINHYTYVLVGDGCLMEGISQEAISLAGHLKLHKLIVLWDDNN 186

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ISIDG ISLADSTDQ ARF+ASGWNT+ V+GH   AI   + +A+ SDKPT+IAC+T IG
Sbjct: 187 ISIDGEISLADSTDQCARFKASGWNTVKVDGHSQTAIAHAIEEAKNSDKPTLIACKTTIG 246

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
           FG+PN+AGTNKVHGS LG  EI  TR AL W+ +PF IP DI+  WRLAGL +++ R  W
Sbjct: 247 FGAPNKAGTNKVHGSPLGVREIAETRIALGWEAEPFVIPADILDNWRLAGLNAAKRRQKW 306

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           +E+L+++  S R EFER     L   FD A    K+K     P++ATRK+SE+ LEV+N+
Sbjct: 307 EEKLAALSVSERVEFERLMRGDLVGGFDGAVDAYKQKLVEECPVVATRKASEMALEVINE 366

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            + E IGGSADLTGSN TK+SQMK+IS +DFSGRYLHYG+REHAM A MNG+ALH G  P
Sbjct: 367 VVSETIGGSADLTGSNNTKSSQMKSISANDFSGRYLHYGIREHAMGAIMNGLALHGGFIP 426

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTF+ FSDY RPA+RL+SLMG+RVI+V+THDSIGLGEDGPTHQPVEHLA LRA+P+ L
Sbjct: 427 YGGTFLCFSDYMRPAMRLSSLMGLRVIYVMTHDSIGLGEDGPTHQPVEHLACLRAMPNHL 486

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN- 558
           V RPAD++ET+ECWQ+ALK +  PS L+LSRQNLP LR +YE  NLC LGAY+ ++  + 
Sbjct: 487 VFRPADAMETVECWQLALKARGTPSTLALSRQNLPLLRQEYEEENLCMLGAYELLTASDE 546

Query: 559 AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIA 618
           AQVT+F+SGSEL+IAV+A  +L  + I TRVVSVPCFELF +QS SY+  +IG +PIKIA
Sbjct: 547 AQVTLFASGSELQIAVKAHAVLEEKGIPTRVVSVPCFELFSQQSCSYQRALIGDAPIKIA 606

Query: 619 IEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           IEA + QGWD FIG DG FIGM+GFGASG+ D LY HFGI 
Sbjct: 607 IEAAVAQGWDRFIGCDGVFIGMEGFGASGTIDDLYAHFGIT 647


>gi|240851243|ref|YP_002972646.1| transketolase [Bartonella grahamii as4aup]
 gi|240268366|gb|ACS51954.1| transketolase [Bartonella grahamii as4aup]
          Length = 668

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/652 (65%), Positives = 514/652 (78%), Gaps = 2/652 (0%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIRFL++DAIE  NSGHPGLPMG AD+ T L+TQ +  DP+ P WPNRDRFVLSAG
Sbjct: 9   QMANAIRFLAIDAIEKANSGHPGLPMGAADIATVLYTQFLAHDPKNPRWPNRDRFVLSAG 68

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YALLYL GY+D+++ED+KNFR +GSK AGHPEYG  AGIE TTGPLGQG+ANAV
Sbjct: 69  HGSMLLYALLYLSGYEDLSLEDLKNFRQVGSKLAGHPEYGHVAGIETTTGPLGQGLANAV 128

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+ ER     FGD LI+HYTY LVGDGCLMEGISQEAIS AGHL L+KLIVLWD+N I
Sbjct: 129 GMALGERLQNARFGD-LINHYTYALVGDGCLMEGISQEAISLAGHLKLNKLIVLWDDNNI 187

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           SIDG ISLADSTDQ ARF+ASGW T  VNGHD  AI   +  AQ SDKPT+IAC+T IGF
Sbjct: 188 SIDGEISLADSTDQIARFKASGWETHKVNGHDQAAIARAIEAAQNSDKPTLIACKTTIGF 247

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PN+AGTNK HG+ LG  EI  TR AL W+ +PF IP DI+  WRLAGL +++ R  W+
Sbjct: 248 GAPNKAGTNKAHGAPLGAREITETRIALGWEAEPFVIPADILDNWRLAGLNAAKRRQKWE 307

Query: 321 ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
            + + +  S R EFER     L   FD A    K+K    +P++ATRK+SE+ LEV+N+ 
Sbjct: 308 AKFADLPVSERVEFERLMRGDLVGGFDGAIDTYKQKLVEERPVVATRKASEMALEVINEV 367

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
           + E IGGSADLTGSN TK+SQMK IS  DFSGRYLHYG+REHAM A MNG+AL+ G  PY
Sbjct: 368 VVETIGGSADLTGSNNTKSSQMKIISAEDFSGRYLHYGIREHAMGAVMNGLALYGGFIPY 427

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
            GTF+ FSDY RPA+RL+SLMG+RVI+V+THDSIGLGEDGPTHQPVEHLA LRA+P+ LV
Sbjct: 428 GGTFLCFSDYMRPAMRLSSLMGLRVIYVMTHDSIGLGEDGPTHQPVEHLACLRAMPNHLV 487

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIS-TPNA 559
            RPAD++ET+ECWQ+ALK +  PS L+LSRQNLP LR +YE  NLC LGAY++++ + +A
Sbjct: 488 FRPADAMETVECWQLALKARKTPSTLALSRQNLPLLRQEYEEENLCMLGAYEFLTASDDA 547

Query: 560 QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAI 619
           QVT+F+SGSEL+IAVEA  +L  + I TRVVSVPCFELF +QS SY+  +IG +PIKIAI
Sbjct: 548 QVTLFASGSELQIAVEAHAVLEEKGIPTRVVSVPCFELFSQQSLSYQRALIGDAPIKIAI 607

Query: 620 EAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           EA +RQGWD FIG DG FIGM+GFGASG+ D LY HF I    +V  VE++L
Sbjct: 608 EAAIRQGWDRFIGCDGVFIGMEGFGASGTIDALYAHFDITCENVVATVEKEL 659


>gi|239832814|ref|ZP_04681143.1| transketolase [Ochrobactrum intermedium LMG 3301]
 gi|239825081|gb|EEQ96649.1| transketolase [Ochrobactrum intermedium LMG 3301]
          Length = 663

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/662 (62%), Positives = 526/662 (79%), Gaps = 1/662 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  DPQ P+WP+R
Sbjct: 1   MTNSDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHDPQNPHWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYL GY+D+TI++IKNFR +GS+TAGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKNFRQLGSRTAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIANAVGMA++ER L  +FGD L++HYTYV+ GDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGIANAVGMALSERILNAQFGDSLVNHYTYVIAGDGCLMEGISQEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           V WD+N ISIDGP++L+D+TDQ ARF ASGWNT++V+GHD  AI   +  A++SDKPT+I
Sbjct: 181 VFWDDNNISIDGPVTLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIELAKVSDKPTLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W  +PF +P +++  WR+AGL +
Sbjct: 241 ACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWSAEPFVVPAEVLDAWRVAGLNA 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R +W++RL++  +  R EFERR    LP  FD   I  KKK    KP +ATRKSSE+
Sbjct: 301 AKKRQEWEKRLAAADAETRAEFERRMRGDLPANFDATIIEYKKKLSADKPKVATRKSSEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE +GGSADLTGSN TKTSQ KA++  D+  RY+HYG+REH MAAAMNG+ 
Sbjct: 361 ALEVINGVVPETVGGSADLTGSNNTKTSQTKAVTPEDYGQRYVHYGIREHGMAAAMNGMT 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PY GTF+ FSDY RPA+RL+SLMGIR I+V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 421 LHGGLIPYGGTFLTFSDYCRPAMRLSSLMGIRTIYVMTHDSIGLGEDGPTHQPVEHLAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++ET ECWQ+AL+ K  PS L+L+RQNLP +RT++   NL A GAY+
Sbjct: 481 RAIPNHNVFRPADAVETAECWQIALQSKKTPSTLALTRQNLPTVRTEHRDENLSAYGAYE 540

Query: 553 Y-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QSD+Y+   IG
Sbjct: 541 LAAASKDARVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQSDAYKTATIG 600

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +P+K+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A    +  E+KL
Sbjct: 601 DAPVKVAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEHAAEAAEKKL 660

Query: 672 SV 673
           + 
Sbjct: 661 NA 662


>gi|319409343|emb|CBI82987.1| Transketolase [Bartonella schoenbuchensis R1]
          Length = 668

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/660 (63%), Positives = 516/660 (78%), Gaps = 2/660 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   +   +MA+AIRFL++DAIE   SGHPGLPMG AD+ T L+T+ +V DP+ P WPNR
Sbjct: 1   MTNTEQQNQMANAIRFLAIDAIEKAQSGHPGLPMGAADIATVLYTKFLVHDPKNPRWPNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML YAL+YL GY+D++++DI+NFR +GSK AGHPEYG  AG+E TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYALMYLSGYEDISLDDIRNFRQMGSKIAGHPEYGHGAGVETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+ANAVGMA+ ER L   FGD LI+HYTYVLVGDGCLMEGI+QEAIS AGHL L+KLI
Sbjct: 121 GQGLANAVGMALGERLLNARFGD-LINHYTYVLVGDGCLMEGIAQEAISLAGHLKLNKLI 179

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           V WD+N ISIDG ISL DSTDQ ARF+A GWNT+ VNGH+  A+   +  A+ SDKPT+I
Sbjct: 180 VFWDDNDISIDGAISLTDSTDQVARFKACGWNTIKVNGHNQSALARAIETAKTSDKPTLI 239

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T+IGFG+P + GTNKVHGS LG EEI ATRKAL W  +PF +P DI+  WRLAGL +
Sbjct: 240 ACKTIIGFGAPRKGGTNKVHGSPLGAEEIAATRKALGWAQEPFVVPSDILDSWRLAGLSA 299

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R  W+ +LS++  S R EFER     L   F++     KK+     P +ATRK+SE+
Sbjct: 300 AKKRKKWEAQLSALPVSKRAEFERLMRGDLVSSFESVLDEYKKQLVLDCPHVATRKASEM 359

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  + E IGGSADLTGSN TKTSQMK+I+  DFSGRYLHYG+REHAM A MNG+A
Sbjct: 360 ALEVINGVVVETIGGSADLTGSNCTKTSQMKSITAEDFSGRYLHYGIREHAMGAVMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G  PY GTF+ FSDY RPA+RL+SLMG+RVI+V+THDSIGLGEDGPTHQPVEHLA+L
Sbjct: 420 LYGGFIPYGGTFLCFSDYMRPAMRLSSLMGLRVIYVMTHDSIGLGEDGPTHQPVEHLASL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RA+P+  V RPAD++ET+ECWQ+AL+    PS L+LSRQNLP LR  Y+ +NLC LGAY+
Sbjct: 480 RALPNHFVFRPADAVETVECWQLALRACKTPSTLALSRQNLPLLRRDYKEDNLCMLGAYE 539

Query: 553 YI-STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
            + ++  AQVT+F+SGSE++I VEA  IL  + I TRVVSVPCFELFFEQS +Y+  +IG
Sbjct: 540 LLMASDTAQVTLFASGSEVEIIVEAHAILEEKGIPTRVVSVPCFELFFEQSAAYQNALIG 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +P+KIA+EA +RQGWD FIGSDG FIGM+GFGAS   D LY HFGI    +V +VE +L
Sbjct: 600 DAPLKIAVEAAIRQGWDYFIGSDGVFIGMEGFGASAPMDDLYMHFGITCENVVAVVEERL 659


>gi|319404779|emb|CBI78380.1| Transketolase [Bartonella rochalimae ATCC BAA-1498]
          Length = 668

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/660 (63%), Positives = 515/660 (78%), Gaps = 2/660 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M  ++   +MA AIRFL++DAIE  +SGHPGLPMG AD+VT L+T+ + +DP+ P+WPNR
Sbjct: 1   MTNNEQQNQMAHAIRFLAIDAIEAAHSGHPGLPMGAADIVTVLYTKFLAYDPKNPHWPNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML YALLYL GY+DV+ ED++NFR IGSK AGHPEYG  AG+E TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYALLYLSGYEDVSCEDLRNFRQIGSKLAGHPEYGHVAGVETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+ANAVGMA+ ER L   FG+ LI HYTY LVGDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGLANAVGMALGERLLNARFGE-LICHYTYALVGDGCLMEGISQEAITLAGHLKLNKLI 179

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           V WD+N ISIDG ISL DSTDQ ARF+ASGWNT+ VNGH+  A+T  +  AQ S KPT+I
Sbjct: 180 VFWDDNDISIDGAISLTDSTDQIARFKASGWNTIKVNGHNQAALTRAIEAAQASCKPTLI 239

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+ GTNKVHGS LG EEI ATRKAL W+ +PF +P DI+  WRLAGL +
Sbjct: 240 ACKTTIGFGAPNKGGTNKVHGSPLGAEEIDATRKALGWEEEPFVVPADILDSWRLAGLNA 299

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R  W+E+  ++  + R EFER     L   F+NA    K+K     P +ATRK+SE+
Sbjct: 300 AKKRKKWEEKFLALSVAERVEFERLMRGDLIGNFENAVDAYKQKLTVECPAVATRKASEM 359

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N+ + E IGGSADLTGSN TKTSQMKAIS  DFSGRYLHYG+REHAM A MNG+A
Sbjct: 360 ALEVINEVVEETIGGSADLTGSNNTKTSQMKAISAEDFSGRYLHYGIREHAMGAMMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G  PY GTF+ FSDY RPA+RL+SLMG+RVI+V+THDSIGLGEDGPTHQPVEHLA L
Sbjct: 420 LYGGFIPYGGTFLCFSDYMRPAMRLSSLMGLRVIYVMTHDSIGLGEDGPTHQPVEHLATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RA+P+  V RPAD++ETLECWQ+ALK +  PS L+LSRQNLP +R +Y   NLC  GAY+
Sbjct: 480 RALPNHFVFRPADAVETLECWQLALKSRKTPSTLALSRQNLPLVRQEYIKENLCMFGAYE 539

Query: 553 YIS-TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
            ++ + +AQVT+F+SGSE+ I V+A  +L    I TRVVSVPCFELF +QS +Y+  +IG
Sbjct: 540 LLTASDDAQVTLFASGSEVHIVVKAHSVLEESGIPTRVVSVPCFELFAQQSAAYQKALIG 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +PIKIA+EA ++QGW+ FIG DG F+GM+GFG SG  D LY HFGI   A+V +V+ KL
Sbjct: 600 DAPIKIAVEAAIQQGWERFIGCDGVFVGMEGFGVSGPGDALYGHFGITCEAVVAIVKEKL 659


>gi|319407743|emb|CBI81390.1| Transketolase [Bartonella sp. 1-1C]
          Length = 668

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/660 (63%), Positives = 514/660 (77%), Gaps = 2/660 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M  ++   +MA AIRFL++DAIE  +SGHPGLPMG AD+VT L+T+ + +DP+ P+WPNR
Sbjct: 1   MTNNEQQNQMAHAIRFLAIDAIEAAHSGHPGLPMGAADIVTVLYTKFLAYDPKNPHWPNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML YALLYL GY+DV+ ED++NFR IGSK AGHPEYG  AG+E TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYALLYLSGYEDVSCEDLRNFRQIGSKLAGHPEYGHVAGVETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+ANAVGMA+ ER L   FG+ LI HYTY LVGDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGLANAVGMALGERLLNARFGE-LICHYTYALVGDGCLMEGISQEAITLAGHLKLNKLI 179

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           V WD+N ISIDG ISL DSTDQ ARF+ASGWNT+ VNGH+  A+T  +  AQ S KPT+I
Sbjct: 180 VFWDDNDISIDGAISLTDSTDQIARFKASGWNTIKVNGHNQAALTRAIEAAQASCKPTLI 239

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+ GTNKVHGS LG EEI ATRKAL W  +PF +P DI+  WRLAGL +
Sbjct: 240 ACKTTIGFGAPNKGGTNKVHGSPLGAEEIDATRKALGWKEEPFVVPADILDGWRLAGLNA 299

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R  W+E+  ++  + R EFER     L   F+N     K+K    +P +ATRK+SE+
Sbjct: 300 AKKRKKWEEKFLALSVAERVEFERLMRGDLIGNFENVVDAYKQKLVVDRPAVATRKASEM 359

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
           VLE +N+ + E IGGSADLTGSN TKTSQMKAIS  DFSGRYLHYG+REHAM A MNG+A
Sbjct: 360 VLEAINEVVEETIGGSADLTGSNNTKTSQMKAISAEDFSGRYLHYGIREHAMGAMMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G  PY GTF+ FSDY RPA+RL+SLMG+RVI+V+THDSIGLGEDGPTHQPVEHLA L
Sbjct: 420 LYGGFIPYGGTFLCFSDYMRPAMRLSSLMGLRVIYVMTHDSIGLGEDGPTHQPVEHLATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RA+P+  V RPAD++ETLECWQ+ALK +  PS L+LSRQNLP +R +Y   NLC  GAY+
Sbjct: 480 RALPNHFVFRPADAVETLECWQLALKARKTPSTLALSRQNLPLVRQEYTKENLCMFGAYE 539

Query: 553 YIS-TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
            ++ + +AQVT+F+SGSE+ I V+A  +L    I TRVVSVPCFELF +QS +Y+  +IG
Sbjct: 540 LLTASDDAQVTLFASGSEVHIVVKAHSVLEESGIPTRVVSVPCFELFAQQSAAYQKALIG 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +PIKIA+EA ++QGW+ FIG DG F+GM+GFG SG  D LY HFGI   A+V +V+ KL
Sbjct: 600 DAPIKIAVEAAIQQGWERFIGCDGVFVGMEGFGVSGPGDALYGHFGITCEAVVAIVKEKL 659


>gi|153008521|ref|YP_001369736.1| transketolase [Ochrobactrum anthropi ATCC 49188]
 gi|151560409|gb|ABS13907.1| transketolase [Ochrobactrum anthropi ATCC 49188]
          Length = 663

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/662 (62%), Positives = 528/662 (79%), Gaps = 1/662 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   D   +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T L+T+ +  DPQ P+WP+R
Sbjct: 1   MTNSDKQNQMANAIRFLSMDAVEKANSGHPGLPMGAADIATTLYTRFLSHDPQNPHWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYL GY+D+TI++IKNFR +GS+TAGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSLLYLSGYEDITIDEIKNFRQLGSRTAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIANAVGMA++ER L  +FGD L++HYTYV+ GDGCLMEGISQEAI+ AGHL L+KLI
Sbjct: 121 GQGIANAVGMALSERILNAQFGDSLVNHYTYVIAGDGCLMEGISQEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           V WD+N ISIDGP++L+D+T+Q ARF ASGWNT++V+GHD  AI   +  A++SDKPT+I
Sbjct: 181 VFWDDNNISIDGPVTLSDNTNQPARFAASGWNTMAVDGHDQDAIAKAIELAKVSDKPTLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+AGTNKVHGS LG EEI ATRKAL W+ +PF +P +++  WR+AGL +
Sbjct: 241 ACKTTIGFGAPNKAGTNKVHGSPLGAEEIAATRKALGWNAEPFVVPAEVLDGWRVAGLNA 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R +W++R +++++  R EFERR    LP  FD   I  KKK    KP +ATRKSSE+
Sbjct: 301 ARKRQEWEKRFAAVEADTRAEFERRMRGDLPSNFDATIIEYKKKLSADKPKVATRKSSEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE IGGSADLTGSN TKTSQ KAI+  D+  RY+HYG+REH MAAAMNG+ 
Sbjct: 361 ALEVINGVVPETIGGSADLTGSNNTKTSQTKAITPEDYGQRYVHYGIREHGMAAAMNGMT 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PY GTF+ FSDY RPA+RL+SLMGIRV++V+THDSIGLGEDGPTHQPVE LAAL
Sbjct: 421 LHGGLIPYGGTFLTFSDYCRPAMRLSSLMGIRVVYVMTHDSIGLGEDGPTHQPVEQLAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++E  ECWQ+AL+ K  PS ++L+RQNLP +RT++   NL A GAY+
Sbjct: 481 RAIPNHNVFRPADAVEAAECWQIALQSKKTPSTMALTRQNLPTVRTEHRDENLSAFGAYE 540

Query: 553 Y-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              ++ +A+VTIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QSD+Y+   IG
Sbjct: 541 LAAASKDAKVTIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQSDAYKTATIG 600

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           ++P+K+AIEA +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A    +  E+KL
Sbjct: 601 NAPVKVAIEAAISLGWERFIGENGIFIGMKGFGASGEINDLYKHFGITAEHAAEAAEKKL 660

Query: 672 SV 673
           + 
Sbjct: 661 NA 662


>gi|49474690|ref|YP_032732.1| transketolase [Bartonella quintana str. Toulouse]
 gi|49240194|emb|CAF26661.1| Transketolase [Bartonella quintana str. Toulouse]
          Length = 668

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/660 (65%), Positives = 520/660 (78%), Gaps = 2/660 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   +   +MA+AIRFL++DAIE  NSGHPGLPMG AD+ T L+T+ +  DP+ P+WP+R
Sbjct: 1   MINTEQQNQMANAIRFLAIDAIEKANSGHPGLPMGAADIATVLYTKFLAHDPKNPHWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHG+ML YALLYL GY+D+++ED+KNFR IGSK AGHPEYG  AGIE TTGPL
Sbjct: 61  DRFVLSAGHGAMLLYALLYLSGYEDISLEDLKNFRQIGSKLAGHPEYGHAAGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+ANAVGMA+ ER     FGD+ I+HYTY LVGDGCLMEGI+QEAISFAGHL L KLI
Sbjct: 121 GQGLANAVGMALGERLQNARFGDI-INHYTYALVGDGCLMEGIAQEAISFAGHLKLHKLI 179

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VLWD+N ISIDG ISLADSTDQ ARF+ASGWNT  V+GHD  AI   +  AQ SDKPT+I
Sbjct: 180 VLWDDNNISIDGEISLADSTDQMARFKASGWNTYKVDGHDQGAIARAIEAAQNSDKPTLI 239

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+PN+AGTNKVHG+ LG  EI  TR AL W+ +PF IP DI+  WRLAGL +
Sbjct: 240 ACKTTIGFGAPNKAGTNKVHGAPLGTREIAETRIALGWEAEPFVIPADILDNWRLAGLNA 299

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R  W+E+ + +  S R EFER     L   FD A    K+K     P +ATRK+SE+
Sbjct: 300 AKKRQKWKEKFADLPLSERIEFERLMRGDLVGGFDGAIDAYKQKLVEDCPCVATRKASEM 359

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N+ + E IGGSADLTGSN TK+SQMK+IS  DFSGRYLHYG+REHAM A MNG+A
Sbjct: 360 ALEVINETVIETIGGSADLTGSNNTKSSQMKSISAEDFSGRYLHYGIREHAMGAVMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G  PY GTF+ FSDY RPA+RL+SLMG+RVI+V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 420 LHGGCIPYGGTFLCFSDYMRPAMRLSSLMGLRVIYVMTHDSIGLGEDGPTHQPVEHLAAL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RA+P+  V RPAD++ET+ECWQ+ALK +N PS L+LSRQNLP LR +YE  NLC LGAY+
Sbjct: 480 RALPNHFVFRPADAMETVECWQLALKARNTPSTLALSRQNLPLLRQEYEKENLCMLGAYE 539

Query: 553 YIS-TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
            ++ + +AQVT+FSSGSEL+IAV+A  +L    I TRVVSVPCFELF +QS SY+  ++G
Sbjct: 540 LLTASDDAQVTLFSSGSELQIAVKAQALLEENAIPTRVVSVPCFELFAQQSLSYQRALVG 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +PIKIAIEA +RQGWD FIGSDG FIGM+GFGASG+ D LY HFGI    +V  VE++L
Sbjct: 600 DAPIKIAIEAAIRQGWDRFIGSDGIFIGMEGFGASGTIDALYAHFGITCENVVATVEKEL 659


>gi|241206221|ref|YP_002977317.1| transketolase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860111|gb|ACS57778.1| transketolase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 657

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/659 (63%), Positives = 515/659 (78%), Gaps = 2/659 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   + + +MA+AIRFL+MDA+E  NSGHPG+PMGMADV T LFT+ + FDP+ P+WPNR
Sbjct: 1   MTSPEQHDRMANAIRFLAMDAVEKANSGHPGMPMGMADVATVLFTKYLKFDPKKPHWPNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y++LYL GY D+TIED+K FR +GSKTAGHPEYG   GIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSVLYLTGYPDMTIEDLKQFRQLGSKTAGHPEYGHATGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIAN+VGMAIAERKLREEFG  L DHYTY + GDGCLMEGIS EAI+ AGHL L+KL+
Sbjct: 121 GQGIANSVGMAIAERKLREEFGSDLQDHYTYAICGDGCLMEGISHEAIALAGHLKLNKLV 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           + WDNN I+IDG +SL+DSTDQ ARF+A  WNT+ ++GHD  AI   +  A  SD+PT I
Sbjct: 181 LFWDNNSITIDGAVSLSDSTDQIARFKAVHWNTIEIDGHDQAAIADAIEAAHKSDRPTFI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T+IGFG+PN+ GT+KVHG+ LG EEI ATRKALNW+ + F IP D++  WR AG RS
Sbjct: 241 ACKTIIGFGAPNKQGTHKVHGNPLGAEEIAATRKALNWEAEAFVIPSDVLDSWRAAGARS 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
                 W++ L+  K+  R EF RR +  LP+ FD A    KKK   +KP +ATRK+SE 
Sbjct: 301 VDLVKSWEDGLA--KAPARAEFTRRMAGGLPEGFDAAISAYKKKLAETKPTVATRKASED 358

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  LPE +GGSADLT SN TKTSQM +I+ +DF+GRY+H+G+REH MA+AMNGIA
Sbjct: 359 ALEVINGFLPETLGGSADLTPSNNTKTSQMHSITPTDFAGRYMHWGIREHGMASAMNGIA 418

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PYSG F++FSDY RP IRLASLMGIRVIHVLTHDSIG+GEDGPTHQPVE LA L
Sbjct: 419 LHGGLIPYSGGFLIFSDYCRPPIRLASLMGIRVIHVLTHDSIGVGEDGPTHQPVEQLAGL 478

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+L+V RPAD+ ET ECWQ+A+K  NRPS L+L+RQNL   RT+Y   NLC  GAY 
Sbjct: 479 RAIPNLMVFRPADATETAECWQIAIKTHNRPSGLALTRQNLLAARTEYSEKNLCEQGAYV 538

Query: 553 YISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
                +A+VTIF+SGSE++IAV A   L ++ ++ RVVSVPC ELFFEQ ++YR +I+G+
Sbjct: 539 LAGNADAKVTIFASGSEVEIAVAARTALEAKGVTVRVVSVPCTELFFEQPEAYRKEILGN 598

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           SP+KIA+EA +R+GWDAFIG +G+FIGM+ FGASG    +Y+HFGI A A+V   E KL
Sbjct: 599 SPVKIAVEAAVREGWDAFIGPEGTFIGMKSFGASGPVKEVYKHFGITADAVVAAAEAKL 657


>gi|222149676|ref|YP_002550633.1| transketolase [Agrobacterium vitis S4]
 gi|221736658|gb|ACM37621.1| transketolase [Agrobacterium vitis S4]
          Length = 658

 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/656 (65%), Positives = 527/656 (80%), Gaps = 2/656 (0%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + + +MA+AIRFLSMDA+E  NSGHPG+PMGMADV T LFT+ + FDP+ P W NRDRFV
Sbjct: 5   EKHNRMANAIRFLSMDAVEKANSGHPGMPMGMADVATVLFTRFLNFDPKAPKWANRDRFV 64

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSML Y++LYL GY+D++I+DI+NFR +GSKTAGHPEYG  +GIE TTGPLGQG+
Sbjct: 65  LSAGHGSMLLYSVLYLTGYEDISIDDIRNFRQLGSKTAGHPEYGHLSGIETTTGPLGQGV 124

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           ANAVGMAIAE+KL  EFG  L+ H+TY +VGDGCLMEGISQEAIS AGHL L+KLIVLWD
Sbjct: 125 ANAVGMAIAEKKLASEFGSELMHHHTYAIVGDGCLMEGISQEAISLAGHLKLNKLIVLWD 184

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +NGISIDG ISLADSTDQ+ RFRASGWNT++V+GHD  AI++ L  AQLS+KPTMIAC+T
Sbjct: 185 DNGISIDGAISLADSTDQHGRFRASGWNTMAVDGHDPEAISAALSAAQLSEKPTMIACKT 244

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIGFGSPN+AGT+KVHGS LG +EI ATRKAL W  + F +P D++  WR AG R + TR
Sbjct: 245 VIGFGSPNKAGTHKVHGSPLGADEIAATRKALGWADEAFHVPADVLDAWREAGARGAATR 304

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           A+W++ L    S  + EF RRF+  LP+ FD A    KKK   +KP +ATRKSSE  LEV
Sbjct: 305 AEWEKGLEG--SDHKAEFTRRFAGKLPEGFDAAIDAYKKKLAETKPTLATRKSSEDALEV 362

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +N  + E +GGSADLTGSN TKTSQ  +I+ +DFSGRY+H+G+REH MAAAMNGIALH G
Sbjct: 363 INGVVIETLGGSADLTGSNNTKTSQTASITPTDFSGRYVHWGIREHGMAAAMNGIALHGG 422

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           L PYSG F++FSDY RP+IRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVE +AALRAIP
Sbjct: 423 LIPYSGGFLIFSDYCRPSIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEQMAALRAIP 482

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           +L++ RPAD+ E  ECWQ+AL   +RPS ++L+RQNL   RT+Y + NL A G Y+ +  
Sbjct: 483 NLMMFRPADATEVAECWQIALTHTDRPSGIALTRQNLIAARTEYSAENLSAKGGYELLGA 542

Query: 557 PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
            +A+V+IF++GSE+++A++A   L+++ I+ RVVSVPCFELFFEQ + YR  +IG++P+K
Sbjct: 543 DDAKVSIFATGSEVELAIQARAALAAKGIAARVVSVPCFELFFEQPEEYRNAVIGTAPVK 602

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           I +EA +RQGWD  IGS G+FIGM+ FGASG    LY+HFGI   AIV+  E KLS
Sbjct: 603 IGVEAAIRQGWDEIIGSHGTFIGMKSFGASGPYKELYKHFGITVEAIVEAAEAKLS 658


>gi|222087009|ref|YP_002545543.1| transketolase [Agrobacterium radiobacter K84]
 gi|221724457|gb|ACM27613.1| transketolase [Agrobacterium radiobacter K84]
          Length = 660

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/643 (64%), Positives = 511/643 (79%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + + +MA+AIRFL+MDA+E  NSGHPGLPMGMADV T LF++ + FDP+ P WP+RDRFV
Sbjct: 5   EQHDRMANAIRFLAMDAVEKANSGHPGLPMGMADVATVLFSKYLRFDPKNPRWPDRDRFV 64

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSML Y++LYL GY D+T+E++  FR +GSKTAGHPEYG   GIE TTGPLGQGI
Sbjct: 65  LSAGHGSMLLYSVLYLTGYPDMTVEELSRFRQLGSKTAGHPEYGHATGIETTTGPLGQGI 124

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           ANAVGMAIAERKLREEFG  L DHYTY + GDGCLMEGIS EAI+ AGHL L+KLI+ WD
Sbjct: 125 ANAVGMAIAERKLREEFGSELQDHYTYAMCGDGCLMEGISHEAIALAGHLKLNKLILFWD 184

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           NN I+IDG +SL+DSTDQ ARF+A  WNT+ V+GHD  AI + +  A  SD+PTMIAC+T
Sbjct: 185 NNSITIDGAVSLSDSTDQVARFKAVHWNTIEVDGHDQAAIAAAIEAAHKSDRPTMIACKT 244

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           +IGFG+PN+ GT+KVHGS LG EEI ATR ALNW  +PF IP+D++  WR AG RS  TR
Sbjct: 245 IIGFGAPNKQGTHKVHGSPLGAEEIAATRVALNWPYEPFVIPNDVLADWRAAGERSVGTR 304

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
             W+ RL++ ++  + EF RRF+  LP  FD A  + KKK   +KP +ATRK+SE  LE+
Sbjct: 305 EAWEGRLAAAEAGKKAEFTRRFAGELPAGFDAAISDYKKKLAETKPTLATRKASEDALEI 364

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +N  +PE IGGSADLT SN TKTSQMK+I+ +DFSGRY+H+G+REH MAAAMNGI LH G
Sbjct: 365 INGFIPETIGGSADLTPSNNTKTSQMKSITPTDFSGRYMHWGIREHGMAAAMNGITLHGG 424

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           L PYSG FM+FSDY RP +RLA+LMGIR IHVLTHDSIG+GEDGPTHQPVE +A+LRAIP
Sbjct: 425 LIPYSGGFMIFSDYCRPPLRLAALMGIRAIHVLTHDSIGVGEDGPTHQPVEQVASLRAIP 484

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           + ++ RPAD+ ET ECWQ+A+K  NRPS L+L+RQNL   RT+Y   NLC LGAY     
Sbjct: 485 NFMLFRPADATETAECWQIAVKTANRPSGLALTRQNLLAARTEYSEKNLCELGAYALAGN 544

Query: 557 PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
            +A+VTIF+SGSE+++AV A   L ++ +STRVVSVPC ELFFEQ D+YR +++G+SP+K
Sbjct: 545 ADAKVTIFASGSEVELAVAARTDLEAKGVSTRVVSVPCTELFFEQPDAYRKEVLGNSPVK 604

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           IA+EAG+R+GWDAFIG +G+FIGM+ FGAS     +Y HFGI 
Sbjct: 605 IAVEAGVREGWDAFIGPEGAFIGMKSFGASAPYKDVYNHFGIT 647


>gi|190893310|ref|YP_001979852.1| transketolase [Rhizobium etli CIAT 652]
 gi|190698589|gb|ACE92674.1| transketolase protein [Rhizobium etli CIAT 652]
          Length = 648

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/650 (65%), Positives = 516/650 (79%), Gaps = 2/650 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIRFL+MDA+E  NSGHPG+PMGMADV T LFT+ + FDP+ P+WPNRDRFVLSAGH
Sbjct: 1   MANAIRFLAMDAVEKANSGHPGMPMGMADVATVLFTKYLRFDPKKPHWPNRDRFVLSAGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+LLYL GY D+T+ED+K FR IGSKTAGHPEYG   GIE TTGPLGQGIANAVG
Sbjct: 61  GSMLLYSLLYLTGYPDMTVEDLKQFRQIGSKTAGHPEYGHATGIETTTGPLGQGIANAVG 120

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MAIAERKLR+EFG  L DHYTYV+ GDGCLMEGIS EAI+ AGHL L+KLI+ WDNN I+
Sbjct: 121 MAIAERKLRDEFGADLQDHYTYVINGDGCLMEGISHEAIALAGHLKLNKLILFWDNNSIT 180

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG +SL+DSTDQ ARF+A  WNT+ ++GHD  AI   +  A  SD+PT IAC+TVIGFG
Sbjct: 181 IDGAVSLSDSTDQIARFKAVHWNTIEIDGHDQAAIADAIEAAHKSDRPTFIACKTVIGFG 240

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +PN+AG++KVHGS LG +EI ATRKALNWD +PF +P D+++ WR AG RS      W+E
Sbjct: 241 APNKAGSHKVHGSPLGADEIAATRKALNWDYEPFVVPSDVLEAWRAAGTRSDNIVKAWEE 300

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
            LS  KS  R EF RR +  LP+ FD A  + KKK   +KP IATRK+SE  LE++N  L
Sbjct: 301 TLS--KSPARAEFSRRMAGELPEGFDAAITDYKKKLAETKPTIATRKASEDALEIINGFL 358

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           PE +GGSADLT SN TKTSQM +I+ +DF GRY+H+G+REH MA+AMNGI+LH GL PY 
Sbjct: 359 PETLGGSADLTPSNNTKTSQMVSITPTDFKGRYMHWGIREHGMASAMNGISLHGGLIPYG 418

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           G FM+FSDY RP IRL++LMGIRVIHVLTHDSIG+GEDGPTHQPVE +A LRA+P+L V 
Sbjct: 419 GGFMIFSDYCRPPIRLSALMGIRVIHVLTHDSIGVGEDGPTHQPVEQIAGLRAVPNLQVF 478

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQV 561
           RPAD++ET ECWQ+A+K K+RPS L+L+RQNL  +RT+    NLC LGAY      +A+V
Sbjct: 479 RPADAVETAECWQIAIKSKSRPSALALTRQNLTTVRTESNEKNLCELGAYTLAGNADAKV 538

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
           TIF+SGSE++IAV A   L ++ +S RVVSVPC ELFFEQ D+YR  ++G+SP+KIA+EA
Sbjct: 539 TIFASGSEVEIAVAARATLEAKGVSVRVVSVPCTELFFEQPDAYRKDVLGNSPVKIAVEA 598

Query: 622 GLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +R+GWDAFIG +GSFIGM+GFGASG    +Y+HFGI A A+V   E KL
Sbjct: 599 AVREGWDAFIGPEGSFIGMKGFGASGPVKDVYKHFGITADAVVAAAEAKL 648


>gi|15891213|ref|NP_356885.1| transketolase [Agrobacterium tumefaciens str. C58]
 gi|15159574|gb|AAK89670.1| transketolase [Agrobacterium tumefaciens str. C58]
          Length = 660

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/656 (64%), Positives = 526/656 (80%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           D + +MA+AIRFL+MDA+E  NSGHPGLPMG ADV T LFT+ + FDP+ P W +RDRFV
Sbjct: 5   DKHNRMANAIRFLAMDAVEKANSGHPGLPMGAADVATVLFTRYLKFDPKAPLWADRDRFV 64

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSML Y+LLYL GY+D+TI++IK FR  GSKTAGHPEYG   GIE TTGPLGQGI
Sbjct: 65  LSAGHGSMLLYSLLYLTGYEDMTIDEIKRFRQFGSKTAGHPEYGHATGIETTTGPLGQGI 124

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           ANAVGMAIAERKL EEFG  L  H+TYVL GDGCLMEGIS EAI+ AGHL L+KL++ WD
Sbjct: 125 ANAVGMAIAERKLEEEFGSDLQSHFTYVLCGDGCLMEGISHEAIALAGHLKLNKLVLFWD 184

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +N I+IDG + L+DSTDQ ARF+A  WNT+ V+GHD  AI + +  AQ SD+PT IAC+T
Sbjct: 185 DNNITIDGEVGLSDSTDQIARFQAVHWNTIRVDGHDPDAIAAAIEAAQKSDRPTFIACKT 244

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIGFG+PN+ GT+KVHG+ LG EEI A RK+LNW+ + F IP+D++  WRLAGLRS++TR
Sbjct: 245 VIGFGAPNKQGTHKVHGNPLGAEEIAAARKSLNWEAEAFVIPEDVLDAWRLAGLRSTKTR 304

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
            DW+ RL + +++ + EF+RRF+  LP  FD++    KKK   + P +ATRK+SE  LEV
Sbjct: 305 QDWEARLEATETAKKAEFKRRFAGDLPGNFDSSIDAFKKKIIENNPTVATRKASEDSLEV 364

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +N  LPE++GGSADLT SN TKTSQMK+I+ +DFSGRYLHYG+REH MAAAMNGIALH G
Sbjct: 365 INGILPEMVGGSADLTPSNNTKTSQMKSITPTDFSGRYLHYGIREHGMAAAMNGIALHGG 424

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           L PY+G F++FSDY RP+IRLA+LMGIRV+HVLTHDSIG+GEDGPTHQPVE +AALRAIP
Sbjct: 425 LIPYAGGFLIFSDYCRPSIRLAALMGIRVVHVLTHDSIGVGEDGPTHQPVEQIAALRAIP 484

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           +LLV RPAD  ET ECWQ+AL++K+RPS L+L+RQNL   R +YE  NL A GAY+ +S 
Sbjct: 485 NLLVFRPADETETAECWQLALEQKHRPSALALTRQNLTPSRKEYEEKNLSAYGAYELVSA 544

Query: 557 PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
            +A+V+IF+SGSE+++A++A   L  + +S RVVSVPCFELF EQ ++YR  IIG +P+K
Sbjct: 545 SDAKVSIFASGSEVEVALKAAATLKDKGVSARVVSVPCFELFKEQPETYRNAIIGKAPVK 604

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           IA+EA +RQGWD FIG+DG+F+GM  FGAS     L++HFGI A A+V  VE KL+
Sbjct: 605 IAVEAAIRQGWDYFIGNDGAFVGMHSFGASAPAKDLFKHFGITAEAVVAAVEAKLA 660


>gi|332716465|ref|YP_004443931.1| Transketolase [Agrobacterium sp. H13-3]
 gi|325063150|gb|ADY66840.1| Transketolase [Agrobacterium sp. H13-3]
          Length = 660

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/656 (64%), Positives = 525/656 (80%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           D + +MA+AIRFL+MDA+E  NSGHPGLPMG ADV T LFT+ + FDP+   WP+RDRFV
Sbjct: 5   DKHDRMANAIRFLAMDAVEKANSGHPGLPMGAADVATVLFTRFLKFDPKSSLWPDRDRFV 64

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSML Y+LLYL GY+D+TI++IK FR  GSKTAGHPEYG   GIE TTGPLGQGI
Sbjct: 65  LSAGHGSMLLYSLLYLTGYEDMTIDEIKRFRQFGSKTAGHPEYGHATGIETTTGPLGQGI 124

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           ANAVGMAIAERKL EEFG  L +H+TYVL GDGCLMEGIS EAI+ AGHL L+KL++ WD
Sbjct: 125 ANAVGMAIAERKLEEEFGSDLQNHFTYVLCGDGCLMEGISHEAIALAGHLKLNKLVLFWD 184

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +N I+IDG + L+DSTDQ ARF+A  WNT+ V+GHD  AI + +  A  SD+PT IAC+T
Sbjct: 185 DNNITIDGEVGLSDSTDQIARFQAVHWNTIRVDGHDPDAIAAAIEAAHRSDRPTFIACKT 244

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIGFG+PN+ GT+KVHG+ LG EEI A RK+LNW+ + F IP+D++  WRLAGLRS++TR
Sbjct: 245 VIGFGAPNKQGTHKVHGNPLGAEEIAAARKSLNWEAEAFVIPEDVLDAWRLAGLRSTKTR 304

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
            DW+ RL + ++  + EF+RRF+  LP  FD+A    KKK   + P +ATRK+SE  LEV
Sbjct: 305 QDWEARLEATEAGKKAEFKRRFAGDLPGNFDSAIDAFKKKIIENNPTVATRKASEDSLEV 364

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +N  LPE+IGGSADLT SN TKTSQMK+I+ +DFSGRYLHYG+REH MAAAMNGIALH G
Sbjct: 365 INGILPEMIGGSADLTPSNNTKTSQMKSITPTDFSGRYLHYGIREHGMAAAMNGIALHGG 424

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           L PY+G F++FSDY RP+IRLA+LMGIRV+HVLTHDSIG+GEDGPTHQPVE +AALRAIP
Sbjct: 425 LIPYAGGFLIFSDYCRPSIRLAALMGIRVVHVLTHDSIGVGEDGPTHQPVEQIAALRAIP 484

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           +LLV RPAD  ET ECWQ+AL++K+RPS L+L+RQNL   R +YE  NL A GAY+ +S 
Sbjct: 485 NLLVFRPADETETAECWQLALEQKHRPSALALTRQNLAPSRKEYEEKNLSAYGAYELVSA 544

Query: 557 PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
            +A+V+IF+SGSE+++A++A   L  + +S RVVSVPCFELF EQ ++YR  IIG +P+K
Sbjct: 545 SDAKVSIFASGSEVEVALKAAATLKDKGVSARVVSVPCFELFKEQPETYRNAIIGKAPVK 604

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           IA+EA +RQGWD FIGSDG+F+GM  FGAS     L++HFGI A A+V  VE KL+
Sbjct: 605 IAVEAAIRQGWDYFIGSDGAFVGMHSFGASAPAKDLFKHFGITAEAVVAAVEAKLA 660


>gi|118588343|ref|ZP_01545752.1| transketolase [Stappia aggregata IAM 12614]
 gi|118439049|gb|EAV45681.1| transketolase [Stappia aggregata IAM 12614]
          Length = 689

 Score =  875 bits (2261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/652 (64%), Positives = 512/652 (78%), Gaps = 1/652 (0%)

Query: 9   NVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPY 68
           N   M   D +++MA+AIRFL++DA+E  NSGHPGLPMG AD+ T LFT+ + FDP  P 
Sbjct: 24  NGTTMTDLDKHQRMANAIRFLAIDAVEKANSGHPGLPMGAADIATVLFTEFLKFDPTAPN 83

Query: 69  WPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEAT 128
           W +RDRFVLSAGHGSML Y+LLYLLGY+D +++++KNFR +G++TAGHPEYG  AGIE T
Sbjct: 84  WADRDRFVLSAGHGSMLLYSLLYLLGYEDFSLDELKNFRQLGARTAGHPEYGHGAGIETT 143

Query: 129 TGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGL 188
           TGPLGQG+ NAVGMAIAER     FG+ L+DHYTYVL GDGCLMEGISQEA++ AGHL L
Sbjct: 144 TGPLGQGLGNAVGMAIAERLQSTRFGEDLVDHYTYVLAGDGCLMEGISQEALTLAGHLKL 203

Query: 189 SKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDK 248
           +KLIV+WDNNGISIDG + + DSTDQ ARF ASGWNTLSV+GHD  AI++ +R+AQ SD+
Sbjct: 204 NKLIVIWDNNGISIDGKVEITDSTDQQARFAASGWNTLSVDGHDPVAISAAIRQAQASDR 263

Query: 249 PTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLA 308
           PT+IA +T IGFG+PN++GT KVHGS LG EEI  TR ALNW    F +P DI+  WR+A
Sbjct: 264 PTLIAAKTTIGFGAPNKSGTAKVHGSPLGAEEISLTRAALNWPHAAFEVPSDILDAWRIA 323

Query: 309 GLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRK 368
           GLRS+Q   DWQ+R +   +  R EFERR    LP  F  A  + KKK    +P +ATRK
Sbjct: 324 GLRSAQAHKDWQKRFAEADAETRAEFERRNRGDLPAGFSKAVQDYKKKLADEQPTMATRK 383

Query: 369 SSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAM 428
           +SE VL V+N+ +PE IGGSADLTGSN TKTSQ   ++  DFSGRY+HYG+REH MAAAM
Sbjct: 384 ASEAVLTVINEVVPETIGGSADLTGSNNTKTSQTVPVTPDDFSGRYIHYGIREHGMAAAM 443

Query: 429 NGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEH 488
           NG+ALH GL PYSG F++FSDY RP+IRLA+LMG RVIHV+THDSIGLGEDGPTHQPVEH
Sbjct: 444 NGMALHGGLIPYSGGFLIFSDYCRPSIRLAALMGQRVIHVMTHDSIGLGEDGPTHQPVEH 503

Query: 489 LAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCAL 548
            AALRAIP+L   RPAD  ETLECWQ++L+ ++ PSVL+L+RQNLP LR  YE +NLCA 
Sbjct: 504 FAALRAIPNLTFFRPADITETLECWQLSLENRDGPSVLALTRQNLPSLRKSYEEDNLCAR 563

Query: 549 GAYDYI-STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
           GAY  I S  +A VTIF++GSE++IAV+A + +S+  I+ RVVSVP FELF  QSD Y+A
Sbjct: 564 GAYVLIDSDEDAAVTIFATGSEVEIAVDAHKDMSAAGIAVRVVSVPSFELFEAQSDDYKA 623

Query: 608 QIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
            +IG+SP+KIAIEAG+R GWD FIGSDG F+GM GFGAS     LY+HFGI 
Sbjct: 624 AVIGNSPVKIAIEAGIRMGWDHFIGSDGIFVGMTGFGASAPYKELYEHFGIT 675


>gi|110635768|ref|YP_675976.1| transketolase [Mesorhizobium sp. BNC1]
 gi|110286752|gb|ABG64811.1| transketolase [Chelativorans sp. BNC1]
          Length = 686

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/644 (64%), Positives = 507/644 (78%), Gaps = 1/644 (0%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + + +MA+AIRFLSMDA+E   SGHPGLPMG AD+ T LFT+ M  DP+ P+WP+RDRFV
Sbjct: 29  EKHDRMANAIRFLSMDAVEKAKSGHPGLPMGTADIATVLFTRFMKHDPKTPHWPDRDRFV 88

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSML Y+LL+LLGY+D+TIE+IKNFR +GS+TAGHPEYG  AGIE TTGPLGQG 
Sbjct: 89  LSAGHGSMLLYSLLHLLGYEDITIEEIKNFRQLGSRTAGHPEYGFAAGIETTTGPLGQGF 148

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
            NAVGMAIAER L   +GD L++H+TY LVGDGCLMEGISQEA++ AGHL L+KLIVL+D
Sbjct: 149 GNAVGMAIAERLLNARYGDDLVNHFTYALVGDGCLMEGISQEALTLAGHLRLNKLIVLFD 208

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +N ISIDGP+SLADSTDQ ARF ASGWNTL  +GHD  AI S +  A+ SD+PT+IA  T
Sbjct: 209 DNHISIDGPVSLADSTDQCARFAASGWNTLRADGHDPDAIASAIETARQSDRPTLIAFRT 268

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
            IG+GSP++AGTNKVHGS LG +EI  TR AL WD  PF +P +++  WRLAGLRS++ R
Sbjct: 269 TIGYGSPSKAGTNKVHGSPLGADEIAKTRSALGWDSPPFVVPSEVLDDWRLAGLRSAKER 328

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
             W++RL++  +  R +FERR    LP  F    ++ KKK       +ATR +SE+ LEV
Sbjct: 329 GSWEKRLAAADTETRAQFERRMRGDLPAAFPGVIVDYKKKLAQQNTAVATRNASEMALEV 388

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +NDC+PE +GGSADLTGSN TKTSQ   I+ +DFSGRY+H+G+REHAMAAAMNGIALH G
Sbjct: 389 INDCIPETVGGSADLTGSNNTKTSQTTPITPTDFSGRYIHFGIREHAMAAAMNGIALHGG 448

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           L PY GTF+ FSDY+RPA+RLASLM IR I V+THDSIGLGEDGPTHQPVEHLAALRAIP
Sbjct: 449 LIPYGGTFLTFSDYARPAMRLASLMHIRSIFVMTHDSIGLGEDGPTHQPVEHLAALRAIP 508

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-S 555
           +  V RPAD+ ET ECWQ+AL+ +  PS ++L+RQ L  +R ++E  NLCA GAY+ + +
Sbjct: 509 NHNVFRPADATETAECWQLALESRKTPSTIALTRQKLQPVRLEFEEENLCARGAYELLPA 568

Query: 556 TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
           +  A+VTIF+SGSE++IAV+A  +L  R   TRVVSVPCFELF EQS  Y+  I+G +P+
Sbjct: 569 SDEAKVTIFASGSEVEIAVKARVMLEERGYPTRVVSVPCFELFEEQSQDYQRAILGDAPV 628

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           +IAIEAG+RQGWD FIG DG FIGM GFGASG    LYQHFGI 
Sbjct: 629 RIAIEAGVRQGWDRFIGVDGIFIGMHGFGASGPAPELYQHFGIT 672


>gi|304394511|ref|ZP_07376432.1| transketolase [Ahrensia sp. R2A130]
 gi|303293421|gb|EFL87800.1| transketolase [Ahrensia sp. R2A130]
          Length = 663

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/656 (63%), Positives = 514/656 (78%), Gaps = 4/656 (0%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA AIRFLS DA++  NSGHPGLPMG AD+ T LFT+ M FDP+ P WPNRDRFVLSAG
Sbjct: 7   RMAHAIRFLSADAVQKANSGHPGLPMGAADIATVLFTRFMTFDPKKPDWPNRDRFVLSAG 66

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y+ LYLLGY+D+ +E+IKNFR IG+KTAGHPEYG  AGIE TTGPLGQGIANAV
Sbjct: 67  HGSMLLYSSLYLLGYKDIDMEEIKNFRQIGAKTAGHPEYGHAAGIETTTGPLGQGIANAV 126

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMAIAE+KL +EFG  L+DH+TY LVGDGCLMEGISQEAI+ AGHL L+KLIV WD+NGI
Sbjct: 127 GMAIAEKKLSDEFGADLMDHHTYCLVGDGCLMEGISQEAIALAGHLKLNKLIVFWDDNGI 186

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           SIDG ISL+DST+Q  RF AS WNT+S++GHDH AI   + +A+ SDKPTMIAC+T IGF
Sbjct: 187 SIDGAISLSDSTNQIERFEASQWNTISIDGHDHDAIAGAIEEAKTSDKPTMIACKTTIGF 246

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+P +AGT   HGS LG +EI   R+AL W+ +PF +P+DI+  WR+AGLRS+  R +W+
Sbjct: 247 GAPTKAGTAGSHGSPLGDKEIAGAREALGWEAEPFVVPEDILDAWRIAGLRSTHERKEWE 306

Query: 321 ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
           +RL +   + R +FERRF   LP  F+ A   LKK+     P  ATRK+S+ VLEV+N  
Sbjct: 307 DRLGAADGTKRGDFERRFRGDLPGKFEEAITTLKKELAEEPPKKATRKASQQVLEVINGV 366

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
           L E +GGSADLTGSN T TSQ   IS  DFSGR++HYG+REHAMAAAMNGIALH GL PY
Sbjct: 367 LDETLGGSADLTGSNNTNTSQTPPISPDDFSGRFIHYGIREHAMAAAMNGIALHGGLIPY 426

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
           SG F+VF+DY RP+IRLA+LMGIR IHV+THDSIGLGEDGPTHQPVEHLA+LRAIP L V
Sbjct: 427 SGGFLVFADYCRPSIRLAALMGIRAIHVMTHDSIGLGEDGPTHQPVEHLASLRAIPGLQV 486

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP--- 557
            RPAD  ET ECWQ+AL+ +++PSV++L+RQ+L  +RT+++  NLCA GAY+ +++P   
Sbjct: 487 FRPADVTETAECWQLALESRDKPSVIALTRQDLEPVRTEFDEENLCARGAYE-VASPGDD 545

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
           +A V+IF+SGSE++IA+EA   L +    TRVVSVP FELF  QS  YR+ +IG++ + +
Sbjct: 546 DAAVSIFASGSEVEIAMEAKAALDAAGHPTRVVSVPSFELFAAQSGGYRSSVIGNAKVNV 605

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
            IEA +R GWDA IGSDG F+GM  FGASG    LY+HFGI + A+V+ V ++L+ 
Sbjct: 606 GIEAAVRMGWDAIIGSDGIFVGMDSFGASGPYKALYEHFGITSDAVVERVNKRLAT 661


>gi|116253745|ref|YP_769583.1| transketolase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258393|emb|CAK09496.1| putative transketolase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 657

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/659 (63%), Positives = 517/659 (78%), Gaps = 2/659 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   + + +MA+AIRFL+MDA+E  NSGHPG+PMGMADV T LFT+ + FDP+ P+WPNR
Sbjct: 1   MTSPEQHDRMANAIRFLAMDAVEKANSGHPGMPMGMADVATVLFTKYLKFDPKKPHWPNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYL GY D+TIED+K FR +GSKTAGHPEYG   GIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSLLYLTGYPDMTIEDLKQFRQLGSKTAGHPEYGHATGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIAN+VGMAIAERKLREEFG  L DHYTY + GDGCLMEGIS EAI+ AGHL L+KLI
Sbjct: 121 GQGIANSVGMAIAERKLREEFGSDLQDHYTYAICGDGCLMEGISHEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           + WDNN I+IDG +SL+DSTDQ ARF+A  WNT+ ++GHD  AI + +  A  SD+PT I
Sbjct: 181 LFWDNNSITIDGAVSLSDSTDQIARFKAVHWNTIEIDGHDQAAIAAAIEAAHKSDRPTFI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T+IGFG+PN+ GT+KVHG+ LG EEI ATRKALNW+ + F IP D++  WR+AG RS
Sbjct: 241 ACKTIIGFGAPNKQGTHKVHGNPLGAEEIAATRKALNWEAEAFVIPSDVLDSWRVAGARS 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            +    W++ L+  K+  + EF RR +  LP+ FD A    KKK   +KP +ATRK+SE 
Sbjct: 301 VELVKAWEDGLA--KAPAKAEFTRRMAGELPEGFDAAISTYKKKLAETKPTVATRKASED 358

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  LPE +GGSADLT SN TKTSQM +I+ +DF+GRY+H+G+REH MA+AMNGIA
Sbjct: 359 ALEVINGFLPETLGGSADLTPSNNTKTSQMHSITPTDFAGRYMHWGIREHGMASAMNGIA 418

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PYSG F++FSDY RP IRLASLMGIRVIHVLTHDSIG+GEDGPTHQPVE LA L
Sbjct: 419 LHGGLIPYSGGFLIFSDYCRPPIRLASLMGIRVIHVLTHDSIGVGEDGPTHQPVEQLAGL 478

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+L+V RPAD+ ET ECWQ+A+K  NRPS L+L+RQNL   RT+Y   NLC  GAY 
Sbjct: 479 RAIPNLMVFRPADATETAECWQIAIKTHNRPSGLALTRQNLLAARTEYSEKNLCEQGAYV 538

Query: 553 YISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
                +A+VTIF+SGSE++IAV A   L ++ ++ RVVSVPC ELFFEQ ++YR  I+G+
Sbjct: 539 LAGNADAKVTIFASGSEVEIAVAARTALEAKGVTVRVVSVPCTELFFEQPEAYRKGILGN 598

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           SP+KIA+EA +R+GWDAFIG +G+FIGM+ FGASG    +Y+HFGI A A+V   E KL
Sbjct: 599 SPVKIAVEAAVREGWDAFIGPEGTFIGMKSFGASGPVKEVYKHFGITADAVVAAAEAKL 657


>gi|121602913|ref|YP_988475.1| transketolase [Bartonella bacilliformis KC583]
 gi|120615090|gb|ABM45691.1| transketolase [Bartonella bacilliformis KC583]
          Length = 666

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/652 (61%), Positives = 510/652 (78%), Gaps = 2/652 (0%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+A+RFL++DAIE   SGHPGLPMG AD+ T L+TQ +V DP+ P+W NRDRFVLSAG
Sbjct: 9   QMANAVRFLAIDAIEKAKSGHPGLPMGAADIATVLYTQFLVHDPKNPHWVNRDRFVLSAG 68

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YA+LYL GY+D+++E+I+NFR +GSK AGHPEYG  AGIE TTGPLGQG+ANAV
Sbjct: 69  HGSMLLYAVLYLSGYEDISLEEIRNFRQMGSKVAGHPEYGHAAGIETTTGPLGQGLANAV 128

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+ ER L   FGD LI+HYTY LVGDGCLMEGISQE I+ AGHL L KLIVLWD+N I
Sbjct: 129 GMALGERLLNARFGD-LINHYTYALVGDGCLMEGISQETIALAGHLKLHKLIVLWDDNNI 187

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           SIDG ISL DST+Q  RF+A GWN + V+GH+  AI   L  A+ S++PT+IAC+T IGF
Sbjct: 188 SIDGEISLTDSTNQEMRFKACGWNVIKVDGHNQTAIAHALTAAKKSNRPTLIACKTTIGF 247

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+P +AGTNKVHG+ LG+EE+ ATR+ L W+ +PF +P DI+  WRLAGL +++ R +W+
Sbjct: 248 GAPKKAGTNKVHGAPLGEEEVAATREVLGWEFEPFMVPADILDCWRLAGLNAAKKRQEWE 307

Query: 321 ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
           E+L+++    R  FE      L   FD      K+K     P +ATRK+SE+VL+V+N+ 
Sbjct: 308 EKLAALPIEERVRFECFVRGDLVSNFDEVLEAYKEKLVAECPTVATRKASEMVLDVINEV 367

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
           +   IGGSADLTGSN TK+SQM  I+  DFSGRYLHYG+REHAM A MNG+AL+ G  PY
Sbjct: 368 VLGTIGGSADLTGSNLTKSSQMSKITADDFSGRYLHYGIREHAMGAIMNGLALYGGFIPY 427

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
            GTF+ F+DY RPA+RL+SLMG+RV++V+THDSIGLGEDGPTHQPVEHLAALRA+P+  V
Sbjct: 428 GGTFLCFADYMRPAMRLSSLMGLRVVYVMTHDSIGLGEDGPTHQPVEHLAALRALPNHYV 487

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST-PNA 559
            RPAD+IET+ECWQ+ALK    PS L+LSRQNLP +R ++  NNLC LGAY+ ++   +A
Sbjct: 488 FRPADAIETVECWQLALKSLKTPSTLALSRQNLPLVRREHTGNNLCLLGAYELLTDGDDA 547

Query: 560 QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAI 619
           QVT+F+SGSE++I V+A  +L +  I++RVVSVPCFELFFEQS +Y+  +IG+SP+KIA+
Sbjct: 548 QVTLFASGSEVEIIVQAHALLEAEGIASRVVSVPCFELFFEQSVAYQNALIGNSPVKIAV 607

Query: 620 EAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           EA +RQGW+ FIG DG FIGM+GFGAS   D LY+HFGI    IV +V+ KL
Sbjct: 608 EAAIRQGWERFIGQDGIFIGMEGFGASAPMDELYKHFGITCENIVTVVKEKL 659


>gi|86359086|ref|YP_470978.1| transketolase [Rhizobium etli CFN 42]
 gi|86283188|gb|ABC92251.1| transketolase protein [Rhizobium etli CFN 42]
          Length = 648

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/650 (65%), Positives = 514/650 (79%), Gaps = 2/650 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIRFL+MDA+E  NSGHPG+PMGMADV T LFT+ + FDP+ P+WPNRDRFVLSAGH
Sbjct: 1   MANAIRFLAMDAVEKANSGHPGMPMGMADVATVLFTKYLRFDPKKPHWPNRDRFVLSAGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+LLYL GY D+TIED+K FR +GSKTAGHPEYG   GIE TTGPLGQGIANAVG
Sbjct: 61  GSMLLYSLLYLTGYPDMTIEDLKQFRQVGSKTAGHPEYGHATGIETTTGPLGQGIANAVG 120

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MAIAERKLR+EFG  L DHYTYV+ GDGCLMEGIS EAI+ AGHL L+KLI+ WDNN I+
Sbjct: 121 MAIAERKLRDEFGADLQDHYTYVINGDGCLMEGISHEAIALAGHLKLNKLILFWDNNSIT 180

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG +SL+DSTDQ ARF+A  WNT+ ++GHD  AI   +  A  SD+PT IAC+TVIGFG
Sbjct: 181 IDGAVSLSDSTDQIARFKAVHWNTIEIDGHDQAAIADAIEAAHKSDRPTFIACKTVIGFG 240

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +PN+AG++KVHGS LG +EI ATR+ALNWD +PF +P D++  WR AG RS      W+E
Sbjct: 241 APNKAGSHKVHGSPLGADEIAATRRALNWDYEPFVVPSDVLDAWRAAGTRSDNLVKAWEE 300

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
            LS  +S  R EF RR +  LP+ FD A    KKK   ++P +ATRK+SE  LE++N  +
Sbjct: 301 TLS--RSPARAEFSRRMAGDLPEGFDAAISAYKKKLAETRPTVATRKASEDALEIINGFV 358

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           PE +GGSADLT SN TKTSQM +I+ +DF+GRY+H+G+REH MA+AMNGIALH GL PYS
Sbjct: 359 PETLGGSADLTPSNNTKTSQMHSITPTDFAGRYVHWGIREHGMASAMNGIALHGGLIPYS 418

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           G F++FSDY RP IRLA+LMGIRVIHVLTHDSIG+GEDGPTHQPVE LA LRAIP+LLV 
Sbjct: 419 GGFLIFSDYCRPPIRLAALMGIRVIHVLTHDSIGVGEDGPTHQPVEQLAGLRAIPNLLVF 478

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQV 561
           RPAD+ ET ECWQ+A+K  NRPS L+L+RQNL   RT+Y   NLC  GAY      +A+V
Sbjct: 479 RPADATETAECWQIAIKTHNRPSGLALTRQNLSPARTEYSEKNLCEQGAYTLAGNADAKV 538

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
           TIF+SGSE++IAV A   L ++ +S RVVSVPC ELFFEQ ++YR Q++G+SP+KIA+EA
Sbjct: 539 TIFASGSEVEIAVAARAALEAKGVSVRVVSVPCTELFFEQPEAYRKQVLGNSPVKIAVEA 598

Query: 622 GLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +R+GWDAFIG +G+FIGM+ FGASG    +Y+HFGI A A+V   E KL
Sbjct: 599 AVREGWDAFIGPEGTFIGMKSFGASGPVKDVYKHFGITADAVVAAAEAKL 648


>gi|209550812|ref|YP_002282729.1| transketolase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209536568|gb|ACI56503.1| transketolase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 657

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/659 (63%), Positives = 518/659 (78%), Gaps = 2/659 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   + + +MA+AIRFL+MDA+E  NSGHPG+PMGMADV T LFT+ + FDP+ P+WPNR
Sbjct: 1   MTSPEQHDRMANAIRFLAMDAVEKANSGHPGMPMGMADVATVLFTKYLKFDPKKPHWPNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLSAGHGSML Y+LLYL GY D+T+ED+K FR +GSKTAGHPEYG   GIE TTGPL
Sbjct: 61  DRFVLSAGHGSMLLYSLLYLTGYPDMTVEDLKQFRQLGSKTAGHPEYGHATGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQGIAN+VGMAIAERKLREEFG  L DH+TY + GDGCLMEGIS EAI+ AGHL L+KL+
Sbjct: 121 GQGIANSVGMAIAERKLREEFGADLQDHFTYAICGDGCLMEGISHEAIALAGHLKLNKLV 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           + WDNN I+IDG +SL+DSTDQ ARF+A  WNT+ ++GHD  AI + +  A  SD+PT I
Sbjct: 181 LFWDNNSITIDGAVSLSDSTDQIARFKAVHWNTIEIDGHDQAAIAAAIDAAHKSDRPTFI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T+IGFG+PN+ GT+KVHG+ LG EEI ATRKALNW+ +PF IP D++  WR AG RS
Sbjct: 241 ACKTIIGFGAPNKQGTHKVHGNPLGAEEIAATRKALNWESEPFVIPSDVLDSWRAAGARS 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
                 W++ L+  K+  + EF RR +  LP+ FD A    KKK   +KP +ATRK+SE 
Sbjct: 301 VDLVNAWEQGLA--KAPAKAEFTRRMAGELPEGFDAAISAYKKKLAETKPTVATRKASED 358

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  LPE +GGSADLT SN TKTSQM +I+ +DF+GRY+H+G+REH MA+AMNGIA
Sbjct: 359 ALEVINGFLPETLGGSADLTPSNNTKTSQMHSITPTDFAGRYMHWGIREHGMASAMNGIA 418

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL PYSG F++FSDY RP IRLA+LMGIRVIHVLTHDSIG+GEDGPTHQPVE LA L
Sbjct: 419 LHGGLIPYSGGFLIFSDYCRPPIRLAALMGIRVIHVLTHDSIGVGEDGPTHQPVEQLAGL 478

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+L+V RPAD+ ET ECWQ+A+K  NRPS L+L+RQNL   RT+Y   NLC  GAY 
Sbjct: 479 RAIPNLMVFRPADATETAECWQIAVKTHNRPSGLALTRQNLTASRTEYSEKNLCEQGAYT 538

Query: 553 YISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
                +A+VTIF+SGSE++IAV A   L ++ ++ RVVSVPC ELFFEQ D+YR +I+G+
Sbjct: 539 LAGNADAKVTIFASGSEVEIAVAARAALEAKGVTVRVVSVPCTELFFEQPDAYRKEILGN 598

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           SP+KIA+EA +R+GWDAFIG +G+FIGM+GFGASG    +Y+HFGI A A+V   E KL
Sbjct: 599 SPVKIAVEAAVREGWDAFIGPEGTFIGMKGFGASGPVKDVYKHFGITADAVVAAAEAKL 657


>gi|319781131|ref|YP_004140607.1| transketolase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167019|gb|ADV10557.1| transketolase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 663

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/647 (62%), Positives = 499/647 (77%), Gaps = 1/647 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   + + +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T LFT+ + +DP+ P+WP+R
Sbjct: 1   MTSREQHDRMANAIRFLSMDAVEKANSGHPGLPMGCADIATVLFTKFLKYDPKAPHWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRF+LSAGHGSML Y+LL+L GY+D+TI+ IK+FR +GSKTAGHPEYG   GIE TTGPL
Sbjct: 61  DRFILSAGHGSMLLYSLLHLTGYEDMTIDQIKHFRQLGSKTAGHPEYGHATGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+AN+VG A+ ER +   FG+ L+DHYTYVL GDGCLMEG+SQEAI+ AGHL L+KLI
Sbjct: 121 GQGLANSVGFALGERIMNAAFGNDLVDHYTYVLAGDGCLMEGVSQEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           V WDNN ISIDGP+SLAD+TDQ ARF+ASGWN   ++G D  AI   +  A+ SDKPTMI
Sbjct: 181 VFWDNNNISIDGPVSLADNTDQVARFQASGWNASHIDGTDPEAIAYAIEAARHSDKPTMI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+P +AGTNK HGS LG +EI   RK  NWD  PF IP DI+  WR AG   
Sbjct: 241 ACKTTIGFGAPTKAGTNKAHGSPLGADEIAGARKFFNWDSPPFEIPADILDAWRAAGKTG 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ R DW+ RL+  +  ++ EFERR +  LP  FD    + KKK    KP +ATRKSSE+
Sbjct: 301 AKPRTDWEGRLAKAEPKLKAEFERRLAGKLPSNFDAVIADYKKKLSADKPKVATRKSSEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE I GSADLTGSN TKTSQ K I+  D+  RY+HYG+REH MAAA+NG+ 
Sbjct: 361 ALEVINGAVPETISGSADLTGSNNTKTSQTKNITPDDYGQRYVHYGIREHGMAAAINGLT 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL  Y GTF+ FSDY+RP++RLASLMGIR I V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 421 LHGGLIAYGGTFLCFSDYARPSMRLASLMGIRSIFVMTHDSIGLGEDGPTHQPVEHLAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++ET ECWQ+AL+ +  PS L+L+RQNLP +RT++ + NL + GAY+
Sbjct: 481 RAIPNHNVFRPADAVETAECWQIALESEKTPSTLALTRQNLPTVRTEFSAKNLSSQGAYE 540

Query: 553 Y-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              ++  A +TIF++GSE++IA+ A E+L      TRVVSVPCFELF +QSD YR + IG
Sbjct: 541 LAAASGEAAITIFATGSEVEIALGARELLEKHGHPTRVVSVPCFELFDQQSDDYRKKTIG 600

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGI 658
           ++PIK+AIEAG+RQGWD  IGSDG F+GM GFGASG+ + LY HFGI
Sbjct: 601 NAPIKMAIEAGIRQGWDHLIGSDGIFVGMTGFGASGTIEQLYPHFGI 647


>gi|13473220|ref|NP_104787.1| transketolase [Mesorhizobium loti MAFF303099]
 gi|14023968|dbj|BAB50573.1| transketolase [Mesorhizobium loti MAFF303099]
          Length = 683

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/648 (61%), Positives = 498/648 (76%), Gaps = 1/648 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   + + +MA+AIRFLSMDA+E   SGHPGLPMG AD+ T LFT+ + +DP+ P+WP+R
Sbjct: 21  MTSREQHDRMANAIRFLSMDAVEKAQSGHPGLPMGCADIATVLFTRFLKYDPKAPHWPDR 80

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRF+LSAGHGSML Y+LL+L GY+D+TI+ IK+FR +GSKTAGHPEYG   GIE TTGPL
Sbjct: 81  DRFILSAGHGSMLLYSLLHLTGYEDMTIDQIKHFRQLGSKTAGHPEYGHATGIETTTGPL 140

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+AN+VG A+ ER +   FG+ L+ HYTYVL GDGCLMEG+SQEAI+ AGHL L+KLI
Sbjct: 141 GQGLANSVGFALGERIMNAAFGNDLVSHYTYVLAGDGCLMEGVSQEAIALAGHLKLNKLI 200

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           V WDNN ISIDGP+SLAD+TDQ ARF+ASGWN   ++G D  AI   +  A+ SDKPTMI
Sbjct: 201 VFWDNNNISIDGPVSLADNTDQVARFQASGWNASHIDGTDPEAIAYAIEAARHSDKPTMI 260

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+P +AGTNK HGS LG +EI   RK  NW+  PF IP DI+  WR AG   
Sbjct: 261 ACKTTIGFGAPTKAGTNKAHGSPLGADEIAGARKFFNWESPPFEIPADILDAWRTAGKAG 320

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           ++ RADW+ RL+  +  ++ EFERR +  LP  FD    + KKK    KP +ATRKSSE+
Sbjct: 321 AKPRADWEGRLAKAEPKLKAEFERRLAGKLPSNFDAVIADYKKKLSADKPKVATRKSSEM 380

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  +PE IGGSADLTGSN TKTSQ K I+  D+  RY+HYG+REH MAAA+NG+ 
Sbjct: 381 ALEVINGAVPETIGGSADLTGSNNTKTSQTKNITPDDYGQRYVHYGIREHGMAAAINGLT 440

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL  Y GTFM FSDY+RP++RL+SLMGIR I V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 441 LHGGLIAYGGTFMCFSDYARPSMRLSSLMGIRSIFVMTHDSIGLGEDGPTHQPVEHLAAL 500

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++ET ECWQ+AL+ +  PS L+L+RQNLP +R ++ + NL + GAY+
Sbjct: 501 RAIPNHNVFRPADAVETAECWQIALESEKTPSTLALTRQNLPTVRIEHSAKNLSSQGAYE 560

Query: 553 Y-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              ++  A VTIF++GSE++IA+ A ++L      TRVVSVPCFELF +QSD YR + IG
Sbjct: 561 LAAASGEAAVTIFATGSEVEIALGARDLLEKHGHPTRVVSVPCFELFDKQSDDYRKKTIG 620

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           ++PIK+AIEAG+RQGWD  IGSDG F+GM GFGASG+ + LY HFGI 
Sbjct: 621 NAPIKMAIEAGIRQGWDHLIGSDGIFVGMTGFGASGTIEQLYPHFGIT 668


>gi|307944527|ref|ZP_07659867.1| transketolase [Roseibium sp. TrichSKD4]
 gi|307772276|gb|EFO31497.1| transketolase [Roseibium sp. TrichSKD4]
          Length = 661

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/656 (62%), Positives = 517/656 (78%), Gaps = 1/656 (0%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + +++MA+AIRFL++DA+E   SGHPGLPMG AD+ T LFTQ + FDP  P W +RDRFV
Sbjct: 5   EKHQRMANAIRFLAIDAVEQAKSGHPGLPMGAADIATVLFTQFLKFDPTAPNWADRDRFV 64

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSML Y+LLYLLGY+D T++ IKNFR IG+ TAGHPE+G  AGIE TTGPLGQG+
Sbjct: 65  LSAGHGSMLLYSLLYLLGYEDFTLDQIKNFRQIGALTAGHPEFGHGAGIETTTGPLGQGL 124

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
            NAVGMAIAER +  E+G  L++H+TYVL GDGCLMEGISQEAIS AGHL L+KLIV+WD
Sbjct: 125 GNAVGMAIAERLMESEYGQDLVNHFTYVLAGDGCLMEGISQEAISLAGHLKLNKLIVIWD 184

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +NGISIDG + + DST+Q  RF+ASGWNT+SV+GHD  AI + +R+AQ S+ PT++A +T
Sbjct: 185 DNGISIDGRVDITDSTNQIERFKASGWNTISVDGHDPDAIAAAIRQAQASNAPTLVAAKT 244

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
            IGFG+PN++GT+ VHG+ LG +EI +TR+ALNW  +PF IP+DI+  WR+AGLRS+   
Sbjct: 245 TIGFGAPNKSGTSGVHGAPLGADEIASTREALNWSHEPFEIPNDILDAWRIAGLRSAHAH 304

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
            DW++R +     +R EFERR    LP     A  + KKK    KP +ATRK+S+ VLEV
Sbjct: 305 KDWEKRFAEKDGEVRAEFERRQRGDLPAELTEALRDYKKKLAEEKPTMATRKASQAVLEV 364

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +N  +PE IGGSADLTGSN TKTSQ  AI+  DFSGRY+H+G+REH MAAAMNG+ALH G
Sbjct: 365 INGVVPETIGGSADLTGSNNTKTSQTAAITPDDFSGRYIHWGIREHGMAAAMNGMALHGG 424

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           + PYSG F++FSDY RP+IRLA+LM  RVIHV+THDSIGLGEDGPTHQPVEH AALRA+P
Sbjct: 425 VLPYSGGFLIFSDYCRPSIRLAALMNQRVIHVMTHDSIGLGEDGPTHQPVEHYAALRAMP 484

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-S 555
           +    RPAD  ETLECWQ+AL+ K  PS+L+L+RQNL   RT++E  NLCA GAY  + S
Sbjct: 485 NTYFFRPADITETLECWQLALENKTAPSILALTRQNLIAQRTEFEEKNLCARGAYVLVDS 544

Query: 556 TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
             +AQVT+F+SGSE+++AVEA   L+   I+TRVVSVPCFELF EQSD Y+  ++G+SP+
Sbjct: 545 EEDAQVTLFASGSEVELAVEASTQLAEAGIATRVVSVPCFELFEEQSDDYKEAVLGNSPV 604

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           KIA+EAG+R GWD FIG+DG+F+GM GFGASG    LY+HFGI   A+V++ + KL
Sbjct: 605 KIAVEAGVRMGWDRFIGADGAFVGMNGFGASGPYKELYKHFGITTDAVVELAKAKL 660


>gi|260461530|ref|ZP_05809777.1| transketolase [Mesorhizobium opportunistum WSM2075]
 gi|259032600|gb|EEW33864.1| transketolase [Mesorhizobium opportunistum WSM2075]
          Length = 663

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/647 (61%), Positives = 496/647 (76%), Gaps = 1/647 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   + + +MA+AIRFLSMDA+E  NSGHPGLPMG AD+ T LFT+ + +DP+ P W +R
Sbjct: 1   MTSREQHDRMANAIRFLSMDAVEKANSGHPGLPMGCADIATVLFTRFLKYDPKAPRWADR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRF+LSAGHGSML Y+LL+L GY+D+T++ IK+FR +GSKTAGHPEYG   GIE TTGPL
Sbjct: 61  DRFILSAGHGSMLLYSLLHLTGYEDMTLDQIKHFRQLGSKTAGHPEYGHATGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+AN+VG A+ ER +   FG+ L+DHYTYVL GDGCLMEG+SQEAI+ AGHL L+KLI
Sbjct: 121 GQGLANSVGFALGERIMNAAFGNDLVDHYTYVLAGDGCLMEGVSQEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           V WDNN ISIDGP+SLAD+TDQ ARF+ASGWN   ++G +  AI   +  A+ SDKPTMI
Sbjct: 181 VFWDNNNISIDGPVSLADNTDQVARFQASGWNASHIDGTEPEAIAYAIEAARHSDKPTMI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IGFG+P +AGTNK HGS LG +EI   RK  NWD  PF IP DI+  WR AG   
Sbjct: 241 ACKTTIGFGAPTKAGTNKAHGSPLGADEIAGARKFFNWDSPPFEIPADILDAWRTAGKAG 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            + R DW+ RL+   + ++ EFERR +  LP  FD    + KKK    KP +ATRKSSE+
Sbjct: 301 VKARTDWEGRLAKADAKLKAEFERRTNGKLPSNFDAVIADYKKKLSADKPKVATRKSSEM 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LE++N  +PE IGGSADLTGSN TKTSQ K I+  D+  RY+HYG+REH MAAA+NG+ 
Sbjct: 361 ALEIINGAVPETIGGSADLTGSNNTKTSQTKNITPDDYGQRYVHYGIREHGMAAAINGLT 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL  Y GTF+ FSDY+RP++RLASLMGIR I V+THDSIGLGEDGPTHQPVEH+AAL
Sbjct: 421 LHGGLIAYGGTFLCFSDYARPSMRLASLMGIRSIFVMTHDSIGLGEDGPTHQPVEHMAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+  V RPAD++ET ECWQ+AL+ +  PS L+L+RQNLP +RT++   NL + GAY+
Sbjct: 481 RAIPNHNVFRPADAVETAECWQIALESEKTPSTLALTRQNLPTVRTEHSDKNLSSQGAYE 540

Query: 553 Y-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              ++  A VTIF++GSE++IA+ A ++L      TRVVSVPCFELF +QSD YR + IG
Sbjct: 541 LAAASGEAAVTIFATGSEVEIALGARDLLEKHGHPTRVVSVPCFELFDKQSDGYRKKTIG 600

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGI 658
           ++PIK+AIEAG+RQGWD  IGSDG FIGM GFGASG+ + LY HFGI
Sbjct: 601 NAPIKMAIEAGIRQGWDHLIGSDGIFIGMTGFGASGTIEQLYPHFGI 647


>gi|328542529|ref|YP_004302638.1| transketolase protein [polymorphum gilvum SL003B-26A1]
 gi|326412275|gb|ADZ69338.1| Transketolase protein [Polymorphum gilvum SL003B-26A1]
          Length = 666

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/645 (64%), Positives = 501/645 (77%), Gaps = 1/645 (0%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + +++MA+AIRFL+MDA+E   SGHPGLPMG AD+ T LFTQ + FDP  P WP+RDRFV
Sbjct: 5   EKHQRMANAIRFLAMDAVEKAKSGHPGLPMGAADIATVLFTQFLKFDPTAPDWPDRDRFV 64

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSML Y  LYLLGY+D +++++KNFR IG++TAGHPE+G  AGIE TTGPLGQG+
Sbjct: 65  LSAGHGSMLLYGALYLLGYEDFSLDELKNFRQIGARTAGHPEFGHGAGIETTTGPLGQGL 124

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           ANAVGMAIAER     FGD L+DHYTYVL GDGCLMEGISQEA++ AGHL LSKLIV+WD
Sbjct: 125 ANAVGMAIAERLQATRFGDDLVDHYTYVLAGDGCLMEGISQEALTLAGHLKLSKLIVIWD 184

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +NGISIDG + + DSTDQ ARF ASGW T+ V+GHD  AI + LR AQ SD+PT+IA +T
Sbjct: 185 DNGISIDGRVDVTDSTDQIARFEASGWATIRVDGHDPAAIAAALRTAQASDRPTLIAAKT 244

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
            IGFG+P +AG+ KVHGS LG +EI ATRKALNW   PF IP D++  WR+AGLRS+   
Sbjct: 245 TIGFGAPTKAGSAKVHGSPLGADEIAATRKALNWPHAPFEIPSDVLDAWRIAGLRSAHAH 304

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
            DW++R ++  +  R EFERR    LP     A    KKK    +P +ATR++SE VL V
Sbjct: 305 KDWEKRFAAKDAETRAEFERRNRGDLPAALKPALQAYKKKLAEERPTLATRQASEAVLTV 364

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +N+ +PE IGGSADLTGSN TKT Q   ++  DFSGRY+H+G+REH MAAAMNG+ALH G
Sbjct: 365 INEVVPETIGGSADLTGSNNTKTPQTLPVTPDDFSGRYIHWGIREHGMAAAMNGMALHGG 424

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           + PYSGTF+VFSDY RPA+RLA+LM  RVIHV+THDSIGLGEDGPTHQPVEH AALRAIP
Sbjct: 425 VIPYSGTFLVFSDYCRPALRLAALMKQRVIHVMTHDSIGLGEDGPTHQPVEHFAALRAIP 484

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-S 555
           DLL  RPAD  ETLECWQ+AL   ++PSVL+L+RQ L   RT +E +NLCA GAY    +
Sbjct: 485 DLLFFRPADVTETLECWQLALAADDKPSVLALTRQGLAAQRTAFEEDNLCARGAYVLADA 544

Query: 556 TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
              A  TIF+SGSE++IA+ A   L++  I+TRVVSVPCFELF +QSD YRA +IG+SP+
Sbjct: 545 EEGAAATIFASGSEVEIAMAARTALAADGIATRVVSVPCFELFEQQSDDYRAAVIGNSPV 604

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINA 660
           K+A+EAG+R GWD FIGSDG F+GM GFGASG    LY HFGI +
Sbjct: 605 KVAVEAGIRMGWDRFIGSDGLFVGMTGFGASGPYKELYAHFGITS 649


>gi|254500322|ref|ZP_05112473.1| transketolase [Labrenzia alexandrii DFL-11]
 gi|222436393|gb|EEE43072.1| transketolase [Labrenzia alexandrii DFL-11]
          Length = 662

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/658 (62%), Positives = 506/658 (76%), Gaps = 1/658 (0%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + +++MA+AIRFL++DA+E   SGHPGLPMG AD+ T LFT+ + FDP  P W +RDRFV
Sbjct: 5   EKHQRMANAIRFLAIDAVEQAKSGHPGLPMGAADIATVLFTEFLKFDPTAPSWADRDRFV 64

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSML Y+LLYLLGY+D  +E++KNFR +G+KTAGHPE+G  AGIE TTGPLGQG+
Sbjct: 65  LSAGHGSMLLYSLLYLLGYEDFPLEELKNFRQLGAKTAGHPEFGHGAGIETTTGPLGQGL 124

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
            NAVGMAIAER   E FG  L++HYTYVL GDGCLMEGISQEA+S AGHL L+KLIV+WD
Sbjct: 125 GNAVGMAIAERLQEERFGKDLVNHYTYVLAGDGCLMEGISQEALSLAGHLKLNKLIVIWD 184

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +NGISIDG +S+ DSTDQ ARF ASGWNTL+V+GHD   I + +R+AQ SDKPT+IA +T
Sbjct: 185 DNGISIDGAVSITDSTDQVARFAASGWNTLNVDGHDPDGIAAAIRQAQASDKPTLIAAKT 244

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
            IGFG+P +AGT KVHG+ LG EEI  TR+ LNW  +PF +P DI+  WR+AGLRS+   
Sbjct: 245 TIGFGAPTKAGTAKVHGAPLGAEEIAGTRETLNWPHEPFEVPSDILDAWRIAGLRSAHAH 304

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
            DWQ+R +   +  R EFERR    LP  F+ A ++ KKK    +P +ATRK+SE VL V
Sbjct: 305 KDWQKRFNDADTETRAEFERRNRGDLPAGFEQAVLDYKKKLAEEQPTMATRKASEAVLGV 364

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +N  +PE IGGSADLTGSN TKT+Q   ++  DFSGRY+HYG+REH MAAAMNG+ALH G
Sbjct: 365 INGVIPETIGGSADLTGSNNTKTAQTNPVTPDDFSGRYIHYGIREHGMAAAMNGMALHGG 424

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           L PYSG F++FSDY RP+IRLA+LM  RVIHV+THDSIGLGEDGPTHQPVEH AALRAIP
Sbjct: 425 LIPYSGGFLIFSDYCRPSIRLAALMNQRVIHVMTHDSIGLGEDGPTHQPVEHFAALRAIP 484

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-S 555
           +L   RPAD  ETLECWQ++L+ K+ PSVL+L+RQNLP  R  +E  NL A GAY  I S
Sbjct: 485 NLTFFRPADITETLECWQLSLENKDGPSVLALTRQNLPSQRKTFEEKNLSANGAYVLIDS 544

Query: 556 TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
             +A VTIF+SGSE++IAV+A + L    I+ RVVSVP FELF  QS  Y+  +IGSSP+
Sbjct: 545 EDDAAVTIFASGSEVEIAVDAHKELMGSGIAARVVSVPSFELFEAQSADYKEAVIGSSPV 604

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
           K+A+EAG+R GWD FIG+DG FIGM GFGAS     LY+HFGI   A+V   +  L+ 
Sbjct: 605 KVAVEAGIRMGWDRFIGNDGLFIGMTGFGASAPYKELYEHFGITKDAVVAAAKENLNA 662


>gi|90418733|ref|ZP_01226644.1| transketolase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336813|gb|EAS50518.1| transketolase [Aurantimonas manganoxydans SI85-9A1]
          Length = 689

 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/661 (60%), Positives = 505/661 (76%), Gaps = 1/661 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   D ++ MA+AIRFLS DA+E  NSGHPGLPMG AD+ T LF++ + FDP+ P+W +R
Sbjct: 23  MTSPDTHRDMANAIRFLSADAVEAANSGHPGLPMGAADIATVLFSRFLTFDPRAPHWADR 82

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFV SAGHGSML Y+LLYLLGY  V I+D+K FR +GSKTAGHPEY  C GIE TTGPL
Sbjct: 83  DRFVFSAGHGSMLLYSLLYLLGYDGVGIDDLKAFRQLGSKTAGHPEYKHCEGIETTTGPL 142

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+ NAVGMA+AER +   FGD ++DH TYVL GDGCLMEG+SQE+I+ AGHL LSKLI
Sbjct: 143 GQGLGNAVGMALAERIMNARFGDAIVDHRTYVLAGDGCLMEGLSQESIALAGHLRLSKLI 202

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VLWD+NGI+IDG ++L+DSTDQ ARF AS WNTL  +GHD  AI   +  AQ SD+PT+I
Sbjct: 203 VLWDDNGITIDGDVALSDSTDQMARFAASNWNTLRCDGHDQEAIAEAITAAQGSDRPTLI 262

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+T IG G+P +AG+ K HG+ LG +EI   R+AL WD +PF IP  I+ +WRLAGLRS
Sbjct: 263 ACKTNIGHGAPTKAGSAKAHGAPLGADEIAQMREALGWDHEPFEIPAAILDRWRLAGLRS 322

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           S  R +W+ R + + +  R EFERR    LP  F  A    K++F   +P IATRK+SEL
Sbjct: 323 STHRKEWERRFAEIDAETRGEFERRVRGDLPSGFTQALQRCKRRFNEERPEIATRKASEL 382

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+N  + E IGGSADLTGSN T+TSQ  AI+  +++GRY+HYG+REH MAAAMNG+A
Sbjct: 383 ALEVLNAVVVETIGGSADLTGSNNTRTSQTDAIAPGEYAGRYIHYGIREHGMAAAMNGLA 442

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ PY GTF+VFSDY+R A+RL++LMG+RV++VLTHDSIGLGEDGPTHQPVEHLA+L
Sbjct: 443 LHGGIIPYGGTFLVFSDYARGAMRLSALMGLRVVYVLTHDSIGLGEDGPTHQPVEHLASL 502

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RA+P++ V RPAD++ETLECWQ+AL+ ++ PSVL+LSRQ+LP LR      N  A GAY+
Sbjct: 503 RAMPNMQVFRPADAVETLECWQLALESRDAPSVLALSRQSLPTLRLDQHDENKSARGAYE 562

Query: 553 YISTP-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
             ST  +A+VTI+++GSE++IA+ A  IL +  I TRVVSVPC ELF  QS  YR+ ++ 
Sbjct: 563 ISSTSGDAEVTIYATGSEVQIALAASTILEADGIPTRVVSVPCVELFDRQSPEYRSAMLD 622

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +  +K+AIEAG+RQGWD F+G +G FIGM GFGASG    LY+HFGI   A+V  V  +L
Sbjct: 623 NGGLKVAIEAGVRQGWDHFVGRNGIFIGMDGFGASGPAPELYEHFGITTEAVVAAVRARL 682

Query: 672 S 672
           +
Sbjct: 683 A 683


>gi|299134162|ref|ZP_07027355.1| transketolase [Afipia sp. 1NLS2]
 gi|298590909|gb|EFI51111.1| transketolase [Afipia sp. 1NLS2]
          Length = 668

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/644 (60%), Positives = 487/644 (75%), Gaps = 4/644 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D  +MA+AIR L+MDA+E  NSGHPGLPMG AD+ T LFTQ + FD + P W +RDRFVL
Sbjct: 11  DPSRMANAIRALAMDAVEKANSGHPGLPMGAADIATVLFTQFLKFDARDPKWADRDRFVL 70

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL G + +TI+ IKNFR +GS T GHPE     GIE TTGPLGQGI+
Sbjct: 71  SAGHGSMLLYALLYLTGNEAMTIDQIKNFRQLGSLTPGHPENFITPGIEMTTGPLGQGIS 130

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
            AVGMA+AER L  EFG  ++DH TYVL  DG LMEGISQEAI+ AGHL L+K+IVL+D+
Sbjct: 131 TAVGMALAERHLAAEFGGDIVDHTTYVLASDGDLMEGISQEAIALAGHLKLNKMIVLFDD 190

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGISIDG ISL+DS DQ  RF A+GW    ++GH+H AI   + +AQ SD+PT+IAC+T 
Sbjct: 191 NGISIDGAISLSDSVDQVKRFEAAGWAAERIDGHNHDAIVDAIARAQKSDRPTLIACKTT 250

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           I FG+P +AGT+K HGS LG EEI   RK LNWD  PF IP DI++ WR AG R +   A
Sbjct: 251 IAFGAPTKAGTSKSHGSPLGAEEIAGARKQLNWDAPPFEIPADILEAWRAAGSRGAAVHA 310

Query: 318 DWQERLSSMKSSIRKEFERRFSDALP-DCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           +W ++L+S  +  R EFERR    LP     +A   +K     +   IATR +SE  LEV
Sbjct: 311 EWAKKLASKDAGQRAEFERRMKGDLPAKALKDAVAKMKAALAEAPKDIATRTASERALEV 370

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +   +PE++GGSADLTGSN T+   M AIS +++ GRY++YG+REH MAAAMNG+ALH G
Sbjct: 371 LIPAVPEMVGGSADLTGSNNTRIKDMVAISANNYGGRYVNYGIREHGMAAAMNGMALHGG 430

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           + PYSGTF+VFSDY RP++RLA+LMG  VIHVLTHDSIGLGEDGPTHQPVEH+AALRAIP
Sbjct: 431 IIPYSGTFLVFSDYLRPSLRLAALMGECVIHVLTHDSIGLGEDGPTHQPVEHVAALRAIP 490

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           +L V RP D++ETLECWQ+AL+ K+RPSVL+L+RQNLP LR   +++N CA GAY+ IS 
Sbjct: 491 NLNVFRPCDTVETLECWQLALEAKDRPSVLALTRQNLPQLRRSNDADNKCAAGAYE-ISK 549

Query: 557 PN--AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSP 614
            +  A+V+IF+SGSE+ +AVEA ++L++R I+ RVVSVPC +LF E  ++ RA +IG++P
Sbjct: 550 ADGEAKVSIFASGSEVSLAVEAQKLLAARGIAARVVSVPCMDLFLEAPEAVRAALIGNAP 609

Query: 615 IKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGI 658
           +K+ +EA +RQGWDA IGSDG F+GM GFGAS     LY HFGI
Sbjct: 610 VKVGVEAAIRQGWDAIIGSDGIFVGMSGFGASAPYKTLYSHFGI 653


>gi|114705096|ref|ZP_01438004.1| transketolase [Fulvimarina pelagi HTCC2506]
 gi|114539881|gb|EAU43001.1| transketolase [Fulvimarina pelagi HTCC2506]
          Length = 663

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/651 (59%), Positives = 488/651 (74%), Gaps = 1/651 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIRFLS DA+EN  SGHPGLP+G AD+ T LFT+ M FDP  P WPNRDRFV SAGH
Sbjct: 1   MANAIRFLSADAVENAGSGHPGLPLGAADIATVLFTRFMRFDPTMPEWPNRDRFVFSAGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+LL+LLGY+D+ IE+I++FR +GSK AGHPEYG  AGIE TTGPLGQGIANAVG
Sbjct: 61  GSMLLYSLLHLLGYKDIGIEEIRSFRQLGSKAAGHPEYGHAAGIETTTGPLGQGIANAVG 120

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MAIAER L   FGD L+DH TYV VGDGCLMEGISQEAIS AG L LSKL +LWD+NGI+
Sbjct: 121 MAIAERHLAARFGDELVDHRTYVFVGDGCLMEGISQEAISLAGQLKLSKLTMLWDDNGIT 180

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG +SLAD+TDQ ARF+ASGW+T S +GHD   I + L  A  SDKP+++ C T IGFG
Sbjct: 181 IDGAVSLADATDQLARFQASGWDTFSCDGHDQDEIAAALEAANASDKPSLVDCRTTIGFG 240

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +  +AGT K HGS LG++EIK  R+ L+W  +PF +P +I  +WR+AGLRS+  R  W+E
Sbjct: 241 ASGKAGTAKAHGSPLGEDEIKQMRETLDWPHEPFEVPANITDQWRIAGLRSAAARRKWEE 300

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           R +++ +  R EF+R     LP          K+     +P +ATRK+SE+ LEV+N+ +
Sbjct: 301 RHAALDAEQRGEFDRLHRGDLPSGLQQRIERAKRNANEMRPAVATRKASEMALEVINEIV 360

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           PE +GGSADLTGSN T T  +  +S  +  GRY+HYG+REHAMA  MNG+ALH G+ PY 
Sbjct: 361 PETLGGSADLTGSNNTLTEGLGVLSAENHDGRYIHYGIREHAMAGIMNGLALHGGVIPYG 420

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           GTF+ FSDY+R AIRL++LMG+RV++VLTHDSIGLGEDGPTHQPVEHLAALRAIP+L V+
Sbjct: 421 GTFLAFSDYARGAIRLSALMGLRVVYVLTHDSIGLGEDGPTHQPVEHLAALRAIPNLAVM 480

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST-PNAQ 560
           RPAD +ETLECW +AL+ ++RP+VL+LSRQ +P LRT     N  + GAY+ +S    A+
Sbjct: 481 RPADIVETLECWHLALESEDRPTVLALSRQAVPALRTDEHDENKSSRGAYELVSAHGEAK 540

Query: 561 VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIE 620
           VT+F++G+E++IAV A + L      TRVVSVPCFELF  Q+++YRA  +    +K+AIE
Sbjct: 541 VTLFATGTEVEIAVAAQKSLEQDGYPTRVVSVPCFELFEAQTETYRAAFLDDPSLKVAIE 600

Query: 621 AGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           AG+RQGWDA IG  G F+GM GFGASG    LY HFGI A  +V  V  ++
Sbjct: 601 AGVRQGWDALIGRHGIFVGMNGFGASGKAGELYTHFGITADEVVRQVRERM 651


>gi|154252555|ref|YP_001413379.1| transketolase [Parvibaculum lavamentivorans DS-1]
 gi|154156505|gb|ABS63722.1| transketolase [Parvibaculum lavamentivorans DS-1]
          Length = 684

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/642 (57%), Positives = 485/642 (75%), Gaps = 1/642 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +  MA+AIR L+MDA++  NSGHPG+PMG AD+ T LFT+ +  DP+ P WP+RDRFVLS
Sbjct: 27  HDAMANAIRALAMDAVQKANSGHPGMPMGAADIATVLFTKFLKIDPRQPDWPDRDRFVLS 86

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML YA+ YLLGY+D+TIE IKNFR +G+ TAGHPEYG  AG+E TTGPLGQGI+ 
Sbjct: 87  AGHGSMLLYAVNYLLGYEDMTIEQIKNFRQLGAITAGHPEYGHVAGVETTTGPLGQGIST 146

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           AVGMA+AER L   FGD ++DH+TYVL  DG LMEG+S EAI  AGHL LSKLIVL+D+N
Sbjct: 147 AVGMALAERLLAARFGDEVVDHFTYVLASDGDLMEGVSHEAIGLAGHLKLSKLIVLYDDN 206

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            I+IDG +SL++S D   RF A+GWN + ++GH+   IT+ + KAQ +D+P++IAC TVI
Sbjct: 207 EITIDGALSLSESGDALKRFEAAGWNAVRIDGHNPAEITAAIEKAQQADRPSLIACRTVI 266

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           G+GSPN+ G +  HGS LG+EEI   R+ L+W  +PF IP + +  WR+AGLR+ + R  
Sbjct: 267 GYGSPNKRGKSSSHGSPLGEEEISLARELLHWQAEPFVIPSETLDAWRIAGLRNVKARKG 326

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W++RL+++ +  R +FERR +  LP     A    K+K    KP  ATRKSSE  L V+N
Sbjct: 327 WEDRLAALPAEKRIDFERRIAGDLPAELGKAISAFKQKLVAEKPKWATRKSSEEALNVIN 386

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             LP+ IGGSADLTGSN T++   + ++  DFSG ++HYG+REH MAAAMNG+ALHKG  
Sbjct: 387 AALPDTIGGSADLTGSNNTRSKGQQPVTAEDFSGSFIHYGIREHGMAAAMNGLALHKGFI 446

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PYSGTF+VF+DY RPAIRL++LMG RVI+V+THDSIGLGEDGPTHQPVEHLA+LRA+P+L
Sbjct: 447 PYSGTFLVFTDYCRPAIRLSALMGQRVIYVMTHDSIGLGEDGPTHQPVEHLASLRAMPNL 506

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-STP 557
           LV RPAD++ETLECWQ+AL+  + PS+L+LSRQNLP +R +    NLCA GAY+ + ++ 
Sbjct: 507 LVFRPADAVETLECWQLALESADAPSILALSRQNLPAMRIENSEKNLCARGAYELVAASS 566

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
            A+V++ ++GSE++IAV A ++L    I  RVVS+PC +LF  QS  ++ +++G   +KI
Sbjct: 567 KAKVSLLATGSEVEIAVAAQQMLEKEGIPARVVSMPCLDLFDLQSPDFQKEMLGEGTVKI 626

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           AIEA +R GWD +IG DG FIGM GFGAS     LY+HF I 
Sbjct: 627 AIEAAVRYGWDRYIGPDGDFIGMTGFGASAPAPELYKHFNIT 668


>gi|209886422|ref|YP_002290279.1| transketolase [Oligotropha carboxidovorans OM5]
 gi|209874618|gb|ACI94414.1| transketolase [Oligotropha carboxidovorans OM5]
          Length = 654

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/638 (60%), Positives = 485/638 (76%), Gaps = 2/638 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR L+MDA+E   SGHPGLPMG AD+ T LFTQ + FD + P W +RDRFVLSAGH
Sbjct: 1   MANAIRALAMDAVEKAKSGHPGLPMGAADIATVLFTQFLKFDARAPKWADRDRFVLSAGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALLYL G + +TIE+IK+FR +GSKT GHPE     GIE TTGPLGQGI+ AVG
Sbjct: 61  GSMLLYALLYLTGNETMTIEEIKSFRQLGSKTPGHPENFVTPGIEMTTGPLGQGISTAVG 120

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER L  EFG  L+DH+TYVL  DG LMEG+SQEAI+ AGHL L+++IVL+D+NGIS
Sbjct: 121 MALAERHLAAEFGGDLVDHFTYVLASDGDLMEGVSQEAIALAGHLKLNRMIVLFDDNGIS 180

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG ISL+DS DQ  RF A+GW    ++GHDH AI   + +AQ SD+PT+IAC+T I FG
Sbjct: 181 IDGAISLSDSVDQVKRFEAAGWAACRIDGHDHDAIADAIARAQKSDRPTLIACKTTIAFG 240

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +P +AG++K HGS LG +EI  TRKALNWD  PF IP DI+  WR AG R +  R+ W++
Sbjct: 241 APTKAGSSKSHGSPLGADEIAGTRKALNWDAPPFEIPADILDAWRAAGSRGAALRSAWEK 300

Query: 322 RLSSMKSSIRKEFERRFSDALP-DCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
           +L+++ ++ R EFERR    LP     +A  N+K     +   IATR +SE  LE +   
Sbjct: 301 KLAAVDATQRAEFERRMKGDLPVKALTDAVANMKAALAEAPKDIATRTASEQALEALVPV 360

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
           +PE++GGSADLTGSN T+T  M AIS +++ GRY++YG+REH MAAAMNG+ALH G+ PY
Sbjct: 361 VPEMVGGSADLTGSNNTRTKAMVAISANNYGGRYVNYGIREHGMAAAMNGMALHGGIIPY 420

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
           SGTF+VFSDY RP++RLA+LMG RVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP+L V
Sbjct: 421 SGTFLVFSDYLRPSLRLAALMGERVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPNLNV 480

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-STPNA 559
            RP D++ETLECWQ+AL+ K+RPSVL+L+RQNLP LR   ++ N  A GAY+   +   A
Sbjct: 481 FRPCDTVETLECWQLALEAKDRPSVLALTRQNLPQLRRSNDAANRSAAGAYEISPAQGEA 540

Query: 560 QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAI 619
           +V+IF+SGSE+ +AVEA   L +R I TRVVSVPC +LF E  ++ R+ +IG++P+K+ +
Sbjct: 541 KVSIFASGSEVSLAVEAQTQLVARGIPTRVVSVPCMDLFLEAPEATRSALIGNAPVKVGV 600

Query: 620 EAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFG 657
           EA +RQGWDA IG+DG F+GM GFGAS     LY HFG
Sbjct: 601 EAAIRQGWDAIIGADGIFVGMSGFGASAPYKELYNHFG 638


>gi|39934022|ref|NP_946298.1| transketolase [Rhodopseudomonas palustris CGA009]
 gi|39647869|emb|CAE26389.1| transketolase [Rhodopseudomonas palustris CGA009]
          Length = 661

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/657 (56%), Positives = 486/657 (73%), Gaps = 3/657 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ +MA+AIR L+MDA+E   SGHPGLPMG ADV T L+TQ + FD   P+WP+RDRF+L
Sbjct: 5   DHSRMANAIRALAMDAVEKAKSGHPGLPMGAADVATVLWTQFLKFDAVDPHWPDRDRFIL 64

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL G +++T++ IKNFR + SKT GHPE    + +E TTGPLGQG+A
Sbjct: 65  SAGHGSMLLYALLYLTGNEELTLDQIKNFRQLDSKTPGHPENCITSSVETTTGPLGQGVA 124

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           ++VG A+AER L+ EFGD+ +DHYTYVL  DG LMEG+S EAI+ AGHL LSKLI L+D+
Sbjct: 125 SSVGTALAERLLQAEFGDI-VDHYTYVLCSDGDLMEGVSHEAIALAGHLRLSKLIFLYDD 183

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGISIDGP+SL D+ DQ ARF+A GWN+  ++GHDH AI   +RKAQ SD+PTMIAC+T 
Sbjct: 184 NGISIDGPLSLTDTVDQVARFQAHGWNSFRIDGHDHKAIADAIRKAQASDRPTMIACKTT 243

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IGFG+P++AGT+K HG  LG EE+   +KAL WD  PF IPDD++  WR  G + +  RA
Sbjct: 244 IGFGAPHKAGTSKAHGEPLGAEELAGAKKALGWDYGPFEIPDDVLSAWRNVGKQGASARA 303

Query: 318 DWQERLSSMKSSIRKEFERRFSD-ALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           DW  R  ++ +  R +F+RR  D   P    +A   LK K       IATRK+SEL LE 
Sbjct: 304 DWLARFDALPADKRGDFKRRVIDRKRPAAIADAIRTLKDKLVAEPQTIATRKASELALEA 363

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +   +PEL+ GSADLT SN T+  Q K ++  DFSGRY+HYG+RE  MAAAMNG+A+H G
Sbjct: 364 LTPVVPELLLGSADLTPSNNTRVKQAKDVTPDDFSGRYIHYGIREMGMAAAMNGLAMHGG 423

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
            AP  GTF+ F+DY+RP++R+A+L  + V++++THDSIGLGEDGPTHQPVEHLAALRA+P
Sbjct: 424 FAPAGGTFLCFTDYARPSMRVAALSHVPVVYIMTHDSIGLGEDGPTHQPVEHLAALRAMP 483

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           ++ V RPAD++ET ECWQ+AL+  N P++L+LSRQNL  +RT     NLCA G Y+ I  
Sbjct: 484 NMRVFRPADAVETAECWQLALENTNGPTLLALSRQNLAQVRTATSEANLCATGGYELIPA 543

Query: 557 P-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
           P  AQV+IF++GSE++IAV A ++L  + ++ RVVSVP  +L   Q D+ RA IIG +P+
Sbjct: 544 PGKAQVSIFATGSEVEIAVAAQKLLEVQGVAARVVSVPSLDLLLAQDDATRAAIIGDAPV 603

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           K+A+EA +R GWDA IG DG F+GM GFGAS     LY+HFGI A A+ D  +R+L+
Sbjct: 604 KVAVEAAVRFGWDAVIGPDGGFVGMTGFGASAPAKDLYKHFGITAEAVADAAKRRLA 660


>gi|192289442|ref|YP_001990047.1| transketolase [Rhodopseudomonas palustris TIE-1]
 gi|192283191|gb|ACE99571.1| transketolase [Rhodopseudomonas palustris TIE-1]
          Length = 661

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/657 (57%), Positives = 485/657 (73%), Gaps = 3/657 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ +MA+AIR L+MDA+E   SGHPGLPMG ADV T L+TQ + FD   P+WP+RDRF+L
Sbjct: 5   DHSRMANAIRALAMDAVEKAKSGHPGLPMGAADVATVLWTQFLKFDAVDPHWPDRDRFIL 64

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL G +++T++ IKNFR + SKT GHPE    + +E TTGPLGQG+A
Sbjct: 65  SAGHGSMLLYALLYLTGNEELTLDQIKNFRQLDSKTPGHPENCITSSVETTTGPLGQGVA 124

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           ++VG A+AER L+ EFGD+ +DHYTYVL  DG LMEG+S EAI+ AGHL LSKLI L+D+
Sbjct: 125 SSVGTALAERLLQAEFGDI-VDHYTYVLCSDGDLMEGVSHEAIALAGHLRLSKLIFLYDD 183

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGISIDGP+SL D+ DQ ARF+A GWN+  ++GHDH AI   +RKAQ SD+PTMIAC+T 
Sbjct: 184 NGISIDGPLSLTDNVDQVARFQAHGWNSFRIDGHDHKAIADAIRKAQASDRPTMIACKTT 243

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IGFG+P++AGT+K HG  LG EE+   +KAL WD  PF IPDD++  WR  G + +  RA
Sbjct: 244 IGFGAPHKAGTSKAHGEPLGAEELAGAKKALGWDYGPFEIPDDVLTAWRNVGKQGASARA 303

Query: 318 DWQERLSSMKSSIRKEFERRFSD-ALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           DW  R  ++ +  R +F+RR  D   P    +A   LK K       IATRK+SEL LE 
Sbjct: 304 DWLARFDALPADKRDDFKRRVIDRKRPAAIADAIRTLKDKLVAEPQTIATRKASELALEA 363

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +   +PEL+ GSADLT SN T+  Q K ++  DFSGRY+HYG+RE  MAAAMNG+A+H G
Sbjct: 364 LTPVVPELLLGSADLTPSNNTRVKQAKDVTPDDFSGRYIHYGIREMGMAAAMNGLAMHGG 423

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
            AP  GTF+ F+DY+RP+IR+A+L  + V++++THDSIGLGEDGPTHQPVEHLAALRA+P
Sbjct: 424 FAPAGGTFLCFTDYARPSIRVAALSHVPVVYIMTHDSIGLGEDGPTHQPVEHLAALRAMP 483

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           +L V RPAD++ET ECWQ+AL+  N P++L+LSRQNL  +RT     NLCA G Y+ I  
Sbjct: 484 NLRVFRPADAVETAECWQLALENTNGPTLLALSRQNLAQVRTATSEANLCATGGYELIPA 543

Query: 557 P-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
           P  AQV+IF++GSE++IAV A ++L  + ++ RVVSVP  +L   Q D+ RA IIG +P+
Sbjct: 544 PGKAQVSIFATGSEVEIAVAAQKLLEVQGVAARVVSVPSLDLLLAQDDATRAAIIGDAPV 603

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           K+A+EA +R GWDA IG  G F+GM GFGAS     LY+HFGI A A+ D  +R+L+
Sbjct: 604 KVAVEAAVRFGWDAVIGPAGGFVGMTGFGASAPAKDLYKHFGITAEAVADAAKRRLA 660


>gi|154247003|ref|YP_001417961.1| transketolase [Xanthobacter autotrophicus Py2]
 gi|154161088|gb|ABS68304.1| transketolase [Xanthobacter autotrophicus Py2]
          Length = 663

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/642 (60%), Positives = 486/642 (75%), Gaps = 1/642 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           + +MA+AIRFL+MDA+E  NSGHPGLPMG AD+ T LFT+ + +DP  P+WP+RDRFVLS
Sbjct: 7   HDRMANAIRFLAMDAVEAANSGHPGLPMGAADIATVLFTKVLKYDPTRPFWPDRDRFVLS 66

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML Y++L+L GY+ VTIE+IK FR +GS T GHPE     GIE TTGPLGQGIA 
Sbjct: 67  AGHGSMLLYSVLHLAGYEKVTIEEIKRFRKLGSLTPGHPENFVTEGIETTTGPLGQGIAT 126

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           AVGMA+AER L   FG  ++DH+T+VL  DG LMEGISQEA   AGHL LSKLIV+WD+N
Sbjct: 127 AVGMAMAERALAARFGKDVVDHHTFVLCSDGDLMEGISQEAADLAGHLKLSKLIVMWDDN 186

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
           GISIDG  S++ STDQ ARF ASGW T  ++GHD  AI + L  A+ SD+PT+IAC TVI
Sbjct: 187 GISIDGATSISGSTDQLARFAASGWATTRIDGHDPDAILAALTAAKASDRPTLIACRTVI 246

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSP +AG+ KVHGS LG +EI ATR AL W+  PF IP D++  WR AG   S  RA 
Sbjct: 247 GFGSPKKAGSEKVHGSPLGADEIAATRAALGWEAAPFEIPADVLAGWRAAGAAGSAARAA 306

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W+ RL++   + R EFERR +  LP   + A + +K+K       +ATRKSSELVL+ + 
Sbjct: 307 WEARLAAAPEADRAEFERRIAGTLPQALEGAIVAVKQKAVADGGAVATRKSSELVLDFIT 366

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             +PE++GGSADLTGSN TK    KAI+  DF+G ++H+GVREH MAAAMNGI LHKGL 
Sbjct: 367 PVVPEMLGGSADLTGSNNTKAKGAKAITPDDFAGSFVHWGVREHGMAAAMNGITLHKGLI 426

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           P+SG F+VFSDY RP+IRLA+LMG RVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP+L
Sbjct: 427 PFSGGFLVFSDYCRPSIRLAALMGERVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPNL 486

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-STP 557
           LV+RPAD++ET ECWQ+AL+ + RPS L LSRQNLP LRT   + N  A GAY+ + ++ 
Sbjct: 487 LVMRPADTVETAECWQIALQSEGRPSALILSRQNLPILRTDATAENRSAGGAYEIVAASA 546

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
            AQ ++F++GSE+ +AVEA ++L ++ + TRVVS+P FELF E+  + RA++IG +P K+
Sbjct: 547 KAQASLFATGSEVSLAVEAAKLLEAQGVPTRVVSIPSFELFLERPAAERAKVIGDAPAKV 606

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           A+EA +R GWDA +GSD +F+GM  FGAS     L+ HFG+ 
Sbjct: 607 AVEAAIRMGWDAIVGSDAAFVGMTSFGASAPGKDLFAHFGLT 648


>gi|298293024|ref|YP_003694963.1| transketolase [Starkeya novella DSM 506]
 gi|296929535|gb|ADH90344.1| transketolase [Starkeya novella DSM 506]
          Length = 663

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/661 (56%), Positives = 476/661 (72%), Gaps = 2/661 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M   + + +MA+AIR L+MDA+E  NSGHPG+PMGMADV T LF + + FDP  P WP+R
Sbjct: 1   MSNREKHDRMANAIRALAMDAVEAANSGHPGMPMGMADVATVLFGKVLKFDPTDPQWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRF+LSAGHGSML Y+LLYL GY+ +T++DIK+FR +GS+T GHPEYG   GIE TTGPL
Sbjct: 61  DRFILSAGHGSMLIYSLLYLTGYEGMTLDDIKHFRQLGSRTPGHPEYGHTVGIETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+AN+VG A+AER L  +FGD L+DH+TYV+ GDGCLMEGIS+EAI  AG   L KLI
Sbjct: 121 GQGLANSVGFALAERMLNAQFGDDLVDHHTYVICGDGCLMEGISEEAIELAGRQKLGKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VLWD+N I+IDG  +L+ +TDQ ARF ASGW    ++GHD  AI + +  A+ +DKP++I
Sbjct: 181 VLWDDNHITIDGSTALSVATDQLARFEASGWEATRIDGHDPDAILAAIEHAKTTDKPSLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC T IG+G+PN+ GTN VHG+ LG  EI A R  LNW+  PF IP D++  WRLAGLRS
Sbjct: 241 ACRTTIGYGAPNKGGTNAVHGAPLGAAEIAAARAFLNWEYGPFEIPSDVLDAWRLAGLRS 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            Q    W +RL   +   R EFERR    LP  F      +  K       +ATRKSSE+
Sbjct: 301 RQAHKSWSQRLKDTEVGQRAEFERRIRGELPSKFGETVTGVIAKARADGGAVATRKSSEI 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKA-ISKSDFSGRYLHYGVREHAMAAAMNGI 431
            LE +   LPE++GGSADLT SN TKT      +    + GRY++YG+REH MAAAMNGI
Sbjct: 361 ALEALTAALPEMVGGSADLTHSNNTKTKATSVYVEPPKYDGRYINYGIREHGMAAAMNGI 420

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY GTF+VFSDY+R +IRLA+LMG+RV++V THDSIG+GEDGPTHQPVEHLAA
Sbjct: 421 ALHGGFIPYGGTFLVFSDYARGSIRLAALMGVRVVYVFTHDSIGVGEDGPTHQPVEHLAA 480

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LRAIP+L V RP D++ET E W++AL+ K  PSVL+L+RQNLP LRT      L A GAY
Sbjct: 481 LRAIPNLTVFRPCDTVETAEAWKLALEHKTGPSVLALTRQNLPLLRTDSSDRCLTARGAY 540

Query: 552 DYI-STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
           +   ++  AQV++F+SGSE+ +A++A E L ++ I TRVVSVPCFELF  Q +  R Q++
Sbjct: 541 ELAPASDEAQVSLFASGSEVSLAMKARETLQAQGIPTRVVSVPCFELFLNQPEETRRQVV 600

Query: 611 GSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERK 670
           G +P+KIAIEA +RQGW   +GSD +F+GM GFGASG    ++ HFGI    +V     +
Sbjct: 601 GKAPVKIAIEAAIRQGWSDIVGSDAAFVGMTGFGASGPAPEVFAHFGITPEGVVATALSR 660

Query: 671 L 671
           L
Sbjct: 661 L 661


>gi|14917047|sp|P51010|TKT_XANFL RecName: Full=Transketolase; Short=TK
 gi|7239153|gb|AAA96746.2| transketolase [Xanthobacter flavus]
          Length = 668

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/643 (59%), Positives = 480/643 (74%), Gaps = 1/643 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           + ++A+AIRFL++DA+E  NSGHPGLPMG AD+ T LFT+ + +DP  P+WP+RDRFVLS
Sbjct: 12  HDRLANAIRFLAIDAVEAANSGHPGLPMGAADIATVLFTKVLKYDPSRPFWPDRDRFVLS 71

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML Y++L+L GY+ VTI++IK FR +GS T GHPE     GIE TTGPLGQGIA 
Sbjct: 72  AGHGSMLLYSVLHLAGYEKVTIDEIKRFRQLGSLTPGHPENFVTEGIETTTGPLGQGIAT 131

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           AVGMA+AER L   FG  ++DHYTY L  DG LMEGISQEA   AGHL LSKLIV+WD+N
Sbjct: 132 AVGMAMAERLLAARFGSDVVDHYTYALASDGDLMEGISQEAADLAGHLKLSKLIVMWDDN 191

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            ISIDGP S++ ST+Q ARF ASGW T +V+GHD  AI + L  A+ SD+PT+IAC T I
Sbjct: 192 KISIDGPTSISGSTNQLARFAASGWATAAVDGHDPEAILAALEAAKASDRPTLIACRTTI 251

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSP +AG+ KVHGS LG EEI ATR AL W+   F +P+D +  WR AG      R  
Sbjct: 252 GFGSPKKAGSEKVHGSPLGAEEIVATRAALGWEAPAFVVPEDALNGWRAAGAAGRAAREA 311

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W+ R ++  +  R EFERR +  LP   + A + +K+K       +ATRKSSE+VL+ + 
Sbjct: 312 WEARFAARPAEERAEFERRVAGTLPAALEGAIVAVKEKAVKDGGAVATRKSSEMVLDFIT 371

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             +PE++GGSADLTGSN TK    K+++  DFSG ++HYGVREH MAAAMNG+ALHKGL 
Sbjct: 372 PAVPEMVGGSADLTGSNNTKAKGAKSVTPDDFSGSFIHYGVREHGMAAAMNGMALHKGLI 431

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           P+SG FMVFSDY RPAIRLA+LMG RVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP+L
Sbjct: 432 PFSGGFMVFSDYCRPAIRLAALMGERVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPNL 491

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN 558
           LV+RP D++ET ECWQ+AL+  +RPS L LSRQNLP LRT   + N  A GAY+ ++   
Sbjct: 492 LVMRPCDTVETAECWQIALQSTDRPSALILSRQNLPLLRTDATAVNRSAEGAYEILAASG 551

Query: 559 -AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
            AQ ++F++GSE+ +AVEA ++L ++ + TRVVS+  FELF E+  + RA++IG +P K+
Sbjct: 552 PAQASLFATGSEVSLAVEAAKLLEAQGVPTRVVSISSFELFLERPAAERAKVIGDAPAKV 611

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINA 660
           A+EA +R GWDA +GS+ +F+GM  FGAS     LY HFGI A
Sbjct: 612 AVEAAIRMGWDAIVGSNAAFVGMTSFGASAPAKELYAHFGITA 654


>gi|316932485|ref|YP_004107467.1| transketolase [Rhodopseudomonas palustris DX-1]
 gi|315600199|gb|ADU42734.1| transketolase [Rhodopseudomonas palustris DX-1]
          Length = 661

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/657 (55%), Positives = 482/657 (73%), Gaps = 3/657 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ +MA+AIR L+MDA+E   SGHPGLPMG ADV T L+ Q + FD   P+WP+RDRF+L
Sbjct: 5   DHSRMANAIRALAMDAVEKAKSGHPGLPMGAADVATVLWAQFLKFDAADPHWPDRDRFIL 64

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL G +++T++ IKNFR + S+T GHPE    + +E TTGPLGQG+A
Sbjct: 65  SAGHGSMLLYALLYLTGNEEMTLDQIKNFRQLDSRTPGHPENCITSSVETTTGPLGQGVA 124

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           ++VG A+AER L+ EFGD+ +DHYTYVL  DG LMEG+S EAI+ AGHL LSKLI L+D+
Sbjct: 125 SSVGTALAERLLQAEFGDI-VDHYTYVLCSDGDLMEGVSHEAIALAGHLRLSKLIFLYDD 183

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGISIDGP+SL D+ DQ ARF+A GWN+  ++GHDH AI   +RKAQ SD+PTMIAC+T 
Sbjct: 184 NGISIDGPLSLTDNVDQVARFQAHGWNSFRIDGHDHKAIADAIRKAQTSDRPTMIACKTT 243

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IGFG+P++AGT+K HG  LG EE+   +KAL W+  PF IPDD++  WR  G + +  RA
Sbjct: 244 IGFGAPHKAGTSKAHGEPLGAEELAGAKKALGWEYGPFEIPDDVLGAWRNVGKQGATARA 303

Query: 318 DWQERLSSMKSSIRKEFERRFSD-ALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           DW  RL ++ +  R +F RR  D   P    +A   LK +       IATRK+SEL LE 
Sbjct: 304 DWLARLEALPADKRDDFRRRVIDRKRPAAIADAIRALKDRLVTEPQTIATRKASELALEA 363

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +   +PEL+ GSADLT SN T+  Q K ++  DFSGRY+HYG+RE  MAAAMNG+A+H G
Sbjct: 364 LTPVVPELLLGSADLTPSNNTRVKQAKDVTPDDFSGRYIHYGIREMGMAAAMNGLAMHGG 423

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
            AP  GTFM F+DY+RP++R+++L  + V++++THDSIGLGEDGPTHQPVEHLA+LRA+P
Sbjct: 424 FAPAGGTFMCFADYARPSMRISALSHVPVVYIMTHDSIGLGEDGPTHQPVEHLASLRAMP 483

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           ++ V RPAD++ET ECWQ+AL+  + P+VL+LSRQNL  +RT     NLCA G Y+ I  
Sbjct: 484 NMRVFRPADAVETAECWQLALENTSGPTVLALSRQNLAQVRTATSEANLCATGGYELIRA 543

Query: 557 P-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
           P   QV+IF++GSE++IAV A ++L  + I+ RVVSVP  +L   Q ++ RA IIG +P+
Sbjct: 544 PGKPQVSIFATGSEVEIAVAAQKLLEVQGIAARVVSVPSLDLLLAQDEATRAGIIGDAPV 603

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           K+A+EA +R GWDA IG DG F+GM  FGAS     LY+HFGI A A+ D   +++S
Sbjct: 604 KVAVEAAVRFGWDAVIGPDGGFVGMSSFGASAPAKELYKHFGITAEAVADAARQRIS 660


>gi|90420019|ref|ZP_01227928.1| transketolase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336060|gb|EAS49808.1| transketolase [Aurantimonas manganoxydans SI85-9A1]
          Length = 669

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/651 (56%), Positives = 474/651 (72%), Gaps = 4/651 (0%)

Query: 16  DDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRF 75
           D + + MA+AIR L+MDA++   SGHPG+PMGMADV T LF + +  DP  P WP+RDRF
Sbjct: 16  DRNPRDMANAIRALAMDAVQRAKSGHPGMPMGMADVATVLFQKFINIDPSRPDWPDRDRF 75

Query: 76  VLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQG 135
           VLSAGHGSML YAL +L+GY D+ IE +KNFR +GS+TAGHPEYG   GIE TTGPLGQG
Sbjct: 76  VLSAGHGSMLLYALHHLVGYADMDIEQLKNFRQLGSRTAGHPEYGHALGIETTTGPLGQG 135

Query: 136 IANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLW 195
           ++ AVGMA+AER +   FG  L+DHYTY +VGDGCLMEGIS EAI  AG L LSKL+VLW
Sbjct: 136 LSTAVGMALAERMMHARFGGDLVDHYTYTIVGDGCLMEGISHEAIDLAGTLKLSKLVVLW 195

Query: 196 DNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACE 255
           D+NGISIDG + +A +TDQ ARF+A+GWNT +V+GHD  A+ + + +A+ SDKP  IAC+
Sbjct: 196 DDNGISIDGKVDIATATDQVARFKAAGWNTWAVDGHDADAVEAAIAEARKSDKPAFIACK 255

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG+G+PNR GT K HG ALG EEI   R+ L W  +PF +P+ ++K WR  G+R  + 
Sbjct: 256 TIIGYGAPNRGGTAKAHGEALGDEEIALAREQLVWKSEPFELPEAVVKGWREVGIRGREA 315

Query: 316 RADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLE 375
           R  W++RL+S  S+ R+ F+   +  LP        + ++      P +ATRK+SE+ LE
Sbjct: 316 RETWEKRLAS--SAERERFQSAVATTLPSGLAGELASFRQALSADAPKVATRKASEMALE 373

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
           V+N      IGGSADLTGSN T T  M++I+  DFSGRY+HYGVREH MAAAMNG+ALH 
Sbjct: 374 VINRVTDMTIGGSADLTGSNNTLTKGMQSITPDDFSGRYIHYGVREHGMAAAMNGLALHG 433

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
           G  PY GTF+VF+DY+R AIRL++LMG+RV++VLTHDSIGLGEDGPTHQP+EHLA LRA 
Sbjct: 434 GFVPYGGTFLVFADYARGAIRLSALMGLRVVYVLTHDSIGLGEDGPTHQPIEHLAMLRAT 493

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIS 555
           P+LLV RPAD+IET ECW++AL E++RPSVL+L+RQ LP +R      N  A G Y    
Sbjct: 494 PNLLVFRPADAIETAECWEIALTERHRPSVLALTRQGLPTVRAGDVGENRSARGGYVLKE 553

Query: 556 TPNAQ-VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSP 614
               + VTI ++GSE++IA+ A + L+       V+S+PC +LF EQ ++YR  ++G++P
Sbjct: 554 ADGPRDVTIMATGSEVEIALAAAKSLAESGKQAAVLSMPCLDLFEEQDEAYRKSVLGTAP 613

Query: 615 IKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
            +IAIEA  R GWD +IG +G FIGM GFGAS     LY+ FGI   A+VD
Sbjct: 614 -RIAIEAAARLGWDRWIGENGRFIGMTGFGASAPAPQLYEKFGITPQAVVD 663


>gi|114705297|ref|ZP_01438205.1| transketolase [Fulvimarina pelagi HTCC2506]
 gi|114540082|gb|EAU43202.1| transketolase [Fulvimarina pelagi HTCC2506]
          Length = 673

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/650 (57%), Positives = 468/650 (72%), Gaps = 5/650 (0%)

Query: 16  DDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRF 75
           D + + MA+AIR L+MDA++  NSGHPG+PMGMADV T LF + M  DP  P WPNRDRF
Sbjct: 20  DRNPRDMANAIRALAMDAVQKANSGHPGMPMGMADVATVLFQKFMRVDPSKPNWPNRDRF 79

Query: 76  VLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQG 135
           VLSAGHGSML YA+ +LLGY+D+ IE IKNFR +GS+TAGHPEYG  AGIE TTGPLGQG
Sbjct: 80  VLSAGHGSMLLYAIHHLLGYEDMPIEQIKNFRQLGSRTAGHPEYGHAAGIETTTGPLGQG 139

Query: 136 IANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLW 195
           +A +VGMAI ER +   FGD L+DHYTYV+ GDGCLMEGIS EAI  AG L L KLIVLW
Sbjct: 140 LATSVGMAIGERLMNARFGDDLVDHYTYVIAGDGCLMEGISHEAIDLAGTLKLKKLIVLW 199

Query: 196 DNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACE 255
           D+NGISIDG + +A  TDQ ARF A+GW T SV+GHD  A+   +  A+ SD+P  IAC+
Sbjct: 200 DDNGISIDGKVEIASKTDQVARFEAAGWKTFSVDGHDADAVEKAIEDARQSDRPAFIACK 259

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIG+G+PN+AGT+KVHG ALG +EI   R+ L W  +PF +P+ ++K WR    +   +
Sbjct: 260 TVIGYGAPNKAGTHKVHGEALGDDEIALARQKLVWKSEPFELPEAVVKGWREVAAKGRDS 319

Query: 316 RADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLE 375
           R  W+ +L+      R  +E   S  LP  F    +N +      KP +ATRK+SE+ LE
Sbjct: 320 RETWERKLADHPE--RDRYEVFSSGTLPAGFKGEMLNFRAALIQDKPKVATRKASEMTLE 377

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
           VVN  +   IGGSADLTGSN TKT  ++ ++  DFSGRY+HYGVREH M+AAMNG++L+ 
Sbjct: 378 VVNHVIETTIGGSADLTGSNNTKTKGLQPVTAEDFSGRYIHYGVREHGMSAAMNGLSLYG 437

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
           GL PY GTF+VFSDY+R A+RL++LMG RVI+VLTHDSIGLGEDGPTHQPVEHL  LRA 
Sbjct: 438 GLIPYGGTFLVFSDYARGAMRLSALMGTRVIYVLTHDSIGLGEDGPTHQPVEHLTMLRAT 497

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIS 555
           P+LLV RP D IET+E W+ AL E +RPSVL+L+RQ LP +R    S NL   G Y    
Sbjct: 498 PNLLVFRPCDVIETVEVWEAALLEHDRPSVLALTRQGLPTVREDI-SENLSLKGGYVLKE 556

Query: 556 TPNAQ-VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSP 614
               + VT+ +SGSE+++A++A E L    ++  VVS+PC ELF EQ D+YRA ++GS P
Sbjct: 557 AAGERDVTLIASGSEVEVALKAAEALKGEGLNAAVVSMPCMELFAEQDDTYRASVLGSVP 616

Query: 615 IKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
            ++AIEAG+R  WD ++G  G F+GM GFGASG    L++HFGI    +V
Sbjct: 617 -RVAIEAGVRMSWDRWLGDRGRFVGMTGFGASGPGPKLFEHFGITPDKVV 665


>gi|158422128|ref|YP_001523420.1| transketolase [Azorhizobium caulinodans ORS 571]
 gi|158329017|dbj|BAF86502.1| transketolase [Azorhizobium caulinodans ORS 571]
          Length = 694

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/659 (58%), Positives = 481/659 (72%), Gaps = 2/659 (0%)

Query: 8   RNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCP 67
           R  + M   + + ++A+AIRFL++DA+E  NSGHPGLPMG AD+ T LFT+ + FD   P
Sbjct: 26  RRPLFMSSRELHNRLANAIRFLAIDAVEAANSGHPGLPMGAADMATVLFTEKLKFDATAP 85

Query: 68  YWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEA 127
            WP+RDRF+LSAGHGSML Y LL+LLGY  V++++I+ FR +GS T GHPE     GIE 
Sbjct: 86  KWPDRDRFILSAGHGSMLLYGLLHLLGYDAVSMDEIRRFRQLGSLTPGHPENFVTPGIET 145

Query: 128 TTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLG 187
           TTGPLGQGI+ AVG A+AER +   FG  ++DH T V+  DG LMEGISQEAI  AGHL 
Sbjct: 146 TTGPLGQGISTAVGFAMAERLMAARFGSEIVDHRTVVIASDGDLMEGISQEAIDIAGHLK 205

Query: 188 LSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSD 247
           L+KL VLWD+N ISIDGP S++ STDQ ARF ASGWNTL+V+GHD  A+ + L  A  S+
Sbjct: 206 LAKLTVLWDDNRISIDGPTSISVSTDQQARFAASGWNTLAVDGHDPVALLAALNTAYASE 265

Query: 248 KPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRL 307
           KPT+IAC T IGFGSP +AG+ KVHGS LG  EI+ATRKAL W+  PF IP D +  WR 
Sbjct: 266 KPTLIACRTTIGFGSPAKAGSEKVHGSPLGAAEIEATRKALGWEAGPFEIPADALDAWRA 325

Query: 308 AGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALP-DCFDNAFINLKKKFEHSKPMIAT 366
           AG + ++ RA WQ R  ++  + R EF RR +  LP      A   +K K       +AT
Sbjct: 326 AGRKGAEARAAWQARFDALPEATRAEFNRRMAGELPVAALKEAIAAVKAKAVADGGAVAT 385

Query: 367 RKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAA 426
           RKSSE+VL+ +   +PE++GGSADLTGSN T+    K+++ +DFSG ++H+GVREH MAA
Sbjct: 386 RKSSEIVLDTLTKAVPEMLGGSADLTGSNNTRAKGQKSVTPTDFSGDFVHWGVREHGMAA 445

Query: 427 AMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPV 486
           AMNGIALH G  PYSGTF+ F+DYSRPAIRLA+LMG RVIHVLTHDSIGLGEDGPTHQPV
Sbjct: 446 AMNGIALHGGFIPYSGTFLAFADYSRPAIRLAALMGERVIHVLTHDSIGLGEDGPTHQPV 505

Query: 487 EHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLC 546
           EHLAALRAIP+ LVLRPAD++ET ECWQ+AL+ K+RPS L LSRQNLP LR   +  N  
Sbjct: 506 EHLAALRAIPNTLVLRPADTVETAECWQIALEAKDRPSCLILSRQNLPLLRKDADGENKS 565

Query: 547 ALGAYDYI-STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSY 605
           A GAY+ + ++  AQV++F++GSEL +AVEA  +L S  + TRVVSVP FELF  +  + 
Sbjct: 566 AGGAYELLAASGEAQVSLFATGSELSLAVEARALLESEGVPTRVVSVPSFELFLARPLAE 625

Query: 606 RAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           R  +IG +P K+ IEA +R GWD+ IGSD +F+GM  FGAS     LY+HFGI   A+V
Sbjct: 626 RRAVIGKAPAKVGIEAAIRMGWDSIIGSDAAFVGMTSFGASAPAKELYKHFGITPQAVV 684


>gi|90426237|ref|YP_534607.1| transketolase [Rhodopseudomonas palustris BisB18]
 gi|90108251|gb|ABD90288.1| transketolase [Rhodopseudomonas palustris BisB18]
          Length = 686

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/680 (55%), Positives = 485/680 (71%), Gaps = 11/680 (1%)

Query: 3   HPVG--GRNV-------VLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVT 53
            P+G  GRNV       V +    D  +MA+AIR L+MDA+E   SGHPGLPMG AD+ T
Sbjct: 4   QPIGTAGRNVHDPLTQAVALMTQVDSSRMANAIRALAMDAVEKAKSGHPGLPMGAADIAT 63

Query: 54  ALFTQCMVFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKT 113
            LF+Q + FD + P WP+RDRFVLSAGHGSML YAL YL G +DVT++ IKNFR + SKT
Sbjct: 64  VLFSQFLKFDAEDPRWPDRDRFVLSAGHGSMLLYALFYLTGNEDVTLDQIKNFRQLDSKT 123

Query: 114 AGHPEYGSCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLME 173
            GHPE    AG+E TTGPLGQG+A++VG A+AER L  EFGD ++DHYTYVL  DG LME
Sbjct: 124 PGHPENFITAGVETTTGPLGQGVASSVGTALAERLLAAEFGDDIVDHYTYVLCSDGDLME 183

Query: 174 GISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDH 233
           G+S EAI+ AGHL LSKLI L+D+NGISIDGP++L+DS DQ ARF+A GWN + ++GHD 
Sbjct: 184 GVSHEAIALAGHLKLSKLIFLYDDNGISIDGPLTLSDSVDQVARFKAHGWNAVQIDGHDQ 243

Query: 234 HAITSTLRKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLD 293
            AI + + +AQ SD+PTMIAC+T IGFG+P++AGT+K HG  LG EE+   +KAL W+  
Sbjct: 244 KAIAAAITQAQSSDRPTMIACKTTIGFGAPHKAGTSKAHGEPLGAEELAGAKKALGWNYG 303

Query: 294 PFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSD-ALPDCFDNAFIN 352
           PF IP+D++  WR  G   +   ADW++R  +M+ + R EF+RR  D   P+   +    
Sbjct: 304 PFEIPEDVLHAWRNVGREGASAHADWRQRFEAMEDTKRSEFQRRVVDRKRPEVLGDTIRA 363

Query: 353 LKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSG 412
           LK K       IATRK+SELVLE +   +PEL+ GSADLT SN T+    K +   DFSG
Sbjct: 364 LKDKLVAEPQTIATRKASELVLEAIEPIMPELLLGSADLTPSNNTRVKSAKDVKPGDFSG 423

Query: 413 RYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHD 472
           RY+HYG+RE  MAAAMNGI+ H G AP  GTFM F+DY+RP++R+A+L    V++++THD
Sbjct: 424 RYIHYGIREMGMAAAMNGISAHGGFAPAGGTFMCFTDYARPSMRIAALSHTPVVYIMTHD 483

Query: 473 SIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQN 532
           SIGLGEDGPTHQPVEHLA+LRA+P+L + RPAD +ET ECWQ+AL+    P+VL+LSRQN
Sbjct: 484 SIGLGEDGPTHQPVEHLASLRAMPNLRLFRPADPVETAECWQLALEYTTGPTVLALSRQN 543

Query: 533 LPFLRTQYESNNLCALGAYDYISTPN-AQVTIFSSGSELKIAVEACEILSSRNISTRVVS 591
           L  +RT    +NLCA GAY+ ++    A+V++F+SGSE++IAV A ++L+ R I TRVVS
Sbjct: 544 LQPVRTTSHPDNLCAQGAYELVAADGAAEVSLFASGSEVEIAVAAQKLLAERGIPTRVVS 603

Query: 592 VPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDL 651
           VP  +L   Q D  R  IIG + +K+A+EA +R GWDA IG DG F+GM  FGAS     
Sbjct: 604 VPSLDLLLLQKDEVRHGIIGEARVKVAVEAAVRFGWDAVIGPDGGFVGMSSFGASAPAKD 663

Query: 652 LYQHFGINAIAIVDMVERKL 671
           LY+HFGI A A+V     +L
Sbjct: 664 LYKHFGITAEAVVKAATERL 683


>gi|217977377|ref|YP_002361524.1| transketolase [Methylocella silvestris BL2]
 gi|217502753|gb|ACK50162.1| transketolase [Methylocella silvestris BL2]
          Length = 667

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/654 (57%), Positives = 476/654 (72%), Gaps = 4/654 (0%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIR LS+DA+E  NSGHPG+PMGMADV T LFT+ M FDP  P WP+RDRFVLSAG
Sbjct: 15  EMANAIRVLSIDAVEKANSGHPGMPMGMADVATVLFTRFMKFDPADPAWPDRDRFVLSAG 74

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y+LLYLLGY  VT  +I+ FR + SKT GHPEYG  AG+E TTGPLGQG+A AV
Sbjct: 75  HGSMLLYSLLYLLGYPGVTRAEIERFRQLDSKTPGHPEYGHTAGVETTTGPLGQGLAAAV 134

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMAIAE+ L   FG   ++H TYV+ GDGCLMEG+SQEAI+ AGHL LSKLIVLWD+NGI
Sbjct: 135 GMAIAEKLLAARFGSGAVNHRTYVIAGDGCLMEGVSQEAITLAGHLKLSKLIVLWDDNGI 194

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG +SLADST+Q ARF A+GW   SV+GHD  A+   L  AQ SD+PT+IAC T IG+
Sbjct: 195 TIDGKVSLADSTNQLARFEAAGWAAASVDGHDPEAVAKALEAAQSSDRPTLIACRTTIGY 254

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+P +AGT+ VHG+ALG++E+  TR A  W   PF IPD I   WR   +++S  RA W+
Sbjct: 255 GAPTKAGTHAVHGAALGKDEVAGTRAAYGWPHAPFEIPDPIASAWRETAVKASAPRAAWE 314

Query: 321 ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
            RL++++  ++  F+   S  +     +A    KK    +    ATR SS+ +L+ +   
Sbjct: 315 ARLAALEPVLQARFKADISGDIEPAVADAVEAFKKAASDANAPQATRISSQKLLDKLAPA 374

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
            P LIGGSADLTGSN TK + MK +S  DFSGRYLHYG+RE  MAAAMNGIALH G  PY
Sbjct: 375 QPNLIGGSADLTGSNNTKAADMKPVSPVDFSGRYLHYGIREFGMAAAMNGIALHGGFIPY 434

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
            GTF+VF+DYSRPAIRLA+LMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA+LRAIP+LLV
Sbjct: 435 GGTFLVFADYSRPAIRLAALMGIRVIHVLTHDSIGLGEDGPTHQPVEHLASLRAIPNLLV 494

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQ 560
            RPAD++ET E WQ+AL+ +  PSV++L+RQNLP +R  + + NL A GAY  +  P  +
Sbjct: 495 FRPADAVETAEAWQLALERRTSPSVIALTRQNLPIVRRDHTTENLSAAGAY-VLRAPEGE 553

Query: 561 --VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIA 618
             VT+F++GSE+ +AVEA + L +  +   VVS+PCFELF E   +YRA +IG++P ++ 
Sbjct: 554 RDVTLFATGSEVSLAVEAADRLRAEGVRAAVVSIPCFELFAEAPAAYRASVIGTAP-RVG 612

Query: 619 IEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           +EA LRQGWD  +  D  F+GM  FGAS     LY+ FGI   A+V     +L+
Sbjct: 613 VEAALRQGWDIVLDRDDGFVGMSSFGASAPAGELYKKFGITVDAVVAEARARLA 666


>gi|85714403|ref|ZP_01045391.1| transketolase [Nitrobacter sp. Nb-311A]
 gi|85698850|gb|EAQ36719.1| transketolase [Nitrobacter sp. Nb-311A]
          Length = 661

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/656 (56%), Positives = 477/656 (72%), Gaps = 2/656 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D  +MA+AIR L+MD +E   SGHPGLPMG AD+ T LFT+ + +D   P+WP+RDRF+L
Sbjct: 5   DSSRMANAIRALAMDGVEKAKSGHPGLPMGTADIATVLFTKFLKYDAADPHWPDRDRFIL 64

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL GY+++T++ +KNFR + SKT GHPE     G+E TTGPLGQG+A
Sbjct: 65  SAGHGSMLLYALLYLTGYKEMTLDQLKNFRQLNSKTPGHPENFITEGVETTTGPLGQGVA 124

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
            +VG A+AER L  EFG  ++DHYTYVL  DG LMEGIS EAI+ AGHL L+KLI L+D+
Sbjct: 125 TSVGFALAERLLAAEFGSDVVDHYTYVLCSDGDLMEGISHEAIALAGHLKLNKLIFLYDD 184

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGI+IDGPISLAD  DQ ARF+A GW+   ++GHD  AI + +R+AQ SDKP++IAC+T+
Sbjct: 185 NGITIDGPISLADGVDQVARFKACGWDARRIDGHDQKAIAAAIRRAQKSDKPSLIACKTI 244

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IGFG+P RAGT+K HG ALG EE+   +KAL WD  PF IPDD++K WR AG +  +   
Sbjct: 245 IGFGAPTRAGTSKAHGEALGAEELAGAKKALGWDYGPFEIPDDVLKAWRSAGRKGKRHNK 304

Query: 318 DWQERLSSMKSSIRKEFERRFSD-ALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           +W+ R  +   + R EF+RR  D   P   D     LK K     P +ATRK+SEL LEV
Sbjct: 305 EWRARFEAKPEAERGEFKRRAIDRKPPQNLDEVIRKLKDKLVAEPPTVATRKASELALEV 364

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +   +PEL+ GSADLT SN T+T  +K +    + GRY+HYG+RE  MAAAMNGIALH G
Sbjct: 365 LVPAVPELLLGSADLTPSNNTRTKGLKEVEPGHYDGRYIHYGIRELGMAAAMNGIALHGG 424

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
            AP  GTFM F+DY+RPA+R+++L  I  I+++THDSIGLGEDGPTHQPVEHLA+LRA+P
Sbjct: 425 YAPAGGTFMCFTDYARPAMRVSALAHIPTIYIMTHDSIGLGEDGPTHQPVEHLASLRAMP 484

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           ++ V RPAD++ET ECWQ+AL+    P+VL+LSRQNL  +R    ++N CA GAY+ ++ 
Sbjct: 485 NMRVFRPADAVETAECWQLALERPKGPTVLALSRQNLTPVRKTAHADNRCAHGAYELVAA 544

Query: 557 P-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
              A+V+IF++GSE++IAV A + LS R I++RVVSVP  EL  EQ +  R  IIG +P 
Sbjct: 545 NGEAKVSIFATGSEVEIAVAAQQQLSQRGIASRVVSVPSLELLLEQPEDRRQAIIGKAPF 604

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           KIA+EA +R GWDA IG+DG F+GM  FG S     LY+HFGI A A+V  VE +L
Sbjct: 605 KIAVEAAVRFGWDAVIGADGLFVGMHSFGHSAPAKDLYKHFGITAEAVVKAVETRL 660


>gi|316936116|ref|YP_004111098.1| transketolase [Rhodopseudomonas palustris DX-1]
 gi|315603830|gb|ADU46365.1| transketolase [Rhodopseudomonas palustris DX-1]
          Length = 671

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/655 (56%), Positives = 465/655 (70%), Gaps = 2/655 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           ++ MA+AIRFL++D +E   SGHPG+PMGMADV T LFT+ + FDP  P W +RDRFVLS
Sbjct: 14  HRDMANAIRFLAIDGVEKAKSGHPGMPMGMADVATVLFTRFLKFDPADPAWADRDRFVLS 73

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML YALL+L GY DVTI+ +K FR  GSKT GHPEYG   G+E TTGPLGQG+A 
Sbjct: 74  AGHGSMLLYALLHLTGYPDVTIDQLKAFRQWGSKTPGHPEYGHTQGVETTTGPLGQGLAT 133

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           +VGMA+AER +   +GD L+DHYTYV+ GDGCLMEG+S EAIS AGHL LSKLIVLWD+N
Sbjct: 134 SVGMALAERMMNARYGDALVDHYTYVIAGDGCLMEGVSHEAISLAGHLKLSKLIVLWDDN 193

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            ISIDG  SL+ S DQ ARF ASGW T  V+GHD  A+ + + +A+ SD+P++IAC T I
Sbjct: 194 HISIDGDTSLSCSDDQLARFAASGWATTRVDGHDPEAVAAAIEQAKNSDRPSLIACRTTI 253

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSP  AGT K HG+ LG EE++ TR ALNW   PF IPD I+ +WR AG R       
Sbjct: 254 GFGSPKVAGTEKAHGAPLGAEEVEKTRAALNWPYPPFEIPDAILARWREAGGRGKAAHEA 313

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W +RL++  ++ R  F    +  L   ++ A   L  KF+  KP IATR++S+L ++ + 
Sbjct: 314 WNQRLAAADAATRTGFTDALAGKLSADYEGALQGLIAKFDAEKPTIATRQASQLTIDAIV 373

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
              P ++GGSADLT SN T      ++    F G YLHYG+RE  MAAAMNGIALH G  
Sbjct: 374 PASPNILGGSADLTHSNLTHAKGTASVKPGAFGGSYLHYGIREFGMAAAMNGIALHGGFV 433

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           P+ GTF+VF+DYSRPAIRLA+LMG+RVIHV+THDSIGLGEDGPTHQPVEH+A+LRAIP++
Sbjct: 434 PFGGTFLVFADYSRPAIRLAALMGVRVIHVMTHDSIGLGEDGPTHQPVEHVASLRAIPNV 493

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYDYISTP 557
           LV RPAD+IET + W  ALK+ +RPSVL+LSRQ LP L R    S N  A GAY  +   
Sbjct: 494 LVFRPADAIETAQAWDCALKQTSRPSVLALSRQGLPALPRPNGASGNPVARGAYVVVDPG 553

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
              VT+ ++GSE+ +A+EA + L    +   VVS PCFELF EQ D+YRA ++G++P ++
Sbjct: 554 QRDVTLIATGSEVSLALEAAKKLGEAGVKAAVVSAPCFELFAEQDDAYRAGVLGTAP-RV 612

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
            IEA     W  +IG  G+F+GM GFGAS    +LYQ FGI A A+VD  +  ++
Sbjct: 613 GIEAARDTDWRRWIGDTGAFVGMTGFGASAPAPVLYQKFGITADAVVDAAKGAIA 667


>gi|75676918|ref|YP_319339.1| transketolase [Nitrobacter winogradskyi Nb-255]
 gi|74421788|gb|ABA05987.1| transketolase [Nitrobacter winogradskyi Nb-255]
          Length = 661

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/657 (55%), Positives = 483/657 (73%), Gaps = 4/657 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D  +MA+AIR L+MD +E   SGHPGLPMG AD+ T LFT+ + +D   P+WP+RDRF+L
Sbjct: 5   DSSRMANAIRALAMDGVEKAKSGHPGLPMGTADIATVLFTKFLKYDAADPHWPDRDRFIL 64

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL GY+ +T++ +KNFR + SKT GHPE     G E TTGPLGQG+A
Sbjct: 65  SAGHGSMLLYALLYLTGYKQMTLDQLKNFRQLDSKTPGHPENFITEGAETTTGPLGQGVA 124

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
            +VG A+AER L  EFG  ++DHYTYVL  DG LMEGIS EAI+ AGHL L+KLI L+D+
Sbjct: 125 TSVGFALAERLLAAEFGGEVVDHYTYVLCSDGDLMEGISHEAIALAGHLKLNKLIFLYDD 184

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGI+IDGPISLAD  DQ ARF+A GW+   ++GHD  AI + +R+AQ SD+P++IAC+T+
Sbjct: 185 NGITIDGPISLADDVDQVARFKACGWDARRIDGHDQKAIAAAIRRAQKSDRPSLIACKTI 244

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IG+G+P RAGT+K HG ALG EE+  T+KAL+W+  PF +PDD++  WR AG +  +   
Sbjct: 245 IGYGAPTRAGTSKAHGEALGAEELAGTKKALDWEYGPFEVPDDVLNAWRSAGRKGKRHNK 304

Query: 318 DWQERLSSMKSSIRKEFERRFSDALP-DCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           +W+ RL++   + R EF+RR  +  P    + A   LK K     P +ATRK+SE+ LE 
Sbjct: 305 EWRARLAAQPDAQRDEFKRRVIERKPSQNLNEAIRKLKDKLVAEPPTVATRKASEMALEA 364

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +   +PEL+ GSADLT SN T+T  +K +    + GRY+HYG+RE  MAAAMNGIALH G
Sbjct: 365 LVPAVPELLLGSADLTPSNNTRTKGLKEVEPGQYGGRYIHYGIRELGMAAAMNGIALHGG 424

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
            AP  GTFM F+DY+RPA+R+++L  I  I+++THDSIGLGEDGPTHQPVEHLA+LRA+P
Sbjct: 425 YAPAGGTFMCFADYARPAMRVSALAYIPTIYIMTHDSIGLGEDGPTHQPVEHLASLRAMP 484

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           ++ V RPAD++ET ECWQ+AL+    P+VL+LSRQNL  +R   +++N CA GAY+ ++ 
Sbjct: 485 NMRVFRPADAVETAECWQLALERPKGPTVLALSRQNLAPVRKTADTDNRCAHGAYELVA- 543

Query: 557 PN--AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSP 614
           PN  A+V+IF+SGSE++IAV A + LS R I++RVVSVP  EL  EQ +  R  IIG +P
Sbjct: 544 PNGEAKVSIFASGSEVEIAVAAQQQLSQRGIASRVVSVPSLELLLEQPEDRRQAIIGKAP 603

Query: 615 IKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +KIA+EA +R GWDA IG+DG F+GM  FG S     LY+HFGI A A+V  VE++L
Sbjct: 604 VKIAVEAAVRFGWDAVIGADGLFVGMNSFGHSAPAKDLYKHFGITAEAVVSAVEKRL 660


>gi|312112805|ref|YP_004010401.1| transketolase [Rhodomicrobium vannielii ATCC 17100]
 gi|311217934|gb|ADP69302.1| transketolase [Rhodomicrobium vannielii ATCC 17100]
          Length = 664

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/652 (57%), Positives = 474/652 (72%), Gaps = 3/652 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + +A+AIR LSMDA+E  NSGHPG+PMGMADV   LFT+ + FD   P WP+RDRFVLSA
Sbjct: 11  RDLANAIRALSMDAVEAANSGHPGMPMGMADVAAVLFTKFLKFDASAPKWPDRDRFVLSA 70

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LLYL G  DVTIE++K FR + SKT GHPEYG   G+E TTGPLGQGI+ A
Sbjct: 71  GHGSMLLYSLLYLTGSPDVTIEEVKKFRQLHSKTPGHPEYGHTQGVETTTGPLGQGISTA 130

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAER L   FGD ++DH+TY +VGDGCLMEGIS EAI  AGHL L+KLIVLWD+N 
Sbjct: 131 VGMAIAERLLGARFGDKVVDHHTYAIVGDGCLMEGISHEAIDLAGHLKLNKLIVLWDDNS 190

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ISIDG  SL+ STDQ  RF A+GWN + V+GH+   + + + KA+ SDKPT+IAC+T+IG
Sbjct: 191 ISIDGSTSLSTSTDQVKRFEAAGWNAVRVDGHNAAEVEAAIAKAKTSDKPTLIACKTIIG 250

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
           FG+PN+ G+ K HG+ LG++EI A R+ L W   PF +P+ I+  WR AG R     A W
Sbjct: 251 FGAPNKQGSEKTHGAPLGKDEIAAAREFLGWPYAPFEVPEPILSTWRAAGTRGKAEHAAW 310

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
            ERLS + +  R  FER     LP     A      K    KP +ATRKSSE+ L+V+ND
Sbjct: 311 HERLSQLTADERAHFERMIEGELPASVKEALDAFIAKNVAEKPKLATRKSSEMALQVIND 370

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
                IGGSADLT SN T T  MK+I+  DF+GRYLHYG+REH M AAMNGIALH G  P
Sbjct: 371 ATDMTIGGSADLTHSNYTITRGMKSITPDDFTGRYLHYGIREHIMGAAMNGIALHGGFVP 430

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTF+VFSDY R +IRL++LMG+RV++VLTHDSIG+GEDGPTHQP+EHLA+LRA+P++ 
Sbjct: 431 YGGTFLVFSDYLRGSIRLSALMGLRVLYVLTHDSIGVGEDGPTHQPIEHLASLRALPNVN 490

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA 559
           V RPAD +ET E +++AL  K+ PSVL+LSRQNLP +RT+  S NL A GAY       A
Sbjct: 491 VFRPADIVETAEAYEIALASKHTPSVLALSRQNLPTVRTEASSENLTAKGAYVLRGDAKA 550

Query: 560 --QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
              VT+ ++GSE+++AV A E L++  + T VVS+PCFELF  Q ++YRA+++G++P +I
Sbjct: 551 PRDVTLIATGSEIELAVSAAEQLNAEGVKTVVVSMPCFELFEAQPEAYRAEVLGTAP-RI 609

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
           AIEA  R GWD +IG  G+F+GM GFGASG    +Y+ FGI   A++   ++
Sbjct: 610 AIEAAGRFGWDRWIGDKGAFVGMNGFGASGPAPQVYKEFGITVEAVIAAAKK 661


>gi|86751564|ref|YP_488060.1| transketolase [Rhodopseudomonas palustris HaA2]
 gi|86574592|gb|ABD09149.1| transketolase [Rhodopseudomonas palustris HaA2]
          Length = 662

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/644 (56%), Positives = 471/644 (73%), Gaps = 3/644 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ +MA+AIR L+MDA+E   SGHPGLPMG ADV T LFT+ + FD    +WP+RDRF+L
Sbjct: 5   DHSRMANAIRALAMDAVEKAKSGHPGLPMGAADVATVLFTEFLKFDAADAHWPDRDRFIL 64

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL G  ++T++ IK FR + SKT GHPE      +E TTGPLGQG+A
Sbjct: 65  SAGHGSMLLYALLYLTGNSELTLDQIKAFRQLDSKTPGHPENCITDSVETTTGPLGQGVA 124

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           ++VG A+AER L  EFG++ +DH TYVL  DG LMEG+S EAI+ AGHL LSKLI L+D+
Sbjct: 125 SSVGTALAERLLAAEFGEI-VDHTTYVLCSDGDLMEGVSHEAIALAGHLRLSKLIFLYDD 183

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGISIDGP++L D+ DQ ARF+A GWN + ++GHDH AI   ++ A+ SD+PTMIAC+T 
Sbjct: 184 NGISIDGPLTLTDNVDQVARFQAHGWNAMRIDGHDHKAIAEAIKAAKASDRPTMIACKTT 243

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IGFG+P RAGT+K HG  LG EE+   +KAL WD  PF IPDD++  WR  G + ++  A
Sbjct: 244 IGFGAPTRAGTSKAHGEPLGAEELAGAKKALGWDYGPFEIPDDVLSAWRAVGAKGAKAHA 303

Query: 318 DWQERLSSMKSSIRKEFERRFSD-ALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           +WQ +  +M   +R EF+RR  D   P   D A   LK +       IATRK+SEL LE 
Sbjct: 304 EWQSKFDAMDKELRAEFQRRVIDRKRPAALDGAIRKLKDRLVAEPQTIATRKASELALEA 363

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           + + +PE++ GSADLT SN T+T   K ++  DFSGRY+HYG+RE  MAAAMNGIA+H G
Sbjct: 364 IVEVVPEMLLGSADLTPSNNTRTKHAKDVTPDDFSGRYIHYGIREMGMAAAMNGIAMHGG 423

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
            AP  GTFM F+DY+RP++R+A+L  + V++++THDSIGLGEDGPTHQPVEHLA+LRA+P
Sbjct: 424 FAPAGGTFMCFADYARPSMRIAALSHVPVVYIMTHDSIGLGEDGPTHQPVEHLASLRAMP 483

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           ++ V RPAD +ET ECWQ+AL+    P+VL+LSRQNL  +RT    +N CA GAY+ I+ 
Sbjct: 484 NMRVFRPADPVETAECWQLALENTKGPTVLALSRQNLTPVRTSKSDDNRCARGAYELIAA 543

Query: 557 P-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
              AQVTIF++GSE++IAV A ++L+++ I+ RVVSVP  +L  +Q D+ R  IIG +P+
Sbjct: 544 DGKAQVTIFATGSEVEIAVAAHKLLAAKGIAARVVSVPSLDLLLQQDDATRKAIIGDAPV 603

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           K+A+EA +R GWDA IG +G FIGM  FGAS     LY+HFGI 
Sbjct: 604 KVAVEAAVRFGWDAVIGPEGGFIGMSSFGASAPAKDLYKHFGIT 647


>gi|148252054|ref|YP_001236639.1| transketolase [Bradyrhizobium sp. BTAi1]
 gi|146404227|gb|ABQ32733.1| transketolase [Bradyrhizobium sp. BTAi1]
          Length = 671

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/645 (55%), Positives = 472/645 (73%), Gaps = 6/645 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D  +MA+AIR L+MDA+E   SGHPG+PMGMADV T LF   +  DP  P WP+RDRFVL
Sbjct: 12  DEAQMANAIRALAMDAVEAAKSGHPGMPMGMADVATVLFKHFVKIDPTQPNWPDRDRFVL 71

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YAL +LLG+ D+ ++ ++ FR +GS+TAGHPE+G  AGIE TTGPLGQGIA
Sbjct: 72  SAGHGSMLLYALHHLLGFHDMPMDQLRRFRQLGSRTAGHPEFGHAAGIETTTGPLGQGIA 131

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
            AVGMA++ER L   FGD L+DH+TYV+ GDGCLMEGIS EAI  AGHLGL +LIVLWD+
Sbjct: 132 TAVGMALSERMLNARFGDDLVDHHTYVIAGDGCLMEGISHEAIDLAGHLGLGRLIVLWDD 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           N I+IDGP SL+ S DQ ARF A+GW+  +V+GHD  A+ + + +A+   +P++IAC T+
Sbjct: 192 NQITIDGPTSLSTSLDQKARFVAAGWHVAAVDGHDGEAVANAIIEARADPRPSLIACRTI 251

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IGFG+PN+ GT+  HG+ LG+EE+ A R++L W   PF +P+ I+  WR+ G R ++ RA
Sbjct: 252 IGFGAPNKQGTSATHGAPLGKEEVAAARESLGWIYSPFEVPEAIVHAWRVVGARGTRIRA 311

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
           +WQERL+  +S  R+EF    +         A  + +++    +P +ATRK+SEL LEVV
Sbjct: 312 EWQERLA--RSPQREEFVAHLAPPDAARLHAALADHRRRLCGERPKVATRKASELALEVV 369

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N  +P ++GGSADLTGSN T+T  M+ +++SDF+G Y+HYGVREH MAAAMNGI+LH GL
Sbjct: 370 NSTIPNMVGGSADLTGSNNTRTKGMRPVTRSDFTGNYIHYGVREHGMAAAMNGISLHGGL 429

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTF+ FSDY R AIRL++LMG  VI+V+THDSIGLGEDGPTHQPVEHLA+LRA+P+
Sbjct: 430 RPYGGTFLAFSDYCRGAIRLSALMGRPVIYVMTHDSIGLGEDGPTHQPVEHLASLRAMPN 489

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           + V RPAD++ET E W+VAL     PSVL LSRQ+LP LRT++   N+ A GAY  +  P
Sbjct: 490 VYVFRPADAVETAEAWEVALAAAKTPSVLCLSRQDLPTLRTEHGDENMTARGAY-LLRDP 548

Query: 558 NAQ--VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
                +TI ++GSE+ IAVEA + LS+  ++  VVS PC+ELF  Q   YRA ++G  P 
Sbjct: 549 GEHRDLTIIATGSEVAIAVEAADELSADGLAVAVVSAPCWELFAAQEAGYRAAVLGEGP- 607

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINA 660
           ++ +EAG+  GW  ++G +  FIGM GFGASG    LY HFGI A
Sbjct: 608 RVGVEAGVALGWAEWLGPNSIFIGMTGFGASGPAADLYNHFGITA 652


>gi|192293483|ref|YP_001994088.1| transketolase [Rhodopseudomonas palustris TIE-1]
 gi|192287232|gb|ACF03613.1| transketolase [Rhodopseudomonas palustris TIE-1]
          Length = 671

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/655 (55%), Positives = 466/655 (71%), Gaps = 2/655 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           ++ MA+AIRFL++D +E   SGHPG+PMGMADV T LFT+ + FDP  P W +RDRFVLS
Sbjct: 14  HRDMANAIRFLAIDGVEKAKSGHPGMPMGMADVATVLFTRFLKFDPADPAWADRDRFVLS 73

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML YALL+L GY +VTI+ +K+FR  GSKT GHPEYG   G+E TTGPLGQG+A 
Sbjct: 74  AGHGSMLLYALLHLTGYPEVTIDQLKSFRQWGSKTPGHPEYGHTQGVETTTGPLGQGLAT 133

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           +VGMA+AER +   +GD L+DH+TYV+ GDGCLMEG+S EAIS AGHL L+KLIVLWD+N
Sbjct: 134 SVGMALAERMMNARYGDALVDHHTYVIAGDGCLMEGVSHEAISLAGHLKLNKLIVLWDDN 193

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            ISIDG  SL+ S DQ ARF ASGW T  V+GHD  A+ + + +A+ SD+P++IAC T I
Sbjct: 194 HISIDGDTSLSCSDDQLARFAASGWATTRVDGHDPEAVAAAIEQAKNSDRPSLIACRTTI 253

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSP  AGT K HG+ LG +E++ TR ALNW   PF IPD I+ +WR AG R       
Sbjct: 254 GFGSPKVAGTEKAHGAPLGADEVEKTRAALNWPYPPFEIPDPILARWREAGGRGKAAHQA 313

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W +RL++  ++ R  F    +  L   ++ A   L  KF+  KP IATR++S+L ++ + 
Sbjct: 314 WTQRLAAADAATRTGFTDALAGKLSADYEGALQGLIAKFDADKPTIATRQASQLTIDAIV 373

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
              P ++GGSADLT SN T      ++    F G YLHYG+RE  MAAAMNGIALH G  
Sbjct: 374 PASPNILGGSADLTHSNLTHAKGTASVKPGAFGGSYLHYGIREFGMAAAMNGIALHGGFV 433

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           P+ GTF+VF+DYSRPAIRLA+LMG+RVIHV+THDSIGLGEDGPTHQPVEH+A+LRAIP++
Sbjct: 434 PFGGTFLVFADYSRPAIRLAALMGVRVIHVMTHDSIGLGEDGPTHQPVEHVASLRAIPNV 493

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYDYISTP 557
           LV RPAD+IET + W  ALK+ +RPSVL+LSRQ LP L R    + N  A GAY  +   
Sbjct: 494 LVFRPADAIETAQAWDCALKQTSRPSVLALSRQGLPALPRPNGATGNPVARGAYVVVDPG 553

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
              VT+ ++GSE+ +A++A   L +  I   VVS PCFELF +Q D+YRA ++G++P +I
Sbjct: 554 QRDVTLIATGSEVSLALDAASKLEAEGIKAAVVSAPCFELFADQDDAYRASVLGTAP-RI 612

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
            IEA     W  +IG  G+F+GM GFGAS    +LYQ FGI A A+VD  +  ++
Sbjct: 613 GIEAARDTDWRRWIGDTGAFVGMTGFGASAPAPILYQKFGITADAVVDAAKGAIA 667


>gi|148258131|ref|YP_001242716.1| transketolase [Bradyrhizobium sp. BTAi1]
 gi|146410304|gb|ABQ38810.1| transketolase [Bradyrhizobium sp. BTAi1]
          Length = 661

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/656 (56%), Positives = 474/656 (72%), Gaps = 2/656 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ +MA+AIR L+MDA+E   SGHPGLPMG ADV T LFT+ + +D   P WP+RDRFVL
Sbjct: 5   DHSRMANAIRALAMDAVEKAKSGHPGLPMGAADVATVLFTRVLKYDAAAPAWPDRDRFVL 64

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL G +++T++ IK FR + S T GHPE     GIE TTGPLGQGI+
Sbjct: 65  SAGHGSMLLYALLYLTGNEEMTLDQIKRFRQVDSLTPGHPENFRTKGIETTTGPLGQGIS 124

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
            AVGMA+AE+ L+ E+G  ++DH+TYVL  DG LMEGISQEAI+ AGH  L+KLIVLWD+
Sbjct: 125 TAVGMALAEKMLQAEYGKKIVDHHTYVLASDGDLMEGISQEAIAMAGHWKLNKLIVLWDD 184

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGISIDGP+S+ADS DQ  RF+++GW    ++GHD  AI + + +AQ S +P++IAC+T 
Sbjct: 185 NGISIDGPLSIADSVDQVKRFKSAGWAAELIDGHDPEAIAAAIARAQKSSRPSLIACKTT 244

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IG+G+P +AGT+KVHG ALG EE+K  ++ L   L+PF +PDD++  WR AG R +  RA
Sbjct: 245 IGYGAPTKAGTSKVHGEALGPEELKGAKEKLGISLEPFSVPDDVLAAWREAGRRGAPARA 304

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
           +W+ RL+ M    R EFERR     P     A  + KK    +   IATRKSSE  +EV+
Sbjct: 305 EWETRLAEMGPRKRAEFERRLRHERPAALAKALKDHKKALLETPLNIATRKSSEAAIEVI 364

Query: 378 NDCLP-ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
              +P E + GSADLTGSN  K     + S     GR++HYG+REH MAAAMNGI LH G
Sbjct: 365 AAAMPFEFVAGSADLTGSNNNKAKSATSFSAKTPKGRFIHYGIREHGMAAAMNGIFLHGG 424

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
            AP   TF+VFSDY+R A+RL++LMG  V++VLTHDSIGLGEDGPTHQPVEHLAALRAIP
Sbjct: 425 FAPNGATFLVFSDYARGAMRLSALMGAGVVYVLTHDSIGLGEDGPTHQPVEHLAALRAIP 484

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           ++ V RPAD++ET ECW++AL   N P+VL+L+RQNLP LRT   S+N C+ G Y+ ++ 
Sbjct: 485 NMRVFRPADAVETAECWELALNRTNGPTVLALTRQNLPQLRTSAPSDNPCSHGGYELVAA 544

Query: 557 P-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
              A+V++F++GSE++IAV A + L+ R I  RVVSVP  EL  EQ +  +A IIG +P+
Sbjct: 545 QGEAKVSLFATGSEVEIAVAAQKQLAERGIPARVVSVPSLELLLEQPEDAKAAIIGKAPV 604

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           KIAIEA +R GWDA IGSDG FIGM  FG SG    LY+HFGI A A VD   ++L
Sbjct: 605 KIAIEAAVRWGWDAVIGSDGIFIGMHSFGESGPYKELYKHFGITAEAAVDAAVKRL 660


>gi|39937701|ref|NP_949977.1| transketolase [Rhodopseudomonas palustris CGA009]
 gi|39651560|emb|CAE30083.1| transketolase [Rhodopseudomonas palustris CGA009]
          Length = 655

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/652 (55%), Positives = 463/652 (71%), Gaps = 2/652 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIRFL++D +E   SGHPG+PMGMADV T LFT+ + FDP  P W +RDRFVLSAGH
Sbjct: 1   MANAIRFLAIDGVEKAKSGHPGMPMGMADVATVLFTRFLKFDPADPAWADRDRFVLSAGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L GY DVTI+ +K+FR  GSKT GHPEYG   G+E TTGPLGQG+A +VG
Sbjct: 61  GSMLLYALLHLTGYPDVTIDQLKSFRQWGSKTPGHPEYGHTQGVETTTGPLGQGLATSVG 120

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER +   +GD L+DH+TYV+ GDGCLMEG+S EAIS AGHL L+KLIVLWD+N IS
Sbjct: 121 MALAERMMNARYGDALVDHHTYVIAGDGCLMEGVSHEAISLAGHLKLNKLIVLWDDNHIS 180

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG  SL+ S DQ ARF ASGW T  V+GHD  A+ + + +A+ SD+P++IAC T IGFG
Sbjct: 181 IDGDTSLSCSDDQLARFAASGWATTRVDGHDPEAVAAAIEQAKKSDRPSLIACRTTIGFG 240

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           SP  AGT K HG+ LG +E++ TR ALNW   PF IPD I+ +WR AG R       W +
Sbjct: 241 SPKVAGTEKAHGAPLGADEVEKTRAALNWPHPPFEIPDPILARWREAGGRGKAAHEAWTQ 300

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           RL++  ++ R  F    +  L   ++ A   L  KF+  KP IATR++S+L ++ +    
Sbjct: 301 RLAAADAATRTGFTDALAGKLSADYEGALQGLIAKFDADKPTIATRQASQLTIDAIVPAS 360

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           P ++GGSADLT SN T      ++    F G YLHYG+RE  MAAAMNGIALH G  P+ 
Sbjct: 361 PNILGGSADLTHSNLTHAKGTASVKPGAFGGSYLHYGIREFGMAAAMNGIALHGGFVPFG 420

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           GTF+VF+DYSRPAIRLA+LMG+RVIHV+THDSIGLGEDGPTHQPVEH+ +LRAIP++LV 
Sbjct: 421 GTFLVFADYSRPAIRLAALMGVRVIHVMTHDSIGLGEDGPTHQPVEHVPSLRAIPNVLVF 480

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYDYISTPNAQ 560
           RPAD+IET + W  ALK+ +RPSVL+LSRQ LP L R    + N  A GAY  +      
Sbjct: 481 RPADAIETAQAWDCALKQTSRPSVLALSRQGLPALPRPNGATGNPVARGAYVVVDPGQRD 540

Query: 561 VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIE 620
           VT+ ++GSE+ +A++A   L +  I   VVS PCFELF +Q D+YRA ++G++P +I IE
Sbjct: 541 VTLIATGSEVSLALDAASKLEAEGIKAAVVSAPCFELFADQDDAYRASVLGTAP-RIGIE 599

Query: 621 AGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           A     W  +IG  G+F+GM GFGAS    +LYQ FGI A A+VD  +  ++
Sbjct: 600 AARDTDWRRWIGDTGAFVGMTGFGASAPAPVLYQKFGITADAVVDAAKGAIA 651


>gi|86748074|ref|YP_484570.1| transketolase [Rhodopseudomonas palustris HaA2]
 gi|86571102|gb|ABD05659.1| transketolase [Rhodopseudomonas palustris HaA2]
          Length = 671

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/655 (56%), Positives = 461/655 (70%), Gaps = 2/655 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           + +MA+AIRFL++DA+E   SGHPG+PMGMADV T LFT+ + FD   P WP+RDRFVLS
Sbjct: 14  HAEMANAIRFLAIDAVEKAKSGHPGMPMGMADVATVLFTRFLKFDAADPAWPDRDRFVLS 73

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML YALL+L G ++VTI+ +K+FR  GSKT GHPEYG   G+E TTGPLGQG+A 
Sbjct: 74  AGHGSMLLYALLHLTGVEEVTIDQLKSFRQWGSKTPGHPEYGHTKGVETTTGPLGQGLAT 133

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           +VGMA+AER L   +GD L+DHYTYV+ GDGCLMEG+S EAIS AGHL L++LIVLWD+N
Sbjct: 134 SVGMALAERMLNARYGDALVDHYTYVIAGDGCLMEGVSHEAISLAGHLKLNRLIVLWDDN 193

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            ISIDG  SL+ S DQ ARF ASGW T  V+GHD  A+ + + +A+ SD+PT+IAC T I
Sbjct: 194 HISIDGDTSLSCSDDQLARFAASGWATTRVDGHDPEAVAAAIEQARQSDRPTLIACRTTI 253

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSP  AGT K HG+ LG +E++ TR ALNW   PF IPD I+ +WR  G R       
Sbjct: 254 GFGSPKVAGTEKAHGAPLGADEVEKTRAALNWPHAPFEIPDAILARWREDGSRGKAAHQA 313

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W ERL S+ ++ R  FE   +  L   ++ A   L   F   +P IATR++S+L +  + 
Sbjct: 314 WAERLGSVDAATRTGFENVLAGKLSADYEPALKALIAGFAAEQPSIATRQASQLTINALV 373

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
              P L+GGSADLT SN T      ++    + G YLHYG+RE  MAAAMNGIALH G  
Sbjct: 374 PASPNLLGGSADLTHSNLTHAKGSASVKPGAYGGAYLHYGIREFGMAAAMNGIALHGGFI 433

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+VF+DYSRPAIRLA+LMG+RVIHV+THDSIGLGEDGPTHQPVEH+A+LRAIP+L
Sbjct: 434 PYGGTFLVFADYSRPAIRLAALMGVRVIHVMTHDSIGLGEDGPTHQPVEHVASLRAIPNL 493

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYDYISTP 557
           LV RPAD+IET + W  ALK+ +RPSVL+LSRQ LP L R      N  + GAY  I   
Sbjct: 494 LVFRPADAIETAQAWDCALKQTSRPSVLALSRQALPMLPRPNGVEGNPVSRGAYLVIDPA 553

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
              VT+ ++GSE+ +A+EA   L    I   VVS PCFELF EQ D+YRA ++G++P +I
Sbjct: 554 KRDVTLIATGSEVSLALEAASKLDGEGIKVAVVSAPCFELFAEQDDAYRAAVLGTAP-RI 612

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
            IEA     W  +IG  G+F+GM GFGAS    +LYQ FGI A A+ +  +  ++
Sbjct: 613 GIEAARDIDWRRWIGDGGAFVGMTGFGASAPAPVLYQKFGITADAVTEAAKAAIA 667


>gi|182676943|ref|YP_001831090.1| transketolase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182636573|gb|ACB97346.1| transketolase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 665

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/662 (54%), Positives = 472/662 (71%), Gaps = 2/662 (0%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           MK    +  MA+A+R L++D +E   SGHPG P+G+ADV T L+ + + F+   P WP+R
Sbjct: 1   MKNSAVHDLMANAVRGLAIDGVEAAKSGHPGAPLGLADVATVLWAKHLKFNASKPKWPDR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRF+LSAGH SML Y+LLYL G + +T++++K FR + S T GHPE+G   G+E TTGPL
Sbjct: 61  DRFILSAGHASMLIYSLLYLTGVEGMTLDELKRFRQLDSNTPGHPEFGHTLGVETTTGPL 120

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+A +VG A+AE+KL+ EF D ++DHYT+VL  DG LMEGIS EAI+ AGHL L+KLI
Sbjct: 121 GQGLATSVGFALAEKKLQAEFSDAIVDHYTFVLASDGDLMEGISHEAIALAGHLKLNKLI 180

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           +LWD+NGISIDGP++L+DS DQ  RF A+GW    ++GHD  AI + + +A++S +P++I
Sbjct: 181 MLWDDNGISIDGPLTLSDSVDQVKRFEAAGWRAERIDGHDEQAIDAAIARAKVSTQPSLI 240

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
           AC+TVIGFG+P +AG++KVHG  LG EEI AT+  L   ++PF +  D +K WR  G RS
Sbjct: 241 ACKTVIGFGAPKKAGSHKVHGEPLGPEEIVATKNVLGLSVNPFSVQPDALKAWRAMGQRS 300

Query: 313 SQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           +    DW  RL+++ S  R EF RR +   P     A    KKK   +   +ATRK+SEL
Sbjct: 301 ATEYNDWSARLAALDSDKRVEFVRRTAGTRPASLSQAIEAHKKKLHANPVTVATRKASEL 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LE +   +PELI GSADLT SN TK    ++I+   + GRY+HYG+REH MAAAMNG+ 
Sbjct: 361 ALEAIFPIMPELISGSADLTPSNNTKAKGFESITPDSWEGRYIHYGIREHGMAAAMNGMV 420

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH GL P  GTF VFSDY RPAIRL++LM   V++V+THDSIGLGEDGPTHQPVEHLAAL
Sbjct: 421 LHGGLVPVGGTFFVFSDYCRPAIRLSALMRAPVVYVMTHDSIGLGEDGPTHQPVEHLAAL 480

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           RAIP+L + RP D+IET E W++AL   + P+V+ L+RQNLP LRT + + NL A GAY+
Sbjct: 481 RAIPNLRLFRPCDAIETAEAWELALSRTDGPTVIVLTRQNLPQLRTVHSAGNLLATGAYE 540

Query: 553 YIST--PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
            + +     QVTIF+SGSE++IAV+A ++L++  I+ RVVS+P  ELF  Q    R  +I
Sbjct: 541 LMVSEGEEPQVTIFASGSEVEIAVDAYKLLAAEGIAARVVSIPSLELFLAQPQEVRKALI 600

Query: 611 GSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERK 670
           GS+PI+IA+EA +R GWDA +G DG F+GM  FGAS     LY+HFGI A AI D V R 
Sbjct: 601 GSAPIRIAVEAAVRFGWDAVVGEDGLFVGMSSFGASAPSKDLYKHFGITADAIADAVIRS 660

Query: 671 LS 672
           LS
Sbjct: 661 LS 662


>gi|148257630|ref|YP_001242215.1| transketolase [Bradyrhizobium sp. BTAi1]
 gi|146409803|gb|ABQ38309.1| transketolase [Bradyrhizobium sp. BTAi1]
          Length = 670

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/659 (56%), Positives = 469/659 (71%), Gaps = 2/659 (0%)

Query: 14  KYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRD 73
           K D  + +MA+AIRFL++DA+E   SGHPG+PMGMADV T LF++ M FDP  P WP+RD
Sbjct: 7   KADPAHAEMANAIRFLAIDAVEKAKSGHPGMPMGMADVATVLFSRFMKFDPADPAWPDRD 66

Query: 74  RFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLG 133
           RFVLSAGHGSML YALL+L GY+ VTI++IK FR  G+KT GHPEYG   G+E TTGPLG
Sbjct: 67  RFVLSAGHGSMLLYALLHLTGYEAVTIDEIKRFRQWGAKTPGHPEYGHTPGVETTTGPLG 126

Query: 134 QGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIV 193
           QGIA AVGMA+AER +   +GD LIDHYTYV+ GDGCLMEGIS EAIS AGHL L++LIV
Sbjct: 127 QGIATAVGMALAERLMNARYGDELIDHYTYVIAGDGCLMEGISHEAISLAGHLRLNRLIV 186

Query: 194 LWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIA 253
           L+D+NGISIDG   LA S DQ  RF ASGW T  ++GHD  AI + +  A+ SD+PTMIA
Sbjct: 187 LFDDNGISIDGSTGLACSDDQLGRFAASGWATSRIDGHDPEAIAAAIAAARQSDRPTMIA 246

Query: 254 CETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSS 313
           C T IGFGSP R G+ K HG+ LG EE++ TR AL+W   PF IP D++  WR  G R  
Sbjct: 247 CRTTIGFGSPGRQGSEKAHGAPLGPEEVEKTRAALHWPHRPFEIPADVLVSWREIGARGH 306

Query: 314 QTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
             R  W+ER   + ++ R       +  LP  +         +    +P IATR++S+ V
Sbjct: 307 SVRQAWKERARKLCTADRSPCHDALNKKLPAAYTERMAQFIAQLTAERPKIATRQASQNV 366

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           ++V+   LP L+GGSADLT SN TK    K+++ +   G Y+HYGVREHAMAAAMNGIAL
Sbjct: 367 IDVIATVLPNLLGGSADLTHSNLTKAKTHKSVTPATMDGNYVHYGVREHAMAAAMNGIAL 426

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H G  PY GTF+ F+DYSRPAIRLA+LMGIRVIHV+THDSIGLGEDGPTHQPVEH+A+LR
Sbjct: 427 HGGFIPYGGTFLAFADYSRPAIRLAALMGIRVIHVMTHDSIGLGEDGPTHQPVEHVASLR 486

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY 553
           AIP+LLV RPAD++ET E W  AL+ +  PSVL LSRQ LP  RT+   +N  ALGAY  
Sbjct: 487 AIPNLLVFRPADAVETAEAWDCALRAETSPSVLCLSRQALPAFRTEASDHNKVALGAYVV 546

Query: 554 ISTPNAQ-VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
           +     + VT+ ++GSE+ IA+EA ++L++  +   VVS PCFELF +Q+  YRAQ++G+
Sbjct: 547 VEPETRRDVTLIATGSEVAIALEAAKLLAAEGVHAAVVSAPCFELFRQQTAEYRAQVLGN 606

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +P +I +EA +   W  ++G  G F+GMQGFGAS   D+LY+ FGI   A+ D   R +
Sbjct: 607 AP-RIGVEAAIEGDWARWLGDSGEFVGMQGFGASAPADVLYREFGITPAAVADAAMRNI 664


>gi|91978771|ref|YP_571430.1| transketolase [Rhodopseudomonas palustris BisB5]
 gi|91685227|gb|ABE41529.1| transketolase [Rhodopseudomonas palustris BisB5]
          Length = 662

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/644 (56%), Positives = 471/644 (73%), Gaps = 3/644 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ +MA+AIR L+MDA+E   SGHPGLPMG ADV T LFT  + FD   P+WP+RDRF+L
Sbjct: 5   DHSRMANAIRALAMDAVEKAKSGHPGLPMGAADVATVLFTDFLKFDAADPHWPDRDRFIL 64

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL G  ++T++ IK FR + S+T GHPE      +E TTGPLGQG+A
Sbjct: 65  SAGHGSMLLYALLYLTGNSELTLDQIKAFRQLDSRTPGHPENCITDSVETTTGPLGQGVA 124

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           ++VG A+AER L  EFG++ +DHYTYVL  DG LMEG+S EA++ AGHL LSKLI L+D+
Sbjct: 125 SSVGTALAERLLAAEFGEI-VDHYTYVLCSDGDLMEGVSHEALALAGHLKLSKLIFLYDD 183

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGISIDGP++L D+ DQ ARF+A GWN + ++GHDH AI + ++ AQ SD+PTMIAC+T 
Sbjct: 184 NGISIDGPLTLTDNVDQVARFQAHGWNAMRIDGHDHTAIAAAIKAAQASDRPTMIACKTT 243

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IGFG+P RAGT+K HG  LG EE+   +KAL WD  PF IPDD++  WR  G + ++  A
Sbjct: 244 IGFGAPTRAGTSKAHGEPLGAEELAGAKKALGWDYGPFEIPDDVLSAWRAVGSKGAKAHA 303

Query: 318 DWQERLSSMKSSIRKEFERRFSD-ALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
            WQ +L +M   +R EF+RR  D   P   D A   LK +       IATRK+SEL LE 
Sbjct: 304 AWQTKLDAMDKDLRAEFQRRVIDRKRPAALDGAIRKLKDRLVDEPQTIATRKASELALEA 363

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           + + +PE++ GSADLT SN T+T   K ++  DFSGRY+HYG+RE  MAAAMNGIA+H G
Sbjct: 364 IVEVVPEMLLGSADLTPSNNTRTKHAKDVTPEDFSGRYIHYGIREMGMAAAMNGIAMHGG 423

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
            AP  GTF+ F+DY+RP++R+A+L  + V++++THDSIGLGEDGPTHQPVEHLA+LRA+P
Sbjct: 424 FAPAGGTFLCFADYARPSMRIAALSHVPVVYIMTHDSIGLGEDGPTHQPVEHLASLRAMP 483

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           ++ V RPAD +ET ECWQ+AL+    P+VL+LSRQNL  +RT    +N CA G Y+ I+ 
Sbjct: 484 NMRVFRPADPVETAECWQLALENTGGPTVLALSRQNLTPVRTSKSDDNRCAKGGYELIAA 543

Query: 557 P-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
             NA V+IF++GSE++IAV A ++L+ + IS RVVSVP  +L   Q D+ R  IIG +P+
Sbjct: 544 KGNASVSIFATGSEVEIAVAAHKLLADKGISARVVSVPSLDLLLLQDDATRKGIIGDAPV 603

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           K+A+EA +R GWDA IG DG FIGM GFGAS     LY+HFGI 
Sbjct: 604 KVAVEAAVRFGWDAVIGPDGGFIGMSGFGASAPAKDLYKHFGIT 647


>gi|288957813|ref|YP_003448154.1| transketolase [Azospirillum sp. B510]
 gi|288910121|dbj|BAI71610.1| transketolase [Azospirillum sp. B510]
          Length = 664

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/653 (55%), Positives = 466/653 (71%), Gaps = 4/653 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA AIR LSMDA+E   SGHPG+PMGMADV T LFTQ + FDP+ P WP+RDRFVLSAGH
Sbjct: 13  MASAIRALSMDAVEAAKSGHPGMPMGMADVATVLFTQFLKFDPKNPTWPDRDRFVLSAGH 72

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+L YL GY+ +TI++IK FR + S T GHPE     GIE TTGPLGQG++ AVG
Sbjct: 73  GSMLLYSLAYLTGYERMTIDEIKRFRQLHSLTPGHPEVDPSLGIEMTTGPLGQGVSTAVG 132

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER     FGD LIDHYTYV+  DG LMEG+S EA S AGHLGL++LIVLWD+N IS
Sbjct: 133 MALAERITNARFGDALIDHYTYVIASDGDLMEGVSHEACSLAGHLGLNRLIVLWDDNHIS 192

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLS-DKPTMIACETVIGF 260
           IDG   L+ + D  ARFR+ GWNT++V+GHD  A++  + +A+ S DKPT+IAC T+IG 
Sbjct: 193 IDGTTDLSFTDDTQARFRSYGWNTIAVDGHDTDAVSKAIAQARTSTDKPTLIACRTIIGK 252

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PN+A ++  HGS LG +EI ATR A+ W  +PF +P D++  WR AG RS+   A W 
Sbjct: 253 GAPNKANSHACHGSPLGADEIAATRAAIGWSHEPFVVPADVLSAWRAAGTRSAGAHAGWA 312

Query: 321 ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
           +R +++ +   K F+  F   +P    +  +  K+K    KP  ATR +S   LEV+   
Sbjct: 313 DRRAALTAEAGKAFDEAFGHGVPSALADTIVAFKRKVSAEKPSWATRVASGNTLEVLVPA 372

Query: 381 LPELIGGSADLTGSNGTKTSQMKAIS-KSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
           +PE+IGGSADLT SN TK      +  K +F+GRY+ YGVREH MA  MNG+ LH G+ P
Sbjct: 373 IPEMIGGSADLTPSNNTKVKNTADVKGKGEFAGRYVRYGVREHGMATLMNGMTLHGGVIP 432

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTFM F+DY RPAIRLA+LM  R I V+THDSIGLGEDGPTHQPVEHLAALRAIP+LL
Sbjct: 433 YGGTFMQFADYCRPAIRLAALMKQRTIFVMTHDSIGLGEDGPTHQPVEHLAALRAIPNLL 492

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA 559
           VLRPAD++ET ECWQ+AL+    PSVL+L+RQN+P LRT++ + N  A GAY  +     
Sbjct: 493 VLRPADAVETAECWQIALEATGSPSVLALTRQNVPTLRTEHTAENRSARGAYVIVEAEGE 552

Query: 560 -QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIA 618
            + TI ++GSE+ +AVEA + L ++ I T VVS+P +ELF  Q D+YRA ++G+  +++ 
Sbjct: 553 RKATILATGSEVSLAVEARKALQAQGIGTAVVSMPSWELFERQDDAYRASVLGTG-VRVG 611

Query: 619 IEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +EA +R GWD ++G  G+F+GM GFG S     LY+HFGI A A+VD V+ +L
Sbjct: 612 VEAAIRLGWDRWLGDKGAFVGMAGFGESAPYQELYKHFGITAEAVVDAVKARL 664


>gi|115526717|ref|YP_783628.1| transketolase [Rhodopseudomonas palustris BisA53]
 gi|115520664|gb|ABJ08648.1| transketolase [Rhodopseudomonas palustris BisA53]
          Length = 663

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/656 (55%), Positives = 472/656 (71%), Gaps = 2/656 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ +MA+AIR L+MDA+E   SGHPGLPMG AD+ T LFT  + FD   P WP+RDRF+L
Sbjct: 5   DHGRMANAIRALAMDAVEKAKSGHPGLPMGAADIATVLFTTFLKFDAADPRWPDRDRFIL 64

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL G +DVT+E+IK FR + SKT GHPE    AG+E TTGPLGQG+A
Sbjct: 65  SAGHGSMLLYALLYLTGNEDVTLEEIKRFRQLDSKTPGHPESFMTAGVETTTGPLGQGVA 124

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           ++VG A+AER L  EFG+ ++DH+TYVL  DG LMEG+S EAI+ AGHL LSKLI L+D+
Sbjct: 125 SSVGTALAERLLAAEFGEDVVDHFTYVLCSDGDLMEGVSHEAIALAGHLKLSKLIFLYDD 184

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGISIDGP+SL+DS DQ ARF+A GWN + ++GHD HAI + + +AQ SD+P++IAC+T 
Sbjct: 185 NGISIDGPLSLSDSVDQVARFKAHGWNAIQIDGHDQHAIAAAIEQAQSSDRPSLIACKTT 244

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IG+G+P +AGT K HG ALG +E+   +KAL W+  PF IPDD++  WR  G + +    
Sbjct: 245 IGYGAPTKAGTAKAHGEALGADELAGAKKALGWNYGPFEIPDDVLSAWRNVGKQGASAHG 304

Query: 318 DWQERLSSMKSSIRKEFERRFSD-ALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           +W  R  ++ ++ R EF RR  +   P         LK +       IATRK+SELVLEV
Sbjct: 305 EWNSRFDALPATTRDEFLRRVIERKRPAALGEVIGKLKDRLVAEPQSIATRKASELVLEV 364

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +   +PEL+ GSADLT SN T+T  +K ++  DFSGRY+HYG+RE  MAAAMNGI+ H G
Sbjct: 365 LVPIMPELLLGSADLTPSNNTRTKGLKEVTPGDFSGRYIHYGIREMGMAAAMNGISTHGG 424

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
            AP  GTF+ F+DY+RPA+R+A+L    V +++THDSIGLGEDGPTHQPVEHLAALRA+P
Sbjct: 425 FAPAGGTFLCFTDYARPAMRVAALSYTPVTYIMTHDSIGLGEDGPTHQPVEHLAALRAMP 484

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           ++ V RPAD++ET ECWQ+AL+    P+VL+LSRQNL  +R Q  ++N CA G Y+ I+ 
Sbjct: 485 NMRVFRPADAVETAECWQLALENTKGPTVLALSRQNLSPVRRQASADNRCAHGGYELIAA 544

Query: 557 P-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
             +A+V +F+SGSE++IAV A + L  R I+TRVVSVP  +L   Q    R  IIG +P+
Sbjct: 545 EGSARVALFASGSEVEIAVAAHKQLVERGIATRVVSVPSLDLLLGQPAELRHAIIGDAPV 604

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           K+A+EA +R GWDA IG +G F+GM  FGAS     LY HFGI A A+V M    L
Sbjct: 605 KVAVEAAVRFGWDAVIGPEGGFVGMSSFGASAPAKDLYPHFGITADAVVAMAAGPL 660


>gi|146338724|ref|YP_001203772.1| transketolase [Bradyrhizobium sp. ORS278]
 gi|146191530|emb|CAL75535.1| Transketolase (TK) [Bradyrhizobium sp. ORS278]
          Length = 670

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/660 (56%), Positives = 470/660 (71%), Gaps = 2/660 (0%)

Query: 14  KYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRD 73
           K D  + +MA+AIRFL++DA+E   SGHPG+PMGMADV T LF++ M FDP  P WP+RD
Sbjct: 7   KVDPAHAEMANAIRFLAIDAVEKAKSGHPGMPMGMADVATVLFSRFMKFDPADPAWPDRD 66

Query: 74  RFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLG 133
           RFVLSAGHGSML YALL+L GY+ VTI++IK FR  G+KT GHPEYG   G+E TTGPLG
Sbjct: 67  RFVLSAGHGSMLLYALLHLTGYEAVTIDEIKAFRQWGAKTPGHPEYGHTPGVETTTGPLG 126

Query: 134 QGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIV 193
           QGIA AVGMA+AER +   +GD L+DHYTYV+ GDGCLMEGIS EAIS AGHL L++LIV
Sbjct: 127 QGIATAVGMALAERLMNARYGDELVDHYTYVIAGDGCLMEGISHEAISLAGHLRLNRLIV 186

Query: 194 LWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIA 253
           L+D+NGISIDG   LA S DQ ARF ASGW T  ++GHD  AI + +  A+ SD+P+MIA
Sbjct: 187 LFDDNGISIDGSTGLACSDDQPARFAASGWATSRIDGHDPQAIEAAIAAARQSDRPSMIA 246

Query: 254 CETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSS 313
           C T IGFGSP R G+ K HG+ LG EE+  TR AL+W   PF +P D++  WR  G R  
Sbjct: 247 CRTTIGFGSPGRQGSEKAHGAPLGPEEVDKTRAALHWPHRPFEVPADVLVSWREIGARGR 306

Query: 314 QTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
             R  W+ER   + ++ R       +  LP  +         +    KP IATR++S+ V
Sbjct: 307 SVRQAWKERARKLGTADRSPCHDALNKKLPAAYIERMAQFIAQLTVEKPKIATRQASQNV 366

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           ++V+   LP L+GGSADLT SN TK    K+++ S   G Y+HYGVREHAMAAAMNG+AL
Sbjct: 367 IDVIATVLPNLLGGSADLTHSNLTKAKTHKSVTPSSMDGNYVHYGVREHAMAAAMNGVAL 426

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H G  PY GTF+ F+DY+RPAIRLA+LMGIRVIHV+THDSIGLGEDGPTHQPVEH+ +LR
Sbjct: 427 HGGFIPYGGTFLAFADYNRPAIRLAALMGIRVIHVMTHDSIGLGEDGPTHQPVEHVPSLR 486

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY 553
           AIP+LLV RPAD++ET E W  AL+ +  PSVL LSRQ LP  RT+   +N  ALGAY  
Sbjct: 487 AIPNLLVFRPADAVETAEAWDCALRAETSPSVLCLSRQALPAFRTEASDHNKVALGAYVV 546

Query: 554 ISTPNAQ-VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
           +     + VT+ ++GSE+ IA+EA ++L++ N+   VVS PCFELF +QS  YRA ++GS
Sbjct: 547 VEPDGGRNVTLIATGSEVAIALEAAKLLAAENVRAAVVSAPCFELFRKQSAEYRADVLGS 606

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           +P +I +EA +   W  ++G  G F+GM GFGAS   D+LY+ FGI   A+VD  +R ++
Sbjct: 607 AP-RIGVEAAIEGEWARWLGDAGEFVGMHGFGASAPADVLYREFGITPAAVVDAAKRNIT 665


>gi|90424394|ref|YP_532764.1| transketolase [Rhodopseudomonas palustris BisB18]
 gi|90106408|gb|ABD88445.1| transketolase [Rhodopseudomonas palustris BisB18]
          Length = 673

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/655 (54%), Positives = 463/655 (70%), Gaps = 2/655 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +++MA+AIRFL++DA+E   SGHPG+PMGMADV T LF++ + FD   P WP+RDRFVLS
Sbjct: 16  HREMANAIRFLAIDAVEKAKSGHPGMPMGMADVATVLFSRFLKFDAAAPAWPDRDRFVLS 75

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML YALLYL G +DVT++ IK FR  GSKT GHPEYG   G+E TTGPLGQG+A 
Sbjct: 76  AGHGSMLLYALLYLTGNEDVTLDQIKAFRQWGSKTPGHPEYGHTKGVETTTGPLGQGLAT 135

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           AVGMA+AER     FGD ++DHYTYV+ GDGCLMEGIS EAIS AGHL L+KLIVL+D+N
Sbjct: 136 AVGMALAERMSNARFGDDVVDHYTYVIAGDGCLMEGISHEAISLAGHLKLNKLIVLFDDN 195

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            ISIDG  SL+ S DQ ARF ASGW    V+GHD  A+ + + +A+ SD+PT+IAC TVI
Sbjct: 196 QISIDGATSLSCSDDQVARFAASGWAASRVDGHDPEAVAAAIEQAKQSDRPTLIACRTVI 255

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSP RAG+ K HG+ LG EEI+ TR AL W   PF IP+ I+K WR  G R       
Sbjct: 256 GFGSPGRAGSEKAHGAPLGAEEIEKTRAALQWPYAPFEIPEPILKAWREIGKRGEAAHTA 315

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W ER ++  + +R  F+      L   +D A   L +KF   +P IATR++S+L ++ + 
Sbjct: 316 WSERFAACDAGLRTAFDDALQGKLSAEYDGALKALVQKFSTERPNIATRQASQLTIDTIV 375

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
              P ++GGSADLT SN T      +++  +++G Y+HYG+REH MAAAMNGIALH G  
Sbjct: 376 AASPNILGGSADLTHSNLTHAKGTASVTPDNYAGSYIHYGIREHGMAAAMNGIALHGGFI 435

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           P+ GTF+ F+DYSR AIRL +LMG+RVIHV+THDSIGLGEDGPTHQPVE +A+LRAIP+L
Sbjct: 436 PFGGTFLSFADYSRGAIRLGALMGVRVIHVMTHDSIGLGEDGPTHQPVEQVASLRAIPNL 495

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN 558
           LV RPAD++ET E W  ALK+ +RPS+L+LSRQ LP  R+     N  A GAY  +   +
Sbjct: 496 LVFRPADAVETAEAWDCALKQAHRPSLLALSRQALPTARSGLSETNQVARGAYLVVDPGD 555

Query: 559 AQ-VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
            + +T+ ++GSE+ IA +A ++L    +   VVS PCFELF EQ ++YR  I+G++P ++
Sbjct: 556 KRDITLIATGSEVAIATDAAKLLGEAGVKAAVVSAPCFELFAEQPEAYRDAILGTAP-RV 614

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
            +EA +   W  +IG  G F+GM GFGAS    +LY+ FGI A A+    +R ++
Sbjct: 615 GVEAAIAADWYRWIGEKGEFVGMTGFGASAPASVLYREFGITADAVAKAAQRAIA 669


>gi|92118991|ref|YP_578720.1| transketolase [Nitrobacter hamburgensis X14]
 gi|91801885|gb|ABE64260.1| transketolase [Nitrobacter hamburgensis X14]
          Length = 678

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/656 (56%), Positives = 477/656 (72%), Gaps = 2/656 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D   MA+A+R L+MDA+E   SGHPGLPMGMADV T LFT+ + +D   P+WP+RDRF+L
Sbjct: 20  DSSHMANAVRALAMDAVEKAKSGHPGLPMGMADVATVLFTKFLKYDAADPHWPDRDRFIL 79

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL G++++T++ IKNFR + SKT GHPE     G+E TTGPLGQG+A
Sbjct: 80  SAGHGSMLLYALLYLTGHKEMTLDQIKNFRQLNSKTPGHPENFVTEGVETTTGPLGQGVA 139

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
            +VG A+AER L  +FG  ++DHYTYVL  DG LMEGIS EAI+ AGHL L+KLI L+D+
Sbjct: 140 TSVGFALAERLLAAQFGSDVVDHYTYVLCSDGDLMEGISHEAIALAGHLKLTKLIFLYDD 199

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGI+IDGPISLAD  DQ ARF+A GW+   ++GHD  AI + +R+AQ SDKP++IAC+T+
Sbjct: 200 NGITIDGPISLADDVDQVARFKACGWDARRIDGHDPKAIAAAIRRAQKSDKPSLIACKTI 259

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IGFG+P RAGT+K HG ALG EE+   +KAL W+  PF IPDD++K WR AG +  +   
Sbjct: 260 IGFGAPTRAGTSKAHGEALGAEELAGAKKALGWNYGPFEIPDDVLKTWRSAGRKGKRHNK 319

Query: 318 DWQERLSSMKSSIRKEFERRFSD-ALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           +W+ R ++   + R EF RR  D   P   D     LK K     P IATRK+SEL LEV
Sbjct: 320 EWRARFAAKSEAERGEFTRRAIDRKPPQNLDEVIRKLKDKLVAEPPTIATRKASELALEV 379

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +   +PEL+ GSADLT SN T+   +K +      GRY+HYG+RE  M+AAMNG+ALH G
Sbjct: 380 LAPAVPELLLGSADLTPSNNTRPKGLKEVQPGHDDGRYIHYGIRELGMSAAMNGLALHGG 439

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
            AP  GTFM F+DY+RPA+R+++L  I VI+++THDSIGLGEDGPTHQPVEHLA+LRA+P
Sbjct: 440 FAPAGGTFMCFTDYARPAMRVSALAHIPVIYIMTHDSIGLGEDGPTHQPVEHLASLRAMP 499

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           ++ V RPAD++ET ECWQ+AL+    P+VL+LSRQNL  +R   + +N CA GAY+ ++ 
Sbjct: 500 NMRVFRPADAVETAECWQLALERPKGPTVLALSRQNLTPVRKTADPDNRCAHGAYELVAA 559

Query: 557 P-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
              A+V+IF+SGSE++IAV A + L+ R I++RVVSVP  EL  EQ +  R  IIG +P+
Sbjct: 560 NGEAKVSIFASGSEIEIAVAAQQQLAGRGIASRVVSVPSLELLLEQPEERRQAIIGKAPV 619

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           KIA+EA +R GWDA IGSDG F+GM  FG S     LY+ FGI A A+VD  E +L
Sbjct: 620 KIAVEAAVRFGWDAVIGSDGLFVGMHSFGHSAPAKDLYKFFGITAEAVVDAAETRL 675


>gi|91975532|ref|YP_568191.1| transketolase [Rhodopseudomonas palustris BisB5]
 gi|91681988|gb|ABE38290.1| transketolase [Rhodopseudomonas palustris BisB5]
          Length = 671

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/655 (54%), Positives = 463/655 (70%), Gaps = 2/655 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           + +MA+A+RFL++DA+E   SGHPG+PMGMADV T LFT+ M FD   P WP+RDRFVLS
Sbjct: 14  HGEMANAVRFLAIDAVEKAKSGHPGMPMGMADVATVLFTRFMKFDAADPTWPDRDRFVLS 73

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML YALL+L GY++VTI+++K FR  GSKT GHPEYG   G+E TTGPLGQG+A 
Sbjct: 74  AGHGSMLLYALLHLTGYKEVTIDELKAFRQWGSKTPGHPEYGHTEGVETTTGPLGQGLAT 133

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           +VGMA+AER L   +GD L+DH+TYV+ GDGCLMEG+S EAIS AGHL L++LIVLWD+N
Sbjct: 134 SVGMALAERMLNARYGDALVDHFTYVIAGDGCLMEGVSHEAISLAGHLKLNRLIVLWDDN 193

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            ISIDG  SL+ S DQ ARF ASGW T  V+GHD  A+ + + +A+ SD+P++IAC T I
Sbjct: 194 HISIDGETSLSCSDDQLARFAASGWATTRVDGHDPEAVEAAIEQARKSDRPSLIACRTKI 253

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSP   GT K HG+ LG +E++ TR ALNW   PF +PD ++ +WR AG R       
Sbjct: 254 GFGSPKVEGTEKAHGAPLGADEVEKTRAALNWPHPPFEVPDAVLARWREAGSRGKAAHQA 313

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W ERL ++ ++ R  FE   +  L   ++ A   L   F   +P IATR++S+L +  + 
Sbjct: 314 WTERLGNLDAATRAGFENVLAGKLSADYEPALKALIANFASDQPSIATRQASQLTINALV 373

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
              P L+GGSADLT SN T      ++    + G YLHYG+RE  MAAAMNG+ALH G  
Sbjct: 374 PASPNLLGGSADLTHSNLTHAKGSVSVKPGAYGGSYLHYGIREFGMAAAMNGLALHGGFI 433

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+VF+DYSRPAIRLA+LMG+RVIHV+THDSIGLGEDGPTHQPVEH+++LRAIP+L
Sbjct: 434 PYGGTFLVFADYSRPAIRLAALMGVRVIHVMTHDSIGLGEDGPTHQPVEHVSSLRAIPNL 493

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYDYISTP 557
           LV RPAD+IET + W  ALK+ +RPSVL+LSRQ LP L R    ++N    GAY  I   
Sbjct: 494 LVFRPADAIETAQAWDCALKQASRPSVLALSRQALPMLPRPNGVNDNPVGRGAYLVIDPG 553

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
              VT+ ++GSE+ +A+EA   L    I   VVS PCFELF EQ ++YRA ++G++P +I
Sbjct: 554 KRDVTLIATGSEVSLALEAACKLEGEGIKAAVVSAPCFELFAEQDEAYRATVLGTAP-RI 612

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
            +EA     W  +IG  G+F+GM GFGAS    +LYQ FGI A A+ D  +  ++
Sbjct: 613 GVEAARDIDWRRWIGDGGAFVGMTGFGASAPAPVLYQKFGITADAVTDAAKAAIA 667


>gi|260460230|ref|ZP_05808482.1| transketolase [Mesorhizobium opportunistum WSM2075]
 gi|259033875|gb|EEW35134.1| transketolase [Mesorhizobium opportunistum WSM2075]
          Length = 670

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/645 (58%), Positives = 473/645 (73%), Gaps = 7/645 (1%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D + MA+AIR L+MDA++  NSGHPG+PMGMADV T LF + +  DP  P WP+RDRFVL
Sbjct: 15  DEQLMANAIRALAMDAVQKANSGHPGMPMGMADVATILFNRFLQIDPSRPDWPDRDRFVL 74

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YAL YLLGY+D+ IE+++ FR +GS+TAGHPEYG   GIE TTGPLGQGIA
Sbjct: 75  SAGHGSMLQYALHYLLGYEDMPIEELQRFRQLGSRTAGHPEYGHALGIETTTGPLGQGIA 134

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
            AVGMA+AER L   FG  L+DHYTY + GDGCL EG+S EAI  AGHLGLSKLIVLWD+
Sbjct: 135 TAVGMALAERMLAARFGAGLVDHYTYAIAGDGCLQEGMSHEAIDLAGHLGLSKLIVLWDD 194

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           N ISIDGP SLA S DQ  RFRA+GW+ LS++GHD  AI + L +A+ SD+PT+IAC T 
Sbjct: 195 NRISIDGPTSLATSMDQPMRFRAAGWSVLSIDGHDLEAIAAALEQARTSDRPTLIACRTT 254

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IG G+PN  G+ K HG+ LG  EI ATR  L WD  PF IP +I++ WR A  R+   RA
Sbjct: 255 IGKGAPNLGGSEKTHGAPLGAAEIAATRTNLGWDHPPFEIPGEILRAWRTAPARARTARA 314

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            W+ RL++  S  R+EFE   +  LP+    A    +++   S   +ATRK+SE+ L V+
Sbjct: 315 AWEARLAA--SPRRQEFESAVAGDLPEGVFEALSTFRQQHFESATNVATRKASEMALAVI 372

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N+   + +GGSADLT SN T T  M  +S  DFSGRY+HYG+REH MAAAMNG+ALH GL
Sbjct: 373 NEATEQTVGGSADLTHSNLTITKGMARVSPGDFSGRYIHYGIREHGMAAAMNGMALHGGL 432

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTF+ F+DY+R A+RL++LMG RVI+V+THDSIGLGEDGPTHQPVEHLA LRA P+
Sbjct: 433 VPYGGTFLCFADYARGAMRLSALMGQRVIYVMTHDSIGLGEDGPTHQPVEHLAMLRATPN 492

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           L V RPAD IET ECW++AL+ K+RPSVL LSRQ LP LRT+    +  A GAY  +  P
Sbjct: 493 LNVFRPADIIETAECWELALRSKHRPSVLVLSRQTLPMLRTKAPEASRSAKGAY-LMRKP 551

Query: 558 NAQ--VTIFSSGSELKIAVEACEILSSR-NISTRVVSVPCFELFFEQSDSYRAQIIGSSP 614
             +  VT+ ++GSE++IA  A ++L  R ++   +VS+PC+ELF EQ ++YRA+++G++P
Sbjct: 552 VGRRDVTLIATGSEVEIARAAADLLLERHHMRVALVSMPCWELFEEQDEAYRAEVLGTAP 611

Query: 615 IKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
            +IA+EA  R GWD +IG  GSF+GM GFGAS     LY+HFGI 
Sbjct: 612 -RIAVEAAARLGWDRWIGDGGSFVGMTGFGASAPAAELYRHFGIT 655


>gi|209965110|ref|YP_002298025.1| transketolase [Rhodospirillum centenum SW]
 gi|209958576|gb|ACI99212.1| transketolase [Rhodospirillum centenum SW]
          Length = 676

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/658 (54%), Positives = 470/658 (71%), Gaps = 6/658 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +  +A+A+R LSMDA+E   SGHPGLP+GMADV T LFT+ + FD   P WP+RDRFVLS
Sbjct: 20  HADLANAVRALSMDAVEAAKSGHPGLPLGMADVATVLFTRFLKFDAARPRWPDRDRFVLS 79

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML Y+LL+L G++D+ +E++K FR +GS+TAGHPE+G  AGIE TTGPLGQGIA 
Sbjct: 80  AGHGSMLLYSLLHLTGHEDMPLEELKRFRQLGSRTAGHPEFGLAAGIEMTTGPLGQGIAT 139

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           AVGMA+AER L   FGD L+DHYTYV+  DG LMEG+S EA S AGHL LS+LIVLWD+N
Sbjct: 140 AVGMALAERVLNARFGDDLVDHYTYVIASDGDLMEGVSHEAGSLAGHLDLSRLIVLWDDN 199

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            I IDGP  ++ + D  ARFRA GW+  +++GHD H I + +  A+ +D P++IAC TVI
Sbjct: 200 RICIDGPTEMSFTDDTLARFRAYGWDVQTIDGHDAHQIATAIEYARTTDAPSLIACRTVI 259

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           G+G+P +AGT   HGS LG  E++  RKALNW   PF +P+ + + WR AG R ++    
Sbjct: 260 GYGAPTKAGTAASHGSPLGAAEVEGVRKALNWPHAPFEVPEPVRRAWRTAGRRWAEAADA 319

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W+ERL++    +R+ F +     LP   D     +K++   +KP +ATR++S  VL+ + 
Sbjct: 320 WEERLATAGHELREAFRQAVDGRLPAEADAIIDRIKREASETKPAVATRQASGTVLDALV 379

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             +PEL+GGSADLTGSN TK   +  I K  + GRYLHYGVREH MAAAMNG+ALH G+ 
Sbjct: 380 PTVPELLGGSADLTGSNNTKAKNVPIIRKGSYGGRYLHYGVREHGMAAAMNGLALHGGVI 439

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           P+ GTF+ FSDY RP+IRL++LM  RV++V+THDSIGLGEDGPTHQPVEH+AALR IP L
Sbjct: 440 PFGGTFLTFSDYCRPSIRLSALMKQRVVYVMTHDSIGLGEDGPTHQPVEHMAALRCIPGL 499

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-STP 557
           LV RPAD++ET E WQ+AL +K RPSVL+L+RQNLP LRT +   NL A GAY    +T 
Sbjct: 500 LVFRPADAVETAEVWQIALHQKARPSVLALTRQNLPTLRTVHHEENLSARGAYVLREATG 559

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             QVT+ ++GSE+ IAV A ++L +  I T VVS+P +ELF EQ   YRA ++GS  +++
Sbjct: 560 ERQVTLLATGSEVAIAVAARDLLEADGIGTAVVSMPSWELFEEQPAEYRAGVLGSG-VRV 618

Query: 618 AIEAGLRQGWDAFI----GSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           A+EA +R GWD +     G+ G+F+GM GFG SG    LY+HFGI    +      +L
Sbjct: 619 AVEAMVRFGWDRWTGAADGTPGAFVGMPGFGESGPYQDLYRHFGITPEGVAAAARARL 676


>gi|329890466|ref|ZP_08268809.1| transketolase [Brevundimonas diminuta ATCC 11568]
 gi|328845767|gb|EGF95331.1| transketolase [Brevundimonas diminuta ATCC 11568]
          Length = 649

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/639 (55%), Positives = 455/639 (71%), Gaps = 3/639 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MADAIR LSMDA+E   SGHPG+PMGMADV T L+++ + FD   P W +RDRF+LSAGH
Sbjct: 1   MADAIRVLSMDAVEKAKSGHPGMPMGMADVATVLYSKFLKFDASRPDWADRDRFILSAGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+LL+L GY+D T E ++NFR  G KTAGHPEYG  AGIE TTGPLGQG+A +VG
Sbjct: 61  GSMLIYSLLHLTGYKDATREQLENFRQWGFKTAGHPEYGHMAGIETTTGPLGQGLATSVG 120

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
            A+AER L   FG  L+DH T+V+ GDGCLMEG+SQEAI+ AG L L+KL VLWD+N I+
Sbjct: 121 FALAERHLAARFGKDLVDHRTWVVAGDGCLMEGVSQEAIALAGRLKLNKLCVLWDDNEIT 180

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG +SL+D+TDQ  RF+ASGW   +++GHD+  I   L  A   DKPT+IAC+T IG G
Sbjct: 181 IDGKVSLSDATDQLTRFKASGWAVKAIDGHDYRQIQKALAWATKQDKPTLIACKTKIGKG 240

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +    G++K HG+ALG  EI ATR+ALNW   PF +P+ + K W   G +  + R  W+ 
Sbjct: 241 AATMEGSHKTHGAALGATEIAATRQALNWPFAPFELPEGVQKAWAKVGKQGGKARKAWEG 300

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           RL  +  + R +F R  +  LP     A     K+    KP +ATR+SS   LE V + +
Sbjct: 301 RL--LNHAQRDDFTRAMAGDLPTGAFEALDAKLKQLVVDKPALATRQSSGEALETVFNAI 358

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           PE++GGSADLTGSN T     + +   D++GRYL+YG+RE  MAAAMNG+ALH G+ PY 
Sbjct: 359 PEMVGGSADLTGSNNTFVKNTQIMDAPDYAGRYLNYGIREFGMAAAMNGLALHGGVIPYG 418

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           GTFM F+DYSRPAIRL +LMG+R IHVLTHDSIGLGEDGPTHQPVEHLAALRAIP+LL +
Sbjct: 419 GTFMAFADYSRPAIRLGALMGVRAIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPNLLTM 478

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY-ISTPNAQ 560
           RPAD++E LECWQVAL+ K  P+ + LSRQ  P +R      NL   GAY+   +   A+
Sbjct: 479 RPADTVEALECWQVALQHKTTPTAMCLSRQKTPAVRVTDAGENLSRKGAYELKAANGEAK 538

Query: 561 VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIE 620
           VT+F +G+E+ +A++A E+L +  + TRVVSVPCF LF +Q  +Y+  +IG   +++A+E
Sbjct: 539 VTLFGTGTEVALALKAAEMLEAEGVPTRVVSVPCFALFEQQPKAYQDAVIGRGTVRVAVE 598

Query: 621 AGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           A ++QGW+ FIG DG F+GM  FGAS   ++LY+ FGI 
Sbjct: 599 AAIKQGWERFIGEDGGFVGMSSFGASAPAEVLYREFGIT 637


>gi|197106650|ref|YP_002132027.1| transketolase I [Phenylobacterium zucineum HLK1]
 gi|196480070|gb|ACG79598.1| transketolase I [Phenylobacterium zucineum HLK1]
          Length = 656

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/639 (56%), Positives = 461/639 (72%), Gaps = 3/639 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MADAIR LSMDA+E  NSGHPG+PMGMADV   L+T+ + +D   P W +RDRFVLSAGH
Sbjct: 8   MADAIRVLSMDAVEQANSGHPGMPMGMADVAAVLWTKFLKYDAARPDWADRDRFVLSAGH 67

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+LL+L G + VT++ ++NFR +GS T GHPEYG   G+E TTGPLGQG+A AVG
Sbjct: 68  GSMLLYSLLHLSGVKAVTLDSLRNFRQLGSNTPGHPEYGHTPGVETTTGPLGQGLATAVG 127

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER L   FG  L+DH T+VL GDGCLMEG+S EAIS AG L L+KL VLWD+N I+
Sbjct: 128 MAMAERHLAARFGGDLVDHRTWVLAGDGCLMEGVSHEAISLAGRLKLAKLTVLWDDNDIT 187

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG + L+D+TDQ ARF+A+GW    ++GHD   I   L  A   D+P++IAC+T+IG G
Sbjct: 188 IDGHVGLSDATDQLARFKAAGWAVKRIDGHDFGQIRRALAWATRQDRPSLIACKTIIGKG 247

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           SP  AGT+ VHG ALG++E+  TR+ L W  +PF +PD+I + WR AG R ++ R  W+ 
Sbjct: 248 SPTFAGTHDVHGKALGKDEVVKTRENLGWPHEPFVVPDEIARAWRSAGRRGAKVRKAWEA 307

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           RL++  S++R EFER  +  LP     A        E   P  ATR+ S  VLE +   +
Sbjct: 308 RLAA--STLRGEFERAMAGELPKTAFAALDQFIADAEAKAPAAATRQHSGAVLEKIFGEI 365

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           PEL+GGSADLTGSN T       +   D++GRY++YGVRE  MAAAMNG+ALH G+ PY 
Sbjct: 366 PELVGGSADLTGSNNTFVKNTPILDAPDYAGRYVNYGVREFGMAAAMNGLALHGGVIPYG 425

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           GTF+VF+DYSRPAIRLA+LMGIRVIHV THDSIGLGEDGPTHQPVEHLA+LRA+P++ V 
Sbjct: 426 GTFLVFTDYSRPAIRLAALMGIRVIHVGTHDSIGLGEDGPTHQPVEHLASLRAMPNVNVF 485

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY-ISTPNAQ 560
           RPAD++ET ECW++AL  K  PSVL+LSRQ    +RTQ    NL A GAY    +T  A 
Sbjct: 486 RPADAVETAECWKLALDAKATPSVLALSRQKTAAVRTQPIGENLSARGAYQLAAATKPAL 545

Query: 561 VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIE 620
           VTIF+SG+E+ +A+ A ++L +  I  RVVSVPCFELF  Q   Y+  +IG + +++A+E
Sbjct: 546 VTIFASGTEVPVALAARDLLEAEGIGARVVSVPCFELFEAQPRDYQETLIGETDVRVAVE 605

Query: 621 AGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           AG+R GWD FIGSDG F+GM+GFGAS     LY+HFGI 
Sbjct: 606 AGVRMGWDRFIGSDGVFVGMEGFGASAPDKALYKHFGIT 644


>gi|146338226|ref|YP_001203274.1| transketolase [Bradyrhizobium sp. ORS278]
 gi|146191032|emb|CAL75037.1| Transketolase (TK) [Bradyrhizobium sp. ORS278]
          Length = 661

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/656 (55%), Positives = 472/656 (71%), Gaps = 2/656 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ +MA+AIR L+MDA+E   SGHPGLPMG ADV T LFT+ + +D   P WP+RDRFVL
Sbjct: 5   DHSRMANAIRALAMDAVEKAKSGHPGLPMGAADVATVLFTRVLKYDAAVPAWPDRDRFVL 64

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL G +++T++ IK FR + S T GHPE     GIE TTGPLGQGI+
Sbjct: 65  SAGHGSMLLYALLYLTGNEEMTLDQIKRFRQVDSLTPGHPENFRTKGIETTTGPLGQGIS 124

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
            AVGMA+AE+ L+ E+G  ++DH+TYVL  DG LMEGISQEAI+ AGH  L+KLIVLWD+
Sbjct: 125 TAVGMALAEKMLQAEYGKKIVDHHTYVLASDGDLMEGISQEAIAMAGHWKLNKLIVLWDD 184

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGISIDGP+S+ADS DQ  RF+A GW    ++GHD  AI + + +AQ S +P++IAC+T 
Sbjct: 185 NGISIDGPLSIADSVDQVKRFKACGWAAELIDGHDPEAIAAAIARAQKSSRPSLIACKTT 244

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IG+G+P +AGT+KVHG ALG EE+K  ++ L    +PF +PDD++  WR AG R +  RA
Sbjct: 245 IGYGAPTKAGTSKVHGEALGAEELKGAKEKLGISQEPFSVPDDVLAAWREAGRRGAPARA 304

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
           +W+ RL  M    R EFERR     P     A  + KK    +   IATRKSSE  +EV+
Sbjct: 305 EWETRLGEMGPRKRAEFERRLRHERPAALAKALKDHKKALLENPLNIATRKSSEAAIEVI 364

Query: 378 NDCLP-ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
              +P E + GSADLTGSN  K     + S     GR++HYG+REH MAAAMNGI LH G
Sbjct: 365 AAAMPFEFVAGSADLTGSNNNKAKSATSFSAKTPKGRFIHYGIREHGMAAAMNGIFLHGG 424

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
            AP   TF+VFSDY+R A+RL++LMG  V++V+THDSIGLGEDGPTHQPVEHLAALRAIP
Sbjct: 425 FAPNGATFLVFSDYARGAMRLSALMGAGVVYVMTHDSIGLGEDGPTHQPVEHLAALRAIP 484

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           ++ V RPAD++ET ECW++AL   N P+VL+L+RQNLP LRT   ++N C+ G Y+ ++ 
Sbjct: 485 NMRVFRPADAVETAECWELALNRTNGPTVLALTRQNLPQLRTSAPADNPCSHGGYELVAA 544

Query: 557 P-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
             +A+V++F++GSE++IAV A + L+ R I  RVVSVP  EL  EQ    +A+IIG +P+
Sbjct: 545 QGDAKVSLFATGSEVEIAVAAQKQLAERGIPARVVSVPSLELLLEQPAEAKAKIIGHAPV 604

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           KIAIEA +R GWDA IG+DG FIGM  FG SG    LY+HFGI A A V+   ++L
Sbjct: 605 KIAIEAAVRWGWDAVIGTDGIFIGMHSFGESGPYKELYKHFGITAEAAVEAAVKRL 660


>gi|302382403|ref|YP_003818226.1| transketolase [Brevundimonas subvibrioides ATCC 15264]
 gi|302193031|gb|ADL00603.1| transketolase [Brevundimonas subvibrioides ATCC 15264]
          Length = 664

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/641 (55%), Positives = 461/641 (71%), Gaps = 3/641 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K+MADAIR L+MD +E  NSGHPG+PMGMADV T LF++ + FD   P W +RDRF+LSA
Sbjct: 14  KQMADAIRVLAMDGVEKANSGHPGMPMGMADVATVLFSKFLKFDASRPDWADRDRFILSA 73

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY+  T E + NFR  GSKTAGHPEYG   G+E TTGPLGQG+AN+
Sbjct: 74  GHGSMLIYALLHLTGYKAATAEQLSNFRQWGSKTAGHPEYGHMPGVETTTGPLGQGLANS 133

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VG A+AER L  ++GD L+DH T+V+ GDGCLMEG+SQEAI+ AG  GL+KL VLWD+N 
Sbjct: 134 VGFAMAERHLAAKYGDDLVDHRTWVIAGDGCLMEGVSQEAIALAGRYGLNKLTVLWDDNA 193

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           I+IDG ++L+D+TDQ ARF+A+GW   +++GHD  AI S L+ A   DKPT+IAC T IG
Sbjct: 194 ITIDGAVALSDATDQKARFKAAGWAVKAIDGHDTKAIKSALQWATKQDKPTLIACRTKIG 253

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
            G+    G++K HG+ALG  EI ATR  L WD +PF IP+ + K WR  G R  + R  W
Sbjct: 254 RGAATMEGSHKTHGAALGAAEIAATRLGLAWDHEPFVIPEPVEKAWRKVGKRGGKDRKAW 313

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           + RL++  SS   EF R  +  LP+   +A      +    +P  ATR+SS   LE +  
Sbjct: 314 EARLAA--SSQALEFTRAMAGDLPERAFDALNAGIAQLVVDQPAQATRQSSGAALETLFG 371

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            +PE+IGGSADLTGSN T            + GRY+++G+RE  MAAAM G+ALH G+ P
Sbjct: 372 AVPEMIGGSADLTGSNNTFVKGTPIFDAPGYEGRYVNWGIREFGMAAAMTGMALHGGIIP 431

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTFMVFSDYSRPAIR+A+LMG+RVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP+LL
Sbjct: 432 YGGTFMVFSDYSRPAIRMAALMGVRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPNLL 491

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY-ISTPN 558
           V RPAD++E  ECWQ+AL+ K  PS ++LSRQ    +RT    +NL A GAY+   ++  
Sbjct: 492 VFRPADTVEAFECWQLALQHKTTPSAMALSRQKTAAVRTTASDDNLSARGAYELKTASGE 551

Query: 559 AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIA 618
           A+VT+F++G+E+ +A++A   L      TRVVSVPCFELF +Q  +Y+A +IG   +++A
Sbjct: 552 ARVTLFATGTEVPLALKAAATLEGEGTPTRVVSVPCFELFEQQDAAYQASVIGRGTVRVA 611

Query: 619 IEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           +EA ++QGW+ FIG DG+F+GM GFGAS   + LY+ FGI 
Sbjct: 612 VEAAIQQGWERFIGEDGAFVGMTGFGASAPAETLYREFGIT 652


>gi|27376635|ref|NP_768164.1| transketolase [Bradyrhizobium japonicum USDA 110]
 gi|27349776|dbj|BAC46789.1| transketolase [Bradyrhizobium japonicum USDA 110]
          Length = 671

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/657 (56%), Positives = 477/657 (72%), Gaps = 2/657 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ +MA+AIR LSMDA+E   SGHPGLPMG AD+ T LFTQ + FD   P WP+RDRFVL
Sbjct: 15  DHSRMANAIRGLSMDAVEKAKSGHPGLPMGAADIATVLFTQFLKFDAAAPAWPDRDRFVL 74

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML Y+LLYL G  D+T++ +K FR +G  T GHPE     GIE TTGPLGQGI+
Sbjct: 75  SAGHGSMLLYSLLYLTGNADMTLDQLKQFRQLGGLTPGHPENFHTKGIETTTGPLGQGIS 134

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
            AVGMA+AE+ L  EFG  ++DH+T+VL  DG LMEG+SQEAI+ AGH  L+KLIVL+D+
Sbjct: 135 TAVGMALAEKMLAAEFGKKIVDHHTFVLASDGDLMEGVSQEAIAMAGHWKLNKLIVLYDD 194

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGISIDGP S+ADS DQ  RF+++GW    ++GHD  AIT+ + +A+ S+KPT+IAC T 
Sbjct: 195 NGISIDGPTSIADSVDQVKRFKSAGWAAEKIDGHDQAAITAAITRAKKSNKPTLIACRTT 254

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IGFG+P++AGT+KVHG ALG EE+KA ++ L   L+PF +PDD++K WR AG R +  R 
Sbjct: 255 IGFGAPHKAGTSKVHGEALGAEELKAAKENLGISLEPFSVPDDVLKAWRAAGSRGAAARQ 314

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
           +W+ RL  + S  R EFERR     P     A    KK+      + ATRKSSE V+EV+
Sbjct: 315 EWEGRLGELGSRKRAEFERRLRHERPASLAKAVRAYKKELLEKPLVAATRKSSEAVIEVI 374

Query: 378 NDCLP-ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
              +P E + GSADLTGSN  K     A S     GR++HYG+REH MAAAMNGI LH G
Sbjct: 375 AGAMPMEFLAGSADLTGSNNNKAKSATAFSAKTPKGRFIHYGIREHGMAAAMNGIFLHGG 434

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
            AP   TF+VF+DY+RPA+RLA+LMG  V++V+THDSIGLGEDGPTHQPVEHLAALRAIP
Sbjct: 435 FAPNGATFLVFTDYARPAMRLAALMGTGVVYVMTHDSIGLGEDGPTHQPVEHLAALRAIP 494

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-S 555
           ++ V RP DSIE  ECW++AL   + P+VL+L+RQNLP LRT   ++N CA GAY+ + +
Sbjct: 495 NMRVFRPCDSIEVAECWELALNRIDGPTVLALTRQNLPQLRTTAPNDNPCAAGAYELVPA 554

Query: 556 TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
              A+ T+F+SGSE++IAV A + L+ R I +RVVSVP  EL   Q ++ RA+IIG++P+
Sbjct: 555 QGEAKATLFASGSEVEIAVAAQKQLAERGIPSRVVSVPSLELLLAQPEAKRAEIIGNAPV 614

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           K+AIEA +R GWDA IG DG F+GM  FGAS     LY+HFGI A A V+ V +++S
Sbjct: 615 KVAIEAAVRWGWDAVIGQDGEFVGMHSFGASAPAKDLYKHFGITAEAAVNAVLKRVS 671


>gi|294677369|ref|YP_003577984.1| transketolase [Rhodobacter capsulatus SB 1003]
 gi|294476189|gb|ADE85577.1| transketolase-1 [Rhodobacter capsulatus SB 1003]
          Length = 657

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/647 (55%), Positives = 456/647 (70%), Gaps = 10/647 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIR L+MDA+E   SGHPG+PMGMADV T LF + M  DP  P WP+RDRFVLSAG
Sbjct: 11  RMANAIRALAMDAVEQAKSGHPGMPMGMADVATVLFNRFMKIDPAAPKWPDRDRFVLSAG 70

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YAL +LLGY D+ I  +KNFR +G++TAGHPEYG   GIE TTGPLGQGIA AV
Sbjct: 71  HGSMLLYALHHLLGYADMDIAQLKNFRQLGARTAGHPEYGHADGIEMTTGPLGQGIATAV 130

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AER     +GD L+DH+TYV+ GDGCLMEGIS EAI  AGHLGL +LIV WD+N I
Sbjct: 131 GMALAERMKNARYGDDLVDHFTYVIAGDGCLMEGISHEAIDLAGHLGLGRLIVFWDDNRI 190

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG   L+ STDQ ARF ASGW+  S +GH  H I + +  A+   +P+MIAC TVIGF
Sbjct: 191 TIDGDTDLSTSTDQKARFAASGWHVQSCDGHAPHEIAAAIEAAKADPRPSMIACRTVIGF 250

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PN+ G + VHG+ LG EEI A R  L+W   PF IP ++   W     R +  RA+W+
Sbjct: 251 GAPNKQGGHDVHGAPLGAEEIAAARAFLDWPHAPFEIPSELTAAWGRVAARGASARANWE 310

Query: 321 ERLSSMKSSIRKEFERRFSD---ALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            RL +   + R +F +  +D   ALP     A    K +    KP +ATRK+SE+ LEVV
Sbjct: 311 ARLQN--HAARADFIKAEADDTSALP----AAIAAYKARLSADKPKVATRKASEMALEVV 364

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N  LP  +GGSADLTGSN T++  M ++    F+G Y+HYG+REH MAAAMNGIALH GL
Sbjct: 365 NATLPHSVGGSADLTGSNLTRSKGMVSVKPGAFAGNYIHYGIREHGMAAAMNGIALHGGL 424

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTFM F+DY RP+IRL++LMG+ V +V+THDSIGLGEDGPTHQPVEHLA+LRAIP+
Sbjct: 425 RPYGGTFMAFADYCRPSIRLSALMGVPVTYVMTHDSIGLGEDGPTHQPVEHLASLRAIPN 484

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           L V+RPAD++ET E W++A+  K  P++L LSRQNLP LRT + + NL A GAY      
Sbjct: 485 LNVIRPADAVETAEAWEIAMTSKATPNLLVLSRQNLPTLRTTHTAENLTARGAYLLRGPE 544

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
           + QVT+ ++GSE++IA+ A + L+   I   VVS PCFELF  Q   Y  +++G++P ++
Sbjct: 545 DRQVTLIATGSEVEIALAAADQLAKEGIRAAVVSAPCFELFAAQPRDYVTKVLGTAP-RV 603

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
             EA +RQGW   +G   +F+GM GFGAS     LYQHF I A A+V
Sbjct: 604 GCEAAIRQGWCMLLGPTDAFVGMTGFGASAPAPQLYQHFNITAEALV 650


>gi|115524690|ref|YP_781601.1| transketolase [Rhodopseudomonas palustris BisA53]
 gi|115518637|gb|ABJ06621.1| transketolase [Rhodopseudomonas palustris BisA53]
          Length = 674

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/652 (55%), Positives = 458/652 (70%), Gaps = 3/652 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++MA+AIRFL++D +E   SGHPG+PMGMADV T LF++ + FD     WP+RDRFVLSA
Sbjct: 17  REMANAIRFLAIDGVEKAKSGHPGMPMGMADVATVLFSRFLKFDAADTAWPDRDRFVLSA 76

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALLYL G +DVTI+ IK+FR  GSKT GHPEYG   G+E TTGPLGQG+A A
Sbjct: 77  GHGSMLLYALLYLTGTEDVTIDQIKSFRQWGSKTPGHPEYGHTKGVETTTGPLGQGLATA 136

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+AER + + FGD ++DH+TYV+ GDGCLMEGIS EAIS AGHL L++LIVLWD+N 
Sbjct: 137 VGMALAERLMNDRFGDDIVDHHTYVIAGDGCLMEGISHEAISLAGHLKLNRLIVLWDDNH 196

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ISIDG  SL+ S DQ  RF ASGW T  V+GHD  A+ + + +A+ SD+P++IAC T IG
Sbjct: 197 ISIDGDTSLSCSDDQLVRFGASGWATTRVDGHDAEAVAAAIAEAKNSDRPSLIACRTTIG 256

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
           FGSPNRAG+ KVHG+ LG EE++ TR ALNW   PF IP  I+ +WR  G         W
Sbjct: 257 FGSPNRAGSEKVHGAPLGAEEVEKTRVALNWPHAPFEIPQVILDQWRAIGRSGKAAHDAW 316

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
            +RL ++ ++ R  FE   +  L   +D A   L +KF   KP IATR +S+L ++ +  
Sbjct: 317 TKRLGALDAAKRAAFEDALAGKLSAGYDAALKGLLEKFATEKPNIATRAASQLTIDALVP 376

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
             P L+GGSADLT SN T      ++  + F G Y+HYG+RE  MAAAMNGIA+H G  P
Sbjct: 377 ASPNLLGGSADLTHSNLTHAKGTTSVKPNGFGGSYIHYGIREFGMAAAMNGIAVHGGFIP 436

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTF+VF DY+RPAIRLA+LMG+RVIHVLTHDSIGLGEDGPTHQPVEH+A+LRAIP+LL
Sbjct: 437 YGGTFLVFCDYNRPAIRLAALMGVRVIHVLTHDSIGLGEDGPTHQPVEHVASLRAIPNLL 496

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLR--TQYESNNLCALGAYDYISTP 557
           V RPAD+IET   W  ALK+ +RPS L+LSRQNLP L       ++N    GAY  +   
Sbjct: 497 VFRPADAIETALAWDTALKQTSRPSALALSRQNLPALPRGDGAATDNPVVRGAYVVVDPG 556

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
              VT+ ++GSE+ IA++A + L    I   VVS PCFELF EQ  +YR  ++GS+P +I
Sbjct: 557 KRDVTLMATGSEVSIALDAAKALGEAGIKAAVVSAPCFELFAEQDQAYRDAVLGSAP-RI 615

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
            IEA +   W  +IG  G FIGM  FGAS   ++LY+ FGI A A+V    R
Sbjct: 616 GIEAAIASDWYRWIGDTGEFIGMTSFGASAPANVLYREFGITADAVVQAAHR 667


>gi|114763385|ref|ZP_01442792.1| transketolase [Pelagibaca bermudensis HTCC2601]
 gi|114543923|gb|EAU46934.1| transketolase [Roseovarius sp. HTCC2601]
          Length = 661

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/647 (54%), Positives = 454/647 (70%), Gaps = 3/647 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR L+MDA++  NSGHPG PMGMADV T LF + M  DP+   WP+RDRFV+SAGH
Sbjct: 15  MANAIRALAMDAVQAANSGHPGAPMGMADVATVLFNRFMTVDPRDHSWPDRDRFVMSAGH 74

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YA+ +LLGY D+ IE +K FR +GS+TAGHPEYG   GIE TTGPLGQGI+ AVG
Sbjct: 75  GSMLVYAINHLLGYDDMPIEQLKRFRQLGSRTAGHPEYGHAKGIETTTGPLGQGISTAVG 134

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER +   FG  L+DH+TYV+ GDGCLMEGIS EAI  AGHL LS+LIVLWD+NGI+
Sbjct: 135 MALAERMMNARFGSDLVDHFTYVIAGDGCLMEGISHEAIDLAGHLTLSRLIVLWDDNGIT 194

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG   L+ STDQ ARF A+GW+ +SV+GHD  A+ + +  A+   +P+MIAC+T+IG+G
Sbjct: 195 IDGGTDLSTSTDQTARFAAAGWHVVSVDGHDKEAVAAAIETARSDPRPSMIACKTIIGYG 254

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +P   G++ VHGS LG +EI ATR+AL W   PF IP ++   WR    R + +RA W  
Sbjct: 255 APTMQGSHSVHGSPLGPDEIAATREALGWPHAPFEIPAEVRDGWRAVAARGASSRAAWSR 314

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           RL    S     F      A     + A    K +     P +ATRK+SE+ LEVVN  L
Sbjct: 315 RL--FDSPNADAFRAAHGPADKAALEAAICAYKHRLSSDAPKLATRKASEMALEVVNGTL 372

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           P  +GGSADLTGSN T+T     +   D++G Y+HYG+REH MAAAMNG+ALH GL PY 
Sbjct: 373 PNTVGGSADLTGSNNTRTKGQGPVKPGDYAGSYIHYGIREHGMAAAMNGLALHGGLKPYG 432

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           GTF+ F+DY RPA+RL+SLMG+ V++V+THDSIGLGEDGPTHQPVE +A+LRA+P+ LV 
Sbjct: 433 GTFLAFADYCRPAMRLSSLMGVPVVYVMTHDSIGLGEDGPTHQPVETIASLRAMPNHLVF 492

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQV 561
           RPAD++ET E WQ+A+ E  RPS L+LSRQ LP +RT++   NL A GAY         V
Sbjct: 493 RPADAVETAEAWQIAMTETRRPSTLALSRQGLPTVRTRHTDANLTASGAYVLRDPGKRDV 552

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
           T+ ++GSE++IA++A ++L +  I   V+S PCFELF E     RA ++G +P +I IEA
Sbjct: 553 TLIATGSEVEIALDAADLLEAEGIRAAVISAPCFELFAEARPETRAAVLGEAP-RIGIEA 611

Query: 622 GLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
            +RQGWD  +  +  F+GM GFGAS     LY+HFGI A A+  + +
Sbjct: 612 AIRQGWDLMLRPEDGFVGMTGFGASAPASELYRHFGITAEAVAGLAK 658


>gi|298290439|ref|YP_003692378.1| transketolase [Starkeya novella DSM 506]
 gi|296926950|gb|ADH87759.1| transketolase [Starkeya novella DSM 506]
          Length = 674

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/648 (54%), Positives = 458/648 (70%), Gaps = 6/648 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +  MA+A+R L+MDA+E   SGHPG+PMGMADV TALF++ +  DP  P W +RDR VLS
Sbjct: 21  HDDMANALRALAMDAVEQAKSGHPGMPMGMADVATALFSRFVKIDPTRPDWYDRDRVVLS 80

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML YA+ +LLGY D+  + ++ FR +G+ TAGHPE+G   G+E TTGPLGQG+A 
Sbjct: 81  AGHGSMLLYAVNHLLGYADMGTDQLRRFRQLGAVTAGHPEHGHTLGVETTTGPLGQGLAT 140

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           AVGMA+AER L   FGD L+DHYTYV+ GDGCLMEGIS EAI  AGHL L KLI+LWD+N
Sbjct: 141 AVGMALAERMLNARFGDDLVDHYTYVIAGDGCLMEGISHEAIDLAGHLKLGKLILLWDDN 200

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
           GISIDG  +L+ STDQ ARF A+GW+ + V+GH +HA+T  + +A+ +++PT+IAC T I
Sbjct: 201 GISIDGRTTLSTSTDQLARFEAAGWDVMRVDGHAYHAVTDAIAEARGTERPTLIACRTTI 260

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFG+P +AGT   HG+ LG +EI   R  L W   PF +PDD+ + W     R    R  
Sbjct: 261 GFGAPTKAGTEGAHGAPLGPDEIAGARARLGWSHPPFEVPDDVREAWAHTAARGRTAREA 320

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W+ RLS   S  R  FE      LP  FD      K++   S P +ATRK+SE+ L V+N
Sbjct: 321 WERRLSG--SGRRAAFEAAMEGELPADFDEKLDAYKRELSQSAPKVATRKASEMALGVIN 378

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
                 +GGSADLT SN T T  +  ++  +F+GRYLHYG+REHAMAA MNG+ALH+G  
Sbjct: 379 AETELTVGGSADLTHSNLTYTKGLMPVTPGNFAGRYLHYGIREHAMAAVMNGLALHRGTI 438

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+VFSDY+R A+RL++LMG RV++VLTHDSIGLGEDGPTHQPVEHLA LRA P+L
Sbjct: 439 PYGGTFLVFSDYARGAMRLSALMGQRVVYVLTHDSIGLGEDGPTHQPVEHLAMLRATPNL 498

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN 558
            V RPAD++ETLE WQ+AL  +  PSVL+LSRQNLP  RT +   NL   GAY     P 
Sbjct: 499 HVFRPADAVETLEAWQLALHAERTPSVLALSRQNLPTFRTTHSEENLTGYGAY-VARKPE 557

Query: 559 AQ--VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
            +  VT+ ++GSE+++A +A ++L+ R +   VVS+PC+ELF +QS  YR  ++G++P +
Sbjct: 558 RRRDVTLLATGSEVELAFKAADMLALRGVDAAVVSMPCWELFEKQSADYRRAVLGTAP-R 616

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           +A+EA  R GWD +IG  G F+GM+GFGAS     LY++F I   A+V
Sbjct: 617 VAVEAAARFGWDRWIGERGRFVGMEGFGASAPAADLYRYFNITPEAVV 664


>gi|260427271|ref|ZP_05781250.1| transketolase [Citreicella sp. SE45]
 gi|260421763|gb|EEX15014.1| transketolase [Citreicella sp. SE45]
          Length = 661

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/649 (53%), Positives = 455/649 (70%), Gaps = 3/649 (0%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIR L+MDA++  NSGHPG PMGMADV T LF + M  DP+   W +RDRFV+SAG
Sbjct: 14  QMANAIRALTMDAVQAANSGHPGAPMGMADVATVLFNRFMKLDPKDHRWADRDRFVMSAG 73

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YA+ +LLGY D+ ++ ++ FR +GS+TAGHPEYG   GIE TTGPLGQGI+ AV
Sbjct: 74  HGSMLVYAINHLLGYDDMPMDQLRRFRQLGSRTAGHPEYGHAKGIETTTGPLGQGISTAV 133

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AER +   FGD L+DHYTYV+ GDGCLMEGIS EAI  AGHLGLS+LIVLWD+NGI
Sbjct: 134 GMALAERMMNARFGDDLVDHYTYVIAGDGCLMEGISHEAIDLAGHLGLSRLIVLWDDNGI 193

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG   L+ ST+Q ARF A+GW+  SV+GHD  A+ + L  A+    P++IAC+T+IGF
Sbjct: 194 TIDGGTDLSTSTNQLARFAAAGWHVASVDGHDKSAVAAALETARAEASPSLIACKTIIGF 253

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PN+ G++ VHG+ LG+ EI ATR+ L W   PF IP ++   WR    R +  R+ W 
Sbjct: 254 GAPNKQGSHDVHGAPLGEAEIAATRETLGWTHGPFEIPPEVYDGWRAVAARGADARSAWA 313

Query: 321 ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
            RL+    +    F    +       D A    K +     P +ATRK+SE+ LE+VN  
Sbjct: 314 RRLADSPDAW--TFRAAHAPVDDASLDAAITAYKHRLSSDAPKVATRKTSEMALEIVNGT 371

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
           LP  +GGSADLTGSN TKT     +   D++G Y+HYG+REH MAAAMNGIALH GL PY
Sbjct: 372 LPNTVGGSADLTGSNNTKTRGQAPVKAGDYAGSYIHYGIREHGMAAAMNGIALHGGLKPY 431

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
            GTF+ F+DY RPA+RL+SLMG+ V++V+THDSIGLGEDGPTHQPVE +A+LRA+P+ LV
Sbjct: 432 GGTFLAFADYCRPAMRLSSLMGLPVVYVMTHDSIGLGEDGPTHQPVETIASLRAMPNHLV 491

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQ 560
            RP D++ET E WQ+A+ +  RPS L+LSRQ LP +RT++   NL A GAY         
Sbjct: 492 FRPCDAVETAEAWQIAMTQTARPSTLALSRQGLPTVRTRHTEANLTARGAYVLRDVAQRD 551

Query: 561 VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIE 620
           VT+ ++GSE++IA+ A E L++  I+  VVS PCFELF E +   RA ++G +P +I IE
Sbjct: 552 VTLIATGSEVEIALAASEALAAEGIAVAVVSAPCFELFAEATPEQRAAVLGDAP-RIGIE 610

Query: 621 AGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
           A +RQGWD  +  +  FIGM GFGAS     LY+HFGI A A+  +  +
Sbjct: 611 AAIRQGWDLMLRPEDGFIGMTGFGASAPAPELYRHFGITADAVAALARQ 659


>gi|319783965|ref|YP_004143441.1| transketolase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169853|gb|ADV13391.1| transketolase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 670

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/647 (55%), Positives = 462/647 (71%), Gaps = 7/647 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MA+AIR L+MD+++  NSGHPG+PMGMADV T LF + +  DP  P WP+RDRFVLSA
Sbjct: 19  RDMANAIRALAMDSVQKANSGHPGMPMGMADVATVLFNRFINIDPSRPDWPDRDRFVLSA 78

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YAL +LLGY+D+ +E+++ FR +GS+TAGHPEYG   G+E TTGPLGQGI+ A
Sbjct: 79  GHGSMLQYALHHLLGYEDMQVEELQRFRQLGSRTAGHPEYGHALGVETTTGPLGQGISTA 138

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+AER L   +G  L+DH+TYV+ GDGCL EGIS EAI  AGHL LS+LIV WD+N 
Sbjct: 139 VGMALAERMLAARYGADLVDHHTYVIAGDGCLQEGISHEAIDLAGHLKLSRLIVFWDDNA 198

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ISIDGP SL+ S DQ ARF+A+GW+  SV GHD  A+ + +  A+ SD+P++IAC TVIG
Sbjct: 199 ISIDGPTSLSTSMDQPARFKAAGWDVQSVAGHDMAAVAAAIEAARRSDRPSLIACRTVIG 258

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
            G+PN  G+ K HG+ LG+ EI ATR+ + W   PF +PDDI+  WR    R    R  W
Sbjct: 259 MGAPNLGGSEKTHGAPLGEAEIAATRENIGWAHAPFEVPDDILFAWREIAGRGEAMRRAW 318

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           ++RL++  S  R+ FE   +  L D   +A    +++       +ATRK+SE+ LE +N 
Sbjct: 319 EQRLAA--SPRREAFENAVAAELADTVFDALEAFRREHVEKATKVATRKASEMALEAING 376

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
                +GGSADLT SN T T  M  I+ SD++GRY+HYG+REH MAAAMNGIALH G  P
Sbjct: 377 ATELTVGGSADLTHSNLTITKGMNRIAPSDYAGRYIHYGIREHGMAAAMNGIALHGGFVP 436

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTF+ F+DY+R A+RL++LMG RVI+V+THDSIGLGEDGPTHQPVEHLA LRA P+L 
Sbjct: 437 YGGTFLCFADYARGAMRLSALMGQRVIYVMTHDSIGLGEDGPTHQPVEHLAMLRATPNLN 496

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP-- 557
           V RPAD IET ECW++ALK K+RPSVL LSRQNLP LR  +   N    G Y  +  P  
Sbjct: 497 VFRPADVIETAECWELALKSKDRPSVLVLSRQNLPMLRRSHSDENRSRQGGY-VLREPAE 555

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRN-ISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
           +  VT+ ++GSE++IAV A E L + + ++  VVS+PC+ELF EQ  + R  ++GS+P +
Sbjct: 556 HRAVTLIATGSEVEIAVAAAERLETEHGVAAAVVSMPCWELFEEQESATRKAVLGSAP-R 614

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAI 663
           +A+EA  R GWD +IG  G+F+GM GFGAS     LY+HF I + A+
Sbjct: 615 VAVEAAARLGWDRWIGETGAFVGMTGFGASAPAPDLYRHFNITSEAV 661


>gi|254420074|ref|ZP_05033798.1| transketolase [Brevundimonas sp. BAL3]
 gi|196186251|gb|EDX81227.1| transketolase [Brevundimonas sp. BAL3]
          Length = 663

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/642 (55%), Positives = 462/642 (71%), Gaps = 5/642 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++MA+AIR L+MD +E   SGHPG+PMGMADV T LF++ + FD   P W +RDRF+LSA
Sbjct: 13  QQMANAIRVLAMDGVEQAKSGHPGMPMGMADVATVLFSKFLKFDASRPDWADRDRFILSA 72

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY+  T E++ NFR  GS+TAGHPEYG   G+E TTGPLGQG+A +
Sbjct: 73  GHGSMLIYALLHLTGYKAATKEELSNFRQWGSRTAGHPEYGHMPGVEVTTGPLGQGLATS 132

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VG A+AER L  ++G+ L+DH T+V+ GDGCLMEG+SQEAI+ AG   L+KL VLWD+N 
Sbjct: 133 VGFAMAERHLAAKYGEDLVDHRTWVVAGDGCLMEGVSQEAIALAGRYKLNKLTVLWDDNE 192

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           I+IDG +SL+D+TDQ ARF+A+GW   +++GHD  AI S L+ A   DKPT+IAC+T IG
Sbjct: 193 ITIDGKVSLSDTTDQKARFKAAGWAVKAIDGHDMDAIKSALKWATRQDKPTLIACKTKIG 252

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
            G+    G++K HG+ALG  EI ATR  L WD +PF IP  I   W   G R ++ R  W
Sbjct: 253 KGAATMEGSHKTHGAALGAAEIAATRLGLAWDHEPFDIPQTIADAWAKVGRRGAKDRKKW 312

Query: 320 QERLSSMKSSIRKEFERRFSDALPD-CFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           + RL++  S    +F R     LP+  FD     + +  E ++P  ATR+SS   L+ V 
Sbjct: 313 EARLAA--SGQAADFTRAMKGDLPEGAFDALNAKIAELIE-TQPAQATRQSSGAALDQVF 369

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             +PELIGGSADLTGSN T  +    +    + GRY+++G+RE  MAAAMNG+ALH G+ 
Sbjct: 370 AAIPELIGGSADLTGSNNTFVAGTPILDAPSYEGRYVNWGIREFGMAAAMNGLALHGGVI 429

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTFMVFSDYSRPAIRL +LMG+R IHVLTHDSIGLGEDGPTHQPVEHLAALRAIP+L
Sbjct: 430 PYGGTFMVFSDYSRPAIRLGALMGVRAIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPNL 489

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-STP 557
           LV RPAD++E +ECW++AL+ K  PS ++LSRQ  P +RT   + NL A GAY+   ++ 
Sbjct: 490 LVFRPADTVEAMECWKIALETKTAPSAMALSRQKTPAVRTVAGTENLSAKGAYEIKPASG 549

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
            A+ T+F +G+EL +A++A E L +  + TRVVSVPC ELF +Q  +YRA +IG   I++
Sbjct: 550 EAKATLFGTGTELALALKAAETLEAEGVPTRVVSVPCVELFEQQDAAYRASVIGRGTIRV 609

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           A+EA ++QGW+ FIG DG+FIGM GFGAS   ++LY  FGI 
Sbjct: 610 AVEAAIKQGWEGFIGEDGAFIGMTGFGASAPAEVLYDKFGIT 651


>gi|84684733|ref|ZP_01012633.1| transketolase [Maritimibacter alkaliphilus HTCC2654]
 gi|84667068|gb|EAQ13538.1| transketolase [Rhodobacterales bacterium HTCC2654]
          Length = 676

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/663 (54%), Positives = 459/663 (69%), Gaps = 10/663 (1%)

Query: 14  KYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRD 73
           K+ D + K A A+R L++DA++  NSGHPG+PMGMADV T LF + + FDP  P WP+RD
Sbjct: 12  KHPDHWMKAA-ALRMLAVDAVQAANSGHPGMPMGMADVATVLFEKHLKFDPSRPDWPDRD 70

Query: 74  RFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLG 133
           RFVLSAGHGSML Y LL+L GY D+TI++IKNFR  G+KTAGHPEYG   GIE TTGPLG
Sbjct: 71  RFVLSAGHGSMLIYGLLHLTGYADMTIDEIKNFRQWGAKTAGHPEYGHAKGIETTTGPLG 130

Query: 134 QGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIV 193
           QG++ AVGMA+AE  LR  FG  + DHYTYV+ GDGCLMEGISQEAI  AG   LSKLIV
Sbjct: 131 QGLSTAVGMAMAEEMLRARFGRKVQDHYTYVIAGDGCLMEGISQEAIGLAGRQKLSKLIV 190

Query: 194 LWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIA 253
           LWDNN ISIDG IS++D TDQ  RF+ASGW  L+ +GHD   I   L +A+ S KPT+I 
Sbjct: 191 LWDNNNISIDGEISMSDITDQKGRFKASGWQVLACDGHDPEDIDRALTEAKKSKKPTLID 250

Query: 254 CETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSS 313
           C+T IGFGS ++  + K HGS LG EEI   R    W    F IP+D+  +W+  G R +
Sbjct: 251 CKTHIGFGS-SKQDSAKAHGSPLGDEEIAKLRDTYGWPHAAFVIPNDVADQWKAIGERGA 309

Query: 314 QTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
             R DW+ R++ +    +KE  R F+   P         LKK+     P +ATRKSSE+V
Sbjct: 310 ADRRDWEGRVAELSEQRQKEIARVFALEAPKKLSARIKALKKQISEEAPKVATRKSSEMV 369

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           LEVVN  +PE IGGSADLTGSN T T+ +    + +  GRY+HYG+REH MAAAMNG+ L
Sbjct: 370 LEVVNPIMPENIGGSADLTGSNNTLTADLGIFDEKNRKGRYVHYGIREHGMAAAMNGLVL 429

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H G+ PY GTFM F+DY+R AIRL+SLMGI V +V+THDSIGLGEDGPTHQPVEHLA  R
Sbjct: 430 HGGIRPYGGTFMAFTDYARGAIRLSSLMGIPVTYVMTHDSIGLGEDGPTHQPVEHLAIWR 489

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY 553
           A P+    RP D++ET E W++AL  +N PS ++LSRQ LP LRT+++++NL A GAY  
Sbjct: 490 ATPNTWTFRPCDTVETAEAWELALTSQNTPSCMALSRQGLPTLRTEHKNSNLTAKGAYVL 549

Query: 554 ISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
                  Q  + ++GSE++IA++A ++L    I TRVVSVPC ELF  Q +SYR +++ +
Sbjct: 550 AEAEGKRQAILMATGSEVEIAMKARDLLQEAGIGTRVVSVPCMELFAAQDESYRRKVLPA 609

Query: 613 SPIKIAIEAGLRQ-GWDAF-IGSDG-----SFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
            P+++ IEA LR  GWD + +G  G     +F+GM+GFGAS     +Y   GI A  +V+
Sbjct: 610 GPVRVGIEAALRDCGWDRWLLGERGRENRQAFVGMEGFGASAPAPTIYSEMGITAENVVE 669

Query: 666 MVE 668
            V+
Sbjct: 670 KVK 672


>gi|27377694|ref|NP_769223.1| transketolase [Bradyrhizobium japonicum USDA 110]
 gi|24559824|gb|AAN61146.1| CbbT [Bradyrhizobium japonicum]
 gi|27350839|dbj|BAC47848.1| transketolase [Bradyrhizobium japonicum USDA 110]
          Length = 672

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/642 (55%), Positives = 455/642 (70%), Gaps = 3/642 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +  +A+A+RFL++DAIE   SGHPGLPMGMADV T LF++ + FD   P WP+RDRFVLS
Sbjct: 16  HNDLANAVRFLAVDAIETSQSGHPGLPMGMADVATVLFSRFLKFDSAHPSWPDRDRFVLS 75

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML YALL+L G   V+++DIK FR  GSKT GHPEYG   G+E TTGPLGQGIA 
Sbjct: 76  AGHGSMLLYALLHLTGGA-VSLDDIKAFRQWGSKTPGHPEYGHTPGVETTTGPLGQGIAT 134

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           AVGMA+AER     +GD L+DH+TYV+ GDGCLMEGISQEAIS AGHL L +LIVL+D+N
Sbjct: 135 AVGMALAERMANARYGDGLVDHFTYVIAGDGCLMEGISQEAISLAGHLRLGRLIVLFDDN 194

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
           GISIDGP SLA S DQ ARF ASGW+   V+GHD  A+   + + + + KP++IAC TVI
Sbjct: 195 GISIDGPTSLATSDDQLARFAASGWSVRRVDGHDPEAVAQAIAEERETAKPSLIACRTVI 254

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           G+G+P+R GT K HG+ LG E+  A R+ L WD  PF +P  I+K WR+ G R    R  
Sbjct: 255 GYGAPDRQGTEKAHGAPLGTEQTAAARRTLGWDYQPFVVPIPILKAWRMIGQRGQVERLA 314

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W +R  S     R  F      ALP  +  A   L+++F   +P +ATR++S+ VL+ + 
Sbjct: 315 WLDRYESATPEQRDLFVEGKVVALPAAYALAAAKLRERFASERPKLATRQASQQVLDGIA 374

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             +P L+GGSADLT SN T       +++  F+G Y+HYG+REH MAAAMNG+ALH G  
Sbjct: 375 GTIPGLVGGSADLTHSNLTHAKPQTPVTRGAFAGDYIHYGIREHGMAAAMNGLALHGGFI 434

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+ FSDYSRPAIRLA+LM +RVIHV+THDSIGLGEDGPTHQPVEHLAALR IP+L
Sbjct: 435 PYGGTFLAFSDYSRPAIRLAALMRLRVIHVMTHDSIGLGEDGPTHQPVEHLAALRVIPNL 494

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN 558
           LV RPAD++ETLE W  AL  ++RPSVL LSRQ LP  R+     N  A GAY  +S   
Sbjct: 495 LVFRPADAVETLEAWDCALAAEHRPSVLCLSRQALPTFRSDARGRNRVARGAYLVVSPDG 554

Query: 559 AQ-VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
            + VT+ ++GSE+ IA+EA  +L++ +I   VVS PC  LF EQ + YRA ++G++P ++
Sbjct: 555 GRDVTLMATGSEVSIALEAARLLATEHIRAAVVSAPCLALFEEQPEDYRATVLGTAP-RV 613

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
            IEA +   W  +IG+DG F+GM+GFGAS    +LY+ FGI 
Sbjct: 614 GIEAAVLGDWPRWIGADGEFVGMRGFGASAPAPVLYREFGIT 655


>gi|330820724|ref|YP_004349586.1| Transketolase [Burkholderia gladioli BSR3]
 gi|327372719|gb|AEA64074.1| Transketolase [Burkholderia gladioli BSR3]
          Length = 690

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/661 (54%), Positives = 458/661 (69%), Gaps = 3/661 (0%)

Query: 16  DDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRF 75
           D   +++A+ IRFLSMDA+++ NSGHPG P+GMAD+ T LF   + FD   P+W +RDRF
Sbjct: 22  DPHLRELANCIRFLSMDAVQHANSGHPGAPLGMADIATVLFRDFLRFDAADPHWIDRDRF 81

Query: 76  VLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQG 135
           +LS GH SML Y+LLYL GYQD+TIE ++NFR +GSKTAGHPEY    GIE TTGPLGQG
Sbjct: 82  ILSNGHASMLLYSLLYLTGYQDMTIEQLQNFRQVGSKTAGHPEYRHANGIELTTGPLGQG 141

Query: 136 IANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLW 195
           IA +VGMA+AER L  +FGD L+DHYTYV +GDGCLMEGISQEAIS AGHL L +LI  W
Sbjct: 142 IAESVGMALAERILNAKFGDELVDHYTYVFLGDGCLMEGISQEAISLAGHLKLGRLIAFW 201

Query: 196 DNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSD-KPTMIAC 254
           D+N ISIDGP  LA S  +  RFRASGW  L ++GHD  AI   +  A+ SD +PT+IAC
Sbjct: 202 DDNSISIDGPTRLAVSDQEIERFRASGWRVLEIDGHDTDAIHEAIATARASDEQPTLIAC 261

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
            T+IGFG P RAGT K H  A G+EEI   R+ L W   PF IP+ ++++WR  G R  +
Sbjct: 262 RTIIGFGLPTRAGTQKAHSDAPGEEEIAGARERLGWHSPPFEIPEALLREWREIGARGRE 321

Query: 315 TRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
            R  W ER+     ++R+EFERR    LP  +  A    ++ F  S   +ATRK+S  VL
Sbjct: 322 ARMAWAERVEQAPDALRREFERRNDGKLPADWKQAIAEARRAFVDSGDKMATRKASGAVL 381

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           + +   +PEL+GGSADLT SN TK  Q   I+   + G Y+HYGVREH MAAAMNGIALH
Sbjct: 382 DRLFAAIPELLGGSADLTPSNNTKAKQQVEIAPGRYDGAYIHYGVREHGMAAAMNGIALH 441

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            GL PY GTF+ FSDY RPAIRLA++M IR I V+THDSIGLGEDGPTHQPVEHLAALRA
Sbjct: 442 GGLIPYGGTFLCFSDYCRPAIRLAAMMRIRTIFVMTHDSIGLGEDGPTHQPVEHLAALRA 501

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI 554
           IP L V RPAD++ET ECW++ L++  R ++L+LSRQ LP LR      N  A GAY   
Sbjct: 502 IPRLGVYRPADAVETAECWELILEQPRRAALLALSRQPLPLLRRDAAGENRSARGAYVLH 561

Query: 555 STPNA--QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
                  ++T+ S+GSEL++AV+A E L ++ + T VVS+PC  LF EQ  +YR  ++G 
Sbjct: 562 EAEGGPRRLTLLSTGSELQLAVKARETLQAQGVPTAVVSMPCRLLFEEQDAAYRRAVLGD 621

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           SP ++A+EA +  GW+ ++G +G F+GM  FG SG  + +Y+ FGI A A+V      L 
Sbjct: 622 SPARVAVEAAVELGWERYLGPEGRFVGMHDFGESGKYEAVYRKFGITAEAVVQAAREVLE 681

Query: 673 V 673
            
Sbjct: 682 A 682


>gi|150376069|ref|YP_001312665.1| transketolase [Sinorhizobium medicae WSM419]
 gi|160112946|sp|P56900|TKT_SINMW RecName: Full=Transketolase; Short=TK
 gi|150030616|gb|ABR62732.1| transketolase [Sinorhizobium medicae WSM419]
          Length = 695

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/651 (55%), Positives = 457/651 (70%), Gaps = 13/651 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MADAIRFLSMDA+E  NSGHPG+PMGMAD VT LF + +  DP  P WP+RDRFVLSA
Sbjct: 16  RNMADAIRFLSMDAVEKANSGHPGMPMGMADAVTVLFNRFIRIDPSLPDWPDRDRFVLSA 75

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+L +L+G+ D+ + ++ +FR +GSKTAGHPEYG   GIE TTGPLGQGI+ A
Sbjct: 76  GHGSMLLYSLHHLIGFADMPMAELSSFRQLGSKTAGHPEYGHALGIETTTGPLGQGISTA 135

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+AE+ +   FG  L +H+TYV+ GDGCL EGIS EAI  AGHL L KL+VLWD+N 
Sbjct: 136 VGMAMAEQMMASRFGSALCNHFTYVVAGDGCLQEGISHEAIDLAGHLKLRKLVVLWDDNR 195

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ISIDG   L+ S +Q ARFRA+ W+  +V+GHD  A+   L +A+ + KP++IAC T IG
Sbjct: 196 ISIDGSTDLSTSMNQLARFRAASWDAQAVDGHDPEAVAKALERARRTRKPSLIACRTRIG 255

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
            G+ +  G++K HG+ALG +EI ATR+ L W   PFF+P +I   W     R    R  W
Sbjct: 256 KGAASMEGSHKTHGAALGDKEIAATREKLGWPHPPFFVPPEIRAAWAKVAARGRTAREAW 315

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSK----PMIATRKSSELVLE 375
             RL + +S      ++R+   +   FD    +L  KF  +       +ATR++S++ LE
Sbjct: 316 DIRLDASRS------KKRYEQTIRRQFDGELGDLLAKFRSAHRTRATKVATRQASQMALE 369

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
           V+N      IGGSADLTGSN T TSQ + IS  +F GRYLHYG+REH MAAAMNGIALH 
Sbjct: 370 VINGATALTIGGSADLTGSNLTMTSQTQPISPGNFKGRYLHYGIREHGMAAAMNGIALHG 429

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
           G  PY GTF+VFSDY+R A+RL++LMG+ VI+VLTHDSIGLGEDGPTHQPVEHLA LRA 
Sbjct: 430 GFIPYGGTFLVFSDYARGAMRLSALMGLPVIYVLTHDSIGLGEDGPTHQPVEHLAMLRAT 489

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI- 554
           P+L V RPAD IET ECW++AL EKN PSVL+LSRQ LP LR    + N  ALGAY    
Sbjct: 490 PNLNVFRPADIIETAECWEIALGEKNTPSVLALSRQALPMLRRTEGNENQSALGAYVLRE 549

Query: 555 STPNAQVTIFSSGSELKIAVEACEILSSRN-ISTRVVSVPCFELFFEQSDSYRAQIIGSS 613
           +  N  +TI ++GSE++IAV A E L +   I+  VVS+PC+E F  Q  +YR +++G +
Sbjct: 550 ARGNRDITILATGSEVEIAVAAAERLQAEEGIAAAVVSMPCWEKFEVQDLAYRRKVLGDA 609

Query: 614 PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           P +IAIEA  R GWD ++G DG+F+GM GFGAS     LY+HFGI A  +V
Sbjct: 610 P-RIAIEAAGRLGWDRWMGPDGAFVGMTGFGASAPAGDLYRHFGITADHVV 659


>gi|149204055|ref|ZP_01881023.1| transketolase [Roseovarius sp. TM1035]
 gi|149142497|gb|EDM30542.1| transketolase [Roseovarius sp. TM1035]
          Length = 671

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/669 (52%), Positives = 462/669 (69%), Gaps = 8/669 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + D+ K A AIR L++DA+   NSGH G+PMGMADV T L+ + + FDP  P W
Sbjct: 4   AALRSANPDHWKKATAIRALTLDAVAAANSGHSGMPMGMADVATVLYEKHLKFDPTNPNW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
           P+RDRF+LSAGHGSML Y+LL+L GY D+T+++I+NFR  G+KTAGHPEYG   GIE TT
Sbjct: 64  PDRDRFILSAGHGSMLLYSLLHLTGYADMTLDEIRNFRQWGAKTAGHPEYGHATGIETTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGI+NAVG A+AE  LR  FG  L+DHYTYV+ GDGCLMEG+SQEAI  AG   LS
Sbjct: 124 GPLGQGISNAVGFAMAEEMLRARFGAKLMDHYTYVIAGDGCLMEGVSQEAIGLAGRHQLS 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           +LIVLWDNN I+IDG + LAD TDQ ARFRASGW+ L ++GHD  AI + L +A+ + +P
Sbjct: 184 RLIVLWDNNNITIDGTVDLADRTDQVARFRASGWHVLEIDGHDPAAIDAALTEAKTTAEP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           TMIAC+T I  G   +  T+K HG+    +++ A ++A  W   PF IP D+   W   G
Sbjct: 244 TMIACKTHIALGHAAQ-DTSKGHGALTNPDQLAAAKEAYGWPYGPFEIPSDVKSAWEAIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R + T A W +RL+    + + E  R F+  +P         LKK+     P +ATR+S
Sbjct: 303 HRGATTYAAWAKRLADTSPARQAEIARIFNRDMPMKLGARIRALKKQISAEAPKVATRQS 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE+VLEVVN  L E +GGSADL+GSN T++  M      +  GRY+H+G+REH MAAAMN
Sbjct: 363 SEMVLEVVNPILQETVGGSADLSGSNNTRSGDMSVFDVDNRKGRYIHWGIREHGMAAAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G+ PY GTFM F+DY+RPA+RLA+LM I  + V+THDSIGLGEDGPTHQPVEHL
Sbjct: 423 GMALHGGIRPYGGTFMCFTDYARPAMRLAALMKIPTVFVMTHDSIGLGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  RA P+  V RP D++ET E W++AL  K  PSVLSL+RQ LP LR ++++ NL A G
Sbjct: 483 AISRATPNTWVFRPCDTVETAEAWELALTSKETPSVLSLTRQGLPTLRREHKAKNLTAQG 542

Query: 550 AYDYI-STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           AY    +T   Q  + ++GSE++IA++A ++L +  I TRVVS+PC+ELF EQ DSYR +
Sbjct: 543 AYVLADATGKRQAILMATGSEVEIAMKARDLLEAEGIGTRVVSMPCWELFEEQDDSYRRR 602

Query: 609 IIGSSPIKIAIEAGLRQGWDAFIGSD------GSFIGMQGFGASGSCDLLYQHFGINAIA 662
           ++ + P+++A+EA +R GWD ++  +      G F+GM  FGAS     LY+ FGI A A
Sbjct: 603 VLPAGPVRVAVEAAIRFGWDRWLYGERGRREKGGFVGMHDFGASAPAPTLYKEFGITAEA 662

Query: 663 IVDMVERKL 671
           + D V+  L
Sbjct: 663 VADKVKSLL 671


>gi|294677668|ref|YP_003578283.1| transketolase [Rhodobacter capsulatus SB 1003]
 gi|7388291|sp|Q52723|TKT_RHOCA RecName: Full=Transketolase; Short=TK
 gi|3128258|gb|AAC16110.1| transketolase [Rhodobacter capsulatus SB 1003]
 gi|294476488|gb|ADE85876.1| transketolase-2 [Rhodobacter capsulatus SB 1003]
          Length = 672

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/661 (52%), Positives = 459/661 (69%), Gaps = 7/661 (1%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ K+A AIR L++DA++  NSGHPG+PMGMADV T LF   + FD + P W +RDRFVL
Sbjct: 12  DHWKLATAIRVLAIDAVQAANSGHPGMPMGMADVATVLFRNHLKFDAKAPNWADRDRFVL 71

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALL+L GY+  T++++KNFR  G++ AGHPEYG   G+E TTGPLGQGI+
Sbjct: 72  SAGHGSMLLYALLHLTGYEQATLDEVKNFRQWGARMAGHPEYGHLEGVETTTGPLGQGIS 131

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
            AVGMAIAE+ +   FG  L+DH  +V+ GDGCLMEGISQEAI  AG   L  LIVLWDN
Sbjct: 132 TAVGMAIAEKSMAARFGKKLVDHKIWVIAGDGCLMEGISQEAIGLAGKQELDNLIVLWDN 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           N I+IDG ++++D TDQ ARF ASGW+ LS +GHD   I   L  A+ + +P ++ C+T+
Sbjct: 192 NNITIDGRVTVSDVTDQKARFAASGWDVLSCDGHDAEDIDRALTAAKKAKRPVLVDCKTL 251

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IGFGSPN+A +  VHG+ LG  EIK TR+A  W+  PF IP +I  +W   G + +  RA
Sbjct: 252 IGFGSPNKADSYAVHGAPLGDAEIKLTREAYGWEHGPFVIPAEIKAEWEAIGAKGAAERA 311

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
           +W+ RL+++ +  R EFER+ +  +      A    KK    + P +ATRK+SE+VL  V
Sbjct: 312 EWEARLAALPAGKRAEFERQMARGVAPKLAGAIRAFKKAQSEAAPKVATRKASEMVLAAV 371

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N  +PE IGGSADLTGSN TKTS ++     +  GRY+ YG+REHAMAAAMNG+ LH G+
Sbjct: 372 NPVVPETIGGSADLTGSNLTKTSDIEDFMPGNHKGRYMRYGIREHAMAAAMNGMWLHGGV 431

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTF  F+DY+R A+RL+SLMG+  ++V+THDSIGLGEDGPTHQPVEHLA  RA P+
Sbjct: 432 RPYGGTFFCFTDYARGAMRLSSLMGVPTVYVMTHDSIGLGEDGPTHQPVEHLAICRATPN 491

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
               RPAD IET E W++AL  +  PSVL+LSRQNLP LRT++E+ NL A GAY      
Sbjct: 492 TWTFRPADVIETAEAWELALSSERTPSVLALSRQNLPTLRTKHEAKNLTAKGAYVIAEAE 551

Query: 558 NA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
              Q  + ++GSE++IA++A  +L +  I TRVVS+PC ELF  Q ++YR +I+ +  ++
Sbjct: 552 GKRQAILMATGSEVEIALKARALLQAEAIGTRVVSMPCMELFAAQDEAYRKRILPAGGVR 611

Query: 617 IAIEAGLRQGWDAF-IGSDG-----SFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERK 670
           +A+EA +RQ WD + +G  G      F+GM+GFGAS   + LY  FGI   AI   V+  
Sbjct: 612 VAVEAAIRQPWDRWLLGERGMERKAGFVGMEGFGASAPAERLYAEFGITPEAIAAKVKSL 671

Query: 671 L 671
           L
Sbjct: 672 L 672


>gi|85705316|ref|ZP_01036415.1| transketolase [Roseovarius sp. 217]
 gi|85670189|gb|EAQ25051.1| transketolase [Roseovarius sp. 217]
          Length = 671

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/669 (52%), Positives = 459/669 (68%), Gaps = 8/669 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + D+ K A AIR L++DA+   NSGH G+PMGMADV T LF + + FDP  P W
Sbjct: 4   AALRSANPDHWKKATAIRALTLDAVAAANSGHSGMPMGMADVATVLFEKHLKFDPSNPNW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
           P+RDRF+LSAGHGSML Y+LL+L GY D+T++ I+NFR  G+KTAGHPEYG   GIE TT
Sbjct: 64  PDRDRFILSAGHGSMLLYSLLHLTGYADMTLDQIRNFRQWGAKTAGHPEYGHATGIETTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGI NAVG A+AE  LR  FG  L+DHYTYV+ GDGCLMEGIS EAI  AG   LS
Sbjct: 124 GPLGQGITNAVGFAMAEEMLRARFGTKLMDHYTYVIAGDGCLMEGISHEAIGLAGRHQLS 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           +L+VLWDNN I+IDG + LAD TDQ ARFRASGW+ L ++GHD  AI + L +A+ +D+P
Sbjct: 184 RLVVLWDNNNITIDGTVDLADRTDQVARFRASGWHVLEIDGHDPVAIDAALTEAKTTDQP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           TMIAC+T I  G   +  T+K HG+    E++ A + A  W   PF IP D+   W   G
Sbjct: 244 TMIACKTHIALGHAAQ-DTSKGHGALTNPEQLTAAKDAYGWANGPFEIPADVKSAWEEIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R + T A W +RLS+   + + E  R F+  +P         LKK+     P +ATR+S
Sbjct: 303 KRGASTYAAWAKRLSATSPARQAEIARIFNRDMPTKLSARIRALKKQISAEAPKVATRQS 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE+VLEVVN  L E +GGSADL+GSN T++  M      + +GRY+H+G+REH MAAAMN
Sbjct: 363 SEMVLEVVNPILQETVGGSADLSGSNNTRSGDMTVFDVDNRAGRYIHWGIREHGMAAAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ LH G+ PY GTFM F+DY+RPA+RLA+LM I  + V+THDSIGLGEDGPTHQPVEHL
Sbjct: 423 GMVLHGGIRPYGGTFMCFTDYARPAMRLAALMKIPTVFVMTHDSIGLGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  RA P+  V RP D++ET E W++AL  K  PSVLSL+RQ+LP LR ++++ NL A G
Sbjct: 483 AISRATPNTWVFRPCDTVETAEAWELALTSKETPSVLSLTRQSLPTLRREHKAKNLTAQG 542

Query: 550 AYDYI-STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           AY    S    Q  + ++GSE++IA++A ++L +  I TRVVS+PC+ELF EQ DSYR +
Sbjct: 543 AYVLADSEGKRQAILMATGSEVEIAMKARDLLQAEGIGTRVVSMPCWELFEEQEDSYRKR 602

Query: 609 IIGSSPIKIAIEAGLRQGWDAFIGSD------GSFIGMQGFGASGSCDLLYQHFGINAIA 662
           ++ + P+++A+EA +R GWD ++  +      G F+GM  FGAS     LY+ FGI   A
Sbjct: 603 VLPAGPVRVAVEAAIRFGWDRWLYGERGRREKGGFVGMHDFGASAPAPTLYKEFGITPEA 662

Query: 663 IVDMVERKL 671
           + D V+  L
Sbjct: 663 VADKVKSLL 671


>gi|323138369|ref|ZP_08073439.1| transketolase [Methylocystis sp. ATCC 49242]
 gi|322396316|gb|EFX98847.1| transketolase [Methylocystis sp. ATCC 49242]
          Length = 664

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/650 (55%), Positives = 452/650 (69%), Gaps = 7/650 (1%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           + ++ A+AIR L+MDA+E   SGHPG+PMGMADV T LF + M FD   P WP+RDRFVL
Sbjct: 12  ETRRCANAIRALAMDAVEKAKSGHPGMPMGMADVATVLFQRFMKFDASQPDWPDRDRFVL 71

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YAL YLLGY  +T  D++NFR  G+ TAGHPEYG   G+E TTGPLGQG+A
Sbjct: 72  SAGHGSMLLYALHYLLGYPGMTKADLENFRQFGAPTAGHPEYGHAPGVETTTGPLGQGLA 131

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
            AVGMAIAER     FGD L+DH+TYV+ GDGCLMEG+S EAI  AGHL LS+LIVLWD+
Sbjct: 132 TAVGMAIAERLAAARFGDELVDHHTYVIAGDGCLMEGLSHEAIDLAGHLKLSRLIVLWDD 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           N ISIDGP SLA S DQ ARF A+GW+T  V+GHD  A+   +  A+   +P+MIAC T+
Sbjct: 192 NSISIDGPTSLATSMDQLARFAAAGWSTARVDGHDPEAVARAIEAARADPRPSMIACRTL 251

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IG+GSP + G    HG+ LG  EI A R+AL W   PF +P+++M  WR AG R +  R 
Sbjct: 252 IGYGSPGKQGKESSHGAPLGAGEITAAREALEWPHVPFDVPEEVMSLWRAAGGRGASARK 311

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            W+ R ++  S+    FE                  +      KP +ATRKSSE+ L V+
Sbjct: 312 AWEARRAA--SAKGDAFESFLKGDAAVEVAAPLAAFRSSLATEKPKVATRKSSEMTLGVI 369

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           ND     IGGSADLT SN T T  M  ++  DFSGRY+HYGVRE  MAAAMNGIALH G 
Sbjct: 370 NDATQATIGGSADLTHSNFTITKGMGEVAPDDFSGRYIHYGVREFGMAAAMNGIALHGGF 429

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTF+VFSDY+R AIRL++LMG+RVI+VLTHDSIGLGEDGPTHQPVEHLA+LRA+P+
Sbjct: 430 VPYGGTFLVFSDYARGAIRLSALMGLRVIYVLTHDSIGLGEDGPTHQPVEHLASLRAMPN 489

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           L V RPAD+IET ECW++AL  ++ PSVLSLSRQNLP L    +  NL A GAY  +  P
Sbjct: 490 LHVFRPADAIETAECWELALGARHTPSVLSLSRQNLPTLDRPVD-ENLSAKGAY-VLREP 547

Query: 558 NA--QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
                VTI ++GSE++IA+   + L+ + +   VVS+PC+ELF  Q   YRA+++G++P 
Sbjct: 548 AGGRDVTILATGSEVEIALAGADALAGQGVKAAVVSMPCWELFEAQPADYRARVLGAAP- 606

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
           ++ +EA +R GWD ++G    FIGM GFGAS     LY+ FGI A A+ D
Sbjct: 607 RVGVEAAVRLGWDRWLGERSMFIGMSGFGASAPAAELYKRFGITAEAVAD 656


>gi|307300207|ref|ZP_07579992.1| transketolase [Sinorhizobium meliloti BL225C]
 gi|306905096|gb|EFN35679.1| transketolase [Sinorhizobium meliloti BL225C]
          Length = 694

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/647 (54%), Positives = 457/647 (70%), Gaps = 5/647 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MADAIRFLSMDA+E  NSGHPG+PMGMAD VT LF + +  DP  P WP+RDRFVLSA
Sbjct: 16  RSMADAIRFLSMDAVEKANSGHPGMPMGMADAVTVLFNRFIRIDPSHPDWPDRDRFVLSA 75

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+L +L+G+ D+ + ++ +FR +GSKTAGHPEYG   GIE TTGPLGQGI+ A
Sbjct: 76  GHGSMLLYSLHHLIGFADMPMAELSSFRQLGSKTAGHPEYGHALGIETTTGPLGQGISTA 135

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAE+ +   FG  L +H+TYV+ GDGCL EGIS EAI  AGHL L KL+VLWD+N 
Sbjct: 136 VGMAIAEQMMAARFGSALCNHFTYVVAGDGCLQEGISHEAIDLAGHLKLRKLVVLWDDNR 195

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ISIDG   L+ S +Q ARFRA+GW+  +V+GHD  A+   + +A+ + KP++IAC T IG
Sbjct: 196 ISIDGSTDLSTSMNQLARFRAAGWDAQAVDGHDPDAVEKAIERARRTRKPSLIACRTRIG 255

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
            G+ +  G++K HG+ALG++EI ATR+ L W   PFF+P +I   W     R    R  W
Sbjct: 256 KGAASMEGSHKTHGAALGEKEIAATREKLGWPHPPFFVPPEIKAAWEKVATRGRTAREAW 315

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           + RL + +S  +K +E+     L     +     +         +ATR++S++ LEV+N 
Sbjct: 316 EIRLDASRS--KKRYEQTVERQLDGEVGDLLARFRGAHRTRATKVATRQASQMALEVING 373

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
                IGGSADLTGSN T TSQ + IS  +F GRYLHYG+REH MAAAMNGIALH G  P
Sbjct: 374 ATALTIGGSADLTGSNLTLTSQTQPISPGNFKGRYLHYGIREHGMAAAMNGIALHGGFIP 433

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTF+VFSDY+R A+RL++LMG+ VI+VLTHDSIGLGEDGPTHQPVEHLA LRA P+L 
Sbjct: 434 YGGTFLVFSDYARGAMRLSALMGLPVIYVLTHDSIGLGEDGPTHQPVEHLAMLRATPNLN 493

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-STPN 558
           V RPAD IET ECW++A+ EKN PSVL+LSRQ LP LR    + NL ALGAY  + +  +
Sbjct: 494 VFRPADIIETAECWEIAIGEKNTPSVLALSRQALPMLRRTDGNENLSALGAYVLMEARGD 553

Query: 559 AQVTIFSSGSELKIAVEACEILSSRN-ISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             +T+ ++GSE++IAV A E L +   I+  VVS+PC+E F  Q  +Y+ Q++G +P +I
Sbjct: 554 RDITLLATGSEVEIAVAAAERLQAEERIAAAVVSMPCWEKFEAQDAAYQRQVLGDAP-RI 612

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           AIEA  R GWD ++G D +F+GM GFGAS     LY+HFGI A  +V
Sbjct: 613 AIEAAGRLGWDRWMGPDSAFVGMTGFGASAPAGDLYRHFGITADHVV 659


>gi|328542610|ref|YP_004302719.1| transketolase (TK) [polymorphum gilvum SL003B-26A1]
 gi|326412356|gb|ADZ69419.1| Transketolase (TK) [Polymorphum gilvum SL003B-26A1]
          Length = 665

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/640 (55%), Positives = 455/640 (71%), Gaps = 4/640 (0%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+A+R LSMDA++  NSGHPG+PMGMADV T LF + M  DP    WP+RDRFVLSAG
Sbjct: 15  QMANAVRALSMDAVQMANSGHPGMPMGMADVATVLFNRFMTVDPAQADWPDRDRFVLSAG 74

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YA+ +LLGY+D+ IE ++ FR +GS+TAGHPEYG   GIE TTGPLGQGIA AV
Sbjct: 75  HGSMLLYAIHHLLGYEDMDIEQLRRFRQLGSRTAGHPEYGHALGIETTTGPLGQGIATAV 134

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AE+ L+  FG  L+DH+TYV+ GDGCLMEGIS EAI  AGH  L +LIVLWD+N I
Sbjct: 135 GMALAEKMLKARFGADLVDHWTYVIAGDGCLMEGISHEAIDLAGHQRLGRLIVLWDDNAI 194

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG  SL+ S DQ ARF A+GW+   V+GHDH A+ + +  A+   +P++IAC T+IG+
Sbjct: 195 TIDGATSLSTSMDQKARFEAAGWHVQGVDGHDHAAVAAAIEAARADARPSLIACRTIIGY 254

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PN+ GT   HGS LG  E+ A R+AL W   PF +PD++   W  A  R +  RA W 
Sbjct: 255 GAPNKQGTAATHGSPLGAAEVAAAREALGWPHAPFVVPDELRAAWTAAARRGAAARARWL 314

Query: 321 ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
           ERL+  +S     FE   +       D A    K++     P +ATRK+SE+ LEVV   
Sbjct: 315 ERLA--RSPKTDAFEAALAGPDRSALDAAVDAYKRRLASDAPTVATRKASEMALEVVTAA 372

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
           +P ++GGSADLTGSN T+T  M+ ++  D  G YLHYG+REH MAAAMNG+ALH G+ PY
Sbjct: 373 VPSMVGGSADLTGSNNTRTKAMRPVTADDAGGSYLHYGIREHGMAAAMNGLALHGGIVPY 432

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
            GTF+ F+DYSRPAIRL +LMG+R IHV+THDSIGLGEDGPTHQPVEHLA+LRAIP+LLV
Sbjct: 433 GGTFLAFADYSRPAIRLGALMGVRAIHVMTHDSIGLGEDGPTHQPVEHLASLRAIPNLLV 492

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQ 560
            RPAD++ET E WQ A+  +  PSVL LSRQNLP +R ++   NL A GAY        +
Sbjct: 493 FRPADAVETAEAWQTAVLAQATPSVLCLSRQNLPAVRLEHSDENLTARGAYVLKDVAGRR 552

Query: 561 -VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAI 619
            VT+ ++GSE+ IA+EA  +L+   +   VVS PCFELF  Q +SYRA ++G++P ++ +
Sbjct: 553 DVTLVATGSEVAIALEAARLLAETGVRAAVVSAPCFELFERQDESYRASVLGTAP-RVGV 611

Query: 620 EAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           EA + QGW  ++G+  +F+GM GFGAS   + LY HFGI 
Sbjct: 612 EAAVAQGWHRWLGTWSAFVGMDGFGASAPAEQLYAHFGIT 651


>gi|307316440|ref|ZP_07595883.1| transketolase [Sinorhizobium meliloti AK83]
 gi|306897638|gb|EFN28381.1| transketolase [Sinorhizobium meliloti AK83]
          Length = 694

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/647 (54%), Positives = 455/647 (70%), Gaps = 5/647 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MADAIRFLSMDA+E  NSGHPG+PMGMAD VT LF + +  DP  P WP+RDRFVLSA
Sbjct: 16  RSMADAIRFLSMDAVEKANSGHPGMPMGMADAVTVLFNRFIRIDPSHPDWPDRDRFVLSA 75

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+L +L+G+ D+ + ++ +FR +GSKTAGHPEYG   GIE TTGPLGQGI+ A
Sbjct: 76  GHGSMLLYSLHHLIGFADMPMAELSSFRQLGSKTAGHPEYGHALGIETTTGPLGQGISTA 135

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAE+ +   FG  L +H+TYV+ GDGCL EGIS EAI  AGHL L KL+VLWD+N 
Sbjct: 136 VGMAIAEQMMAARFGSALCNHFTYVVAGDGCLQEGISHEAIDLAGHLKLRKLVVLWDDNR 195

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ISIDG   L+ S +Q ARFRA+GW+  +V+GHD  A    + +A+ + KP++IAC T IG
Sbjct: 196 ISIDGSTDLSTSMNQLARFRAAGWDAQAVDGHDPDAAAKAIERARRTRKPSLIACRTRIG 255

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
            G+ +  G++K HG+ALG++EI ATR+ L W   PFF+P +I   W     R    R  W
Sbjct: 256 KGAASMEGSHKTHGAALGEKEIAATREKLGWPHPPFFVPPEIKAAWEKVATRGRTAREAW 315

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           + RL + +S  +K +E+     L     +     +         +ATR++S++ LEV+N 
Sbjct: 316 EIRLDASRS--KKRYEQTVERQLDGEVGDLLARFRGAHRTRATKVATRQASQMALEVING 373

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
                IGGSADLTGSN T TSQ + IS  +F GRYLHYG+REH MAAAMNGIALH G  P
Sbjct: 374 ATALTIGGSADLTGSNLTLTSQTQPISPGNFKGRYLHYGIREHGMAAAMNGIALHGGFIP 433

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTF+VFSDY+R A+RL++LMG+ VI+VLTHDSIGLGEDGPTHQPVEHLA LRA P+L 
Sbjct: 434 YGGTFLVFSDYARGAMRLSALMGLPVIYVLTHDSIGLGEDGPTHQPVEHLAMLRATPNLN 493

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-STPN 558
           V RPAD IET ECW++A+ EKN PSVL+LSRQ LP LR    + NL ALGAY    +  +
Sbjct: 494 VFRPADIIETAECWEIAIGEKNTPSVLALSRQALPMLRRTDGNENLSALGAYVLREARGD 553

Query: 559 AQVTIFSSGSELKIAVEACEILSSRN-ISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             +T+ ++GSE++IAV A E L +   I+  VVS+PC+E F  Q  +Y+ Q++G +P +I
Sbjct: 554 RDITLLATGSEVEIAVAAAERLQAEERIAAAVVSMPCWEKFEAQDAAYQRQVLGDAP-RI 612

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           AIEA  R GWD ++G D +F+GM GFGAS     LY+HFGI A  +V
Sbjct: 613 AIEAAGRLGWDRWMGPDSAFVGMTGFGASAPAGDLYRHFGITADHVV 659


>gi|254295324|ref|YP_003061347.1| transketolase [Hirschia baltica ATCC 49814]
 gi|254043855|gb|ACT60650.1| transketolase [Hirschia baltica ATCC 49814]
          Length = 660

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/654 (54%), Positives = 466/654 (71%), Gaps = 4/654 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MA+AIR LS DAIE    GH GLP+GMAD  T LF Q + FDP  P W +RDRFVLSA
Sbjct: 9   RDMANAIRALSTDAIEKAGIGHLGLPLGMADAATVLFAQFLKFDPTAPKWADRDRFVLSA 68

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY  V++EDIK FR +GSKT GHPE     G+E TTGPLGQGIA A
Sbjct: 69  GHGSMLIYSLLHLTGYPSVSMEDIKQFRQLGSKTPGHPENFITEGVETTTGPLGQGIATA 128

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAER +   +GD L+DHYTYV+ GDGCLMEGISQEA++ AGHLGL KLIVL+D+N 
Sbjct: 129 VGMAIAERNMNARYGDELVDHYTYVIAGDGCLMEGISQEALTLAGHLGLGKLIVLFDDNA 188

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDKPTMIACETVI 258
           ++IDG   +ADST Q ARF +SGW   +V+GHD  A+   + +A+  +DKP++IAC+T I
Sbjct: 189 VTIDGGTDVADSTKQTARFASSGWQVDAVDGHDPEAVAEAIERAKANTDKPSLIACKTTI 248

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFG+P  AG  K HG     +E  A R+ L    + F +  +++  WR AG RS   R  
Sbjct: 249 GFGAPTFAGQGKAHGGPYPADETAALRENLGLPSERFTVVPEVLDAWRAAGARSVDVRKA 308

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W+ RL+++ ++   EF R  +  LP+  + A    KK+    +   ATR+ S   LEV+ 
Sbjct: 309 WEARLNALDNA--SEFTRAMAGKLPEGVEAAANAHKKEVAEGQATKATRQWSGAALEVLT 366

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             +PE+IGGSADLTGSN TKTS   A++  D++GRY+HYGVREHAMAAAMNG+A H G+ 
Sbjct: 367 GAIPEMIGGSADLTGSNNTKTSHTTALNSDDWAGRYMHYGVREHAMAAAMNGMAQHGGVI 426

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PYSGTF+ F+DYSR AIRL +LMG RVIHV+THDSIGLGEDGPTHQPVEH+A+LRA+P++
Sbjct: 427 PYSGTFLAFADYSRGAIRLGALMGARVIHVMTHDSIGLGEDGPTHQPVEHVASLRAMPNI 486

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP- 557
            V+RP D +ET+E WQVAL  +N PSVL+L+RQ +   R  +   NL A GAY       
Sbjct: 487 HVMRPCDGVETMEAWQVALSRENGPSVLALTRQGVVPARKDHTDENLVAKGAYILSEAKG 546

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
            AQV + ++GSE+ +A+EA E L++++I  RVVS+PC ELF EQSD+Y+A+++GS+  K+
Sbjct: 547 EAQVVLIATGSEVGLALEAQEKLAAQDIGARVVSMPCMELFLEQSDAYQAEVLGSNLPKV 606

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +EAG+R GWD+ IGSDG F+GM GFGAS     L+ HF I + A+VD   +++
Sbjct: 607 GVEAGVRFGWDSVIGSDGEFVGMNGFGASAPAKDLFNHFNITSDAVVDAALKQI 660


>gi|16263941|ref|NP_436733.1| transketolase [Sinorhizobium meliloti 1021]
 gi|17368157|sp|P58333|TKT_RHIME RecName: Full=Transketolase; Short=TK
 gi|15140065|emb|CAC48593.1| putative transketolase protein [Sinorhizobium meliloti 1021]
          Length = 694

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/647 (54%), Positives = 454/647 (70%), Gaps = 5/647 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MADAIRFLSMDA+E  NSGHPG+PMGMAD VT LF + +  DP  P WP+RDRFVLSA
Sbjct: 16  RSMADAIRFLSMDAVEKANSGHPGMPMGMADAVTVLFNRFIRIDPSHPDWPDRDRFVLSA 75

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+L +L+G+ D+ + ++ +FR +GSKTAGHPEYG   GIE TTGPLGQGI+ A
Sbjct: 76  GHGSMLLYSLHHLIGFADMPMAELSSFRQLGSKTAGHPEYGHALGIETTTGPLGQGISTA 135

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAE+ +   FG  L +H+TYV+ GDGCL EGIS EAI  AGHL L KL+VLWD+N 
Sbjct: 136 VGMAIAEQMMAARFGSALCNHFTYVVAGDGCLQEGISHEAIDLAGHLKLRKLVVLWDDNR 195

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ISIDG   L+ S +Q ARFRA+GW+  +V+GHD  A+   + +A+ + KP++IAC T IG
Sbjct: 196 ISIDGSTDLSTSMNQLARFRAAGWDAQAVDGHDPDAVAKAIERARRTRKPSLIACRTRIG 255

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
            G+ +  G++K HG+ALG++EI ATR+ L W   PFF+P +I   W     R    R  W
Sbjct: 256 KGAASMEGSHKTHGAALGEKEIAATREKLGWPHPPFFVPPEIKAAWEKVATRGRTAREAW 315

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           + RL + +S  +K +E+     L     +     +         +ATR++S++ LEV+N 
Sbjct: 316 EIRLDASRS--KKRYEQTVERKLDGEVGDLLARFRGAHRTRATKVATRQASQMALEVING 373

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
                IGGSADLTGSN T TSQ + IS  +F GRYLHYG+REH MAAAMNGIALH G  P
Sbjct: 374 ATALTIGGSADLTGSNLTLTSQTQPISPGNFKGRYLHYGIREHGMAAAMNGIALHGGFIP 433

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTF+VFSDY+R A+RL++LMG+ VI+VLTHDSIGLGEDGPTHQPVEHLA LRA P+L 
Sbjct: 434 YGGTFLVFSDYARGAMRLSALMGLPVIYVLTHDSIGLGEDGPTHQPVEHLAMLRATPNLN 493

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-STPN 558
           V RPAD IET ECW++A+ EKN PSV +LSRQ LP LR    + NL ALGAY    +  +
Sbjct: 494 VFRPADIIETAECWEIAIGEKNTPSVFALSRQALPMLRRTDGNENLSALGAYVLREARGD 553

Query: 559 AQVTIFSSGSELKIAVEACEILSSRN-ISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             +T+ ++GSE++IAV A E L +   I+  VVS+PC+E F  Q  +Y  Q++G +P +I
Sbjct: 554 RDITLLATGSEVEIAVAAAERLQAEERIAAAVVSMPCWEKFEAQDAAYHRQVLGDAP-RI 612

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           AIEA  R GWD ++G D +F+GM GFGAS     LY+HFGI A  +V
Sbjct: 613 AIEAAGRLGWDRWMGPDSAFVGMTGFGASAPAGDLYRHFGITADHVV 659


>gi|239833415|ref|ZP_04681743.1| transketolase [Ochrobactrum intermedium LMG 3301]
 gi|239821478|gb|EEQ93047.1| transketolase [Ochrobactrum intermedium LMG 3301]
          Length = 712

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/649 (55%), Positives = 470/649 (72%), Gaps = 4/649 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D  ++A+ IR LS+DA++  NSGHPG+P+GMAD    LF++ + FD   P W +RDRFVL
Sbjct: 55  DMLQLANCIRALSIDAVDAANSGHPGMPLGMADAAAVLFSKHLKFDASAPNWADRDRFVL 114

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           S GHGSML Y+ LYL GY+DV+++++KNFR  GSKTAGHPEYG   G+E TTGPLGQG+A
Sbjct: 115 SNGHGSMLLYSALYLAGYKDVSLDELKNFRQWGSKTAGHPEYGHTEGVELTTGPLGQGLA 174

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           ++VGMAIAER L ++FG  ++DH TYV  GDGCLMEG+ QEAIS AGHL L KLIVL+D+
Sbjct: 175 SSVGMAIAERALADQFGKDIVDHRTYVFCGDGCLMEGVGQEAISLAGHLRLGKLIVLYDD 234

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDKPTMIACET 256
           NGI+IDG   +A + D  A+F+A GWN   V+GHDH AI + L +A+  +D+PT+IA +T
Sbjct: 235 NGITIDGSTEIAFTDDIPAKFKACGWNVEKVDGHDHDAIDAALTRAKAQADRPTLIALKT 294

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIG+GSPNRAGT+ VHG+ LG  E  AT+ AL W  + F IP  ++  WR AG R +  R
Sbjct: 295 VIGYGSPNRAGTSGVHGAPLGAAENAATKAALGWTAEAFEIPAPLLNAWREAGARGASER 354

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
             WQ+R+ ++ ++ R EF+RR +  LP+ F     + K++       +ATRK+S++ LE 
Sbjct: 355 DAWQKRVDALPAAERAEFDRRIAGVLPEGFAAVVADAKQRLLDKPQNVATRKASQIALES 414

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +   LPE+IGGSADLT SN T+   + +    + SGRY+ YGVRE AM AAMNGIA+H G
Sbjct: 415 LTAALPEMIGGSADLTHSNLTRVPAVDSDFTPEKSGRYVSYGVREFAMGAAMNGIAVHGG 474

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
             PY GTFMVFSDY+R AIRL++LMG+RVIHVLTHDSIGLGEDGPTHQPVEHLA+LRA+P
Sbjct: 475 FIPYGGTFMVFSDYARNAIRLSALMGVRVIHVLTHDSIGLGEDGPTHQPVEHLASLRAMP 534

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           +L V RPAD+IETLECW VA+ + N PSVL+LSRQN+P LRT     NL A GAY     
Sbjct: 535 NLHVFRPADTIETLECWAVAVSDPNTPSVLALSRQNVPQLRTD-NGENLSARGAYVLREA 593

Query: 557 PNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
               Q+T+ ++G+E+ +AV+A E L+   I+T VVS+P ++LF +QS  YR  ++G +P 
Sbjct: 594 KGERQITLLATGTEVSLAVKAAEKLAEEGIATAVVSMPSWDLFEKQSKEYRKGVLGDAP- 652

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           +IA+EA  + GW  ++ S+   IGM GFGAS   ++LY+ FGI A AIV
Sbjct: 653 RIAVEAAGKFGWTRYVDSEDDVIGMDGFGASAPAEVLYEKFGITAEAIV 701


>gi|296448050|ref|ZP_06889954.1| transketolase [Methylosinus trichosporium OB3b]
 gi|296254450|gb|EFH01573.1| transketolase [Methylosinus trichosporium OB3b]
          Length = 668

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/650 (56%), Positives = 458/650 (70%), Gaps = 7/650 (1%)

Query: 24  DAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGS 83
           +AIR L+MDA+E   SGHPG+PMGMADV T LF + M FD   P WPNRDRFVLSAGHGS
Sbjct: 22  NAIRALAMDAVEKAKSGHPGMPMGMADVATVLFKEVMTFDASAPDWPNRDRFVLSAGHGS 81

Query: 84  MLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMA 143
           ML YALLYLLGY  V IED+K+FR  G+KT GHPEYG   G+E TTGPLGQG+A AVG A
Sbjct: 82  MLLYALLYLLGYPGVVIEDLKSFRQFGAKTPGHPEYGHTIGVETTTGPLGQGLATAVGFA 141

Query: 144 IAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISID 203
           IAER     F D L+DH TYVL GDGCLMEG+S EAI  AGHL L +LIVLWD+NGISID
Sbjct: 142 IAERLQAARFSDDLVDHRTYVLAGDGCLMEGVSHEAIDLAGHLRLGRLIVLWDDNGISID 201

Query: 204 GPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSP 263
           GP +L+ STDQ ARF ASGW+   V+GH    I + L  AQ   +P++IAC +VIG+G+P
Sbjct: 202 GPTTLSTSTDQLARFSASGWHVQRVDGHAPQEIAAALAAAQQDARPSLIACRSVIGYGAP 261

Query: 264 NRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERL 323
            + G   VHG+ LG+ EI+  R  L W   PF +P++++  WR AG R  + R  W++RL
Sbjct: 262 GKQGKESVHGAPLGETEIELARAELGWPYAPFEVPEEVLADWRAAGARGREARLAWEQRL 321

Query: 324 SSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLPE 383
           ++  S  R EFE   S  +          L+ KF    P IATRKSSE  L VVN+    
Sbjct: 322 AA--SPKRAEFETFLSGDIASEIAAPLAALRAKFASEMPKIATRKSSETTLAVVNEATSR 379

Query: 384 LIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGT 443
            IGGSADLT SN T T  + +++  DFSGRY+HYGVREH MAAAMNG+ALH G  PY GT
Sbjct: 380 TIGGSADLTHSNFTITKGLGSVTAEDFSGRYIHYGVREHGMAAAMNGVALHGGFVPYGGT 439

Query: 444 FMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRP 503
           F+VFSDY+R A+RL++LM  RV++V+THDSIGLGEDGPTHQP+EHLA+LRA+P+L V RP
Sbjct: 440 FLVFSDYARGAMRLSALMNQRVVYVMTHDSIGLGEDGPTHQPIEHLASLRAMPNLNVFRP 499

Query: 504 ADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA--QV 561
           AD+IET ECW++AL  +  PSVLSLSRQNL  L     S NL A GAY  +  P++  QV
Sbjct: 500 ADAIETAECWEIALTTRRTPSVLSLSRQNLATLERPI-SENLSARGAY-VLREPSSGRQV 557

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
           T+ ++GSE++IA+ A ++L +R +   VVS+PC+ELF  QS +YR +++GS+P ++A+EA
Sbjct: 558 TLIATGSEVEIALAAADLLWTRGVRAAVVSMPCWELFEAQSAAYRNRVLGSTP-RVAVEA 616

Query: 622 GLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
             R GWD ++G  G F+GM GFGAS     LY+HFG+ A  +    E  L
Sbjct: 617 ASRFGWDRWLGDRGEFVGMSGFGASAPAGTLYRHFGVTAENVAAAAETLL 666


>gi|119384020|ref|YP_915076.1| transketolase [Paracoccus denitrificans PD1222]
 gi|119373787|gb|ABL69380.1| transketolase [Paracoccus denitrificans PD1222]
          Length = 672

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/655 (54%), Positives = 453/655 (69%), Gaps = 12/655 (1%)

Query: 14  KYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRD 73
           K D  + ++A AIR LSMDA+E  NSGHPG+PMGMADV T LF   + FD   P W +RD
Sbjct: 8   KADPAHWRLATAIRALSMDAVEAANSGHPGMPMGMADVATVLFRNHLKFDAAAPNWFDRD 67

Query: 74  RFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLG 133
           RFVLSAGHGSML Y+LLYL GY+ ++I+ I+NFR  GS TAGHPE+G   G+E TTGPLG
Sbjct: 68  RFVLSAGHGSMLIYSLLYLTGYEQMSIDQIRNFRQWGSITAGHPEFGHAEGVETTTGPLG 127

Query: 134 QGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIV 193
           QGIA AVG AIAE  +R +FG+ L  H T+V+ GDGCLMEGISQEA+  AGH  L  LIV
Sbjct: 128 QGIATAVGFAIAEEAMRAQFGEGLCSHKTWVIAGDGCLMEGISQEAVGLAGHQKLGNLIV 187

Query: 194 LWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQ--LSDKPTM 251
           LWDNN I+IDG +SL+DSTDQ  RF ASGW TLS +GHD   I   L  A     D+P +
Sbjct: 188 LWDNNDITIDGRVSLSDSTDQLKRFEASGWRTLSCDGHDPADIERALADAASGKDDRPVL 247

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLR 311
           +AC+T+IG+G+PN+  ++ VHGSALG  EI A R+ L WD   F IP+DI+ +WR  G +
Sbjct: 248 VACKTIIGYGAPNKQDSSGVHGSALGAAEIVAAREVLGWDSPAFVIPEDILAEWRAIGAK 307

Query: 312 SSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             + R  W  R+ + ++  R EF RR S  + +        LK++   SKP +ATRK+SE
Sbjct: 308 GREAREAWAARVDAAEN--RDEFARRISGGVSERLAPTIAALKQQALDSKPKVATRKASE 365

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
           +VLEVVN  LPE IGGSADLTGSN T+T  +   S  +  GRY++YG+REH MAAAMNG+
Sbjct: 366 MVLEVVNPELPETIGGSADLTGSNNTRTKDLGTFSPENRKGRYINYGIREHGMAAAMNGL 425

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
            LH GL PY GTFM F+DY+R A+RL++LMG+ V +V+THDSIGLGEDGPTHQPVEHLA 
Sbjct: 426 WLHGGLRPYGGTFMCFTDYARGAMRLSALMGLPVTYVMTHDSIGLGEDGPTHQPVEHLAI 485

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
            RA P+ L LRP D IET E W++AL  ++ P+VL+LSRQNLP LR Q    NL A GAY
Sbjct: 486 CRATPNTLTLRPCDLIETAEAWEIALSSESTPAVLALSRQNLPMLREQ-AGENLTARGAY 544

Query: 552 DYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
                  A +V + +SGSE++IAV A + L +  + TRVVSVP  ELF +Q   YR Q++
Sbjct: 545 VLREASAAPKVILMASGSEVEIAVAARDALEAEGVPTRVVSVPSMELFRDQDAEYRRQVL 604

Query: 611 GSSPIKIAIEAGLRQGWD-AFIGSDG-----SFIGMQGFGASGSCDLLYQHFGIN 659
            +  +++AIEA +RQ WD   +G  G      FIGM GFGAS    +LY+ FGI 
Sbjct: 605 PAGTVRVAIEAAVRQPWDWLLLGERGREETSGFIGMIGFGASAPAPVLYKEFGIT 659


>gi|163796360|ref|ZP_02190321.1| transketolase [alpha proteobacterium BAL199]
 gi|159178502|gb|EDP63044.1| transketolase [alpha proteobacterium BAL199]
          Length = 696

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/656 (54%), Positives = 460/656 (70%), Gaps = 1/656 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +K +A+AIR L+MDA+E  +SGHPG+PMGMAD    LF + + FDP+ P WP+RDRFVLS
Sbjct: 38  HKSLANAIRALAMDAVEAASSGHPGMPMGMADAAVVLFAEQLRFDPRRPDWPDRDRFVLS 97

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML YALL+L GY  +TI+++K FR IGS+TAGHPEYG+  GIE TTGPLGQG  N
Sbjct: 98  AGHGSMLLYALLHLTGYPGMTIDELKRFRQIGSRTAGHPEYGASPGIETTTGPLGQGFGN 157

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
            VGMAIAER L   FGD L++H T+V+ GDGCLMEGIS EA S AGHLGL +L VLWD+N
Sbjct: 158 GVGMAIAERHLNARFGDDLVNHRTWVIAGDGCLMEGISHEAASLAGHLGLGRLNVLWDDN 217

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            ISIDGP  L  S D  ARF + GW+ +S +GHD  ++++ L +A    +P++IAC TVI
Sbjct: 218 KISIDGPTDLTLSDDVPARFVSYGWHVVSADGHDPKSVSAALAEAAADPRPSLIACRTVI 277

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           G G+P + GT   HG+ LG  EI ATR+A+ W   PF IP D+       G R +     
Sbjct: 278 GHGAPTKGGTAGSHGAPLGAAEIAATREAIGWPHAPFEIPADVQTAGLALGDRGAVDSEA 337

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           WQ RL +   S+R EFER  +  LP  F +A  +LK       P +A+R +S+  +E   
Sbjct: 338 WQGRLDATDPSVRAEFERTMAGKLPAAFADAVQSLKATLASDPPKLASRVASQRAIEAFA 397

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             LPEL+GGSADL+GSN TK      +++ +  G Y+HYGVREHAMAAAMNG+ALH G+ 
Sbjct: 398 PTLPELLGGSADLSGSNNTKVKSQAILTRDNAGGSYVHYGVREHAMAAAMNGMALHGGVI 457

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+VF+DY RP+IRLA+LMGIRV++V+THDSIGLGEDGPTHQPVEHLAALR IP+L
Sbjct: 458 PYGGTFLVFTDYCRPSIRLAALMGIRVVYVMTHDSIGLGEDGPTHQPVEHLAALRCIPNL 517

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN 558
            V RPAD++ET ECWQVAL+  + PSVL+L+RQ LP +RT +   N    G Y       
Sbjct: 518 HVHRPADAVETAECWQVALERADGPSVLTLTRQGLPPVRTTHSGENRVRRGGYVLQDANG 577

Query: 559 A-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
           A QVT+ ++GSE+ IA +A ++L++  I   VVS+PC ELF  Q   YR Q++G+  ++I
Sbjct: 578 ARQVTLIATGSEVDIARKARDLLAADGIGAAVVSMPCKELFAAQDAEYRDQVLGNRTVRI 637

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
           A+EAG+R  W+A IG DG F+GM  FGASG  + LY+HFGI   A+ D   R+L+ 
Sbjct: 638 AVEAGVRMPWEADIGPDGGFVGMSSFGASGPYEELYKHFGITPEAVADEARRRLAA 693


>gi|149914746|ref|ZP_01903276.1| transketolase [Roseobacter sp. AzwK-3b]
 gi|149811539|gb|EDM71374.1| transketolase [Roseobacter sp. AzwK-3b]
          Length = 671

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/661 (52%), Positives = 450/661 (68%), Gaps = 8/661 (1%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ K A AIR L++DA+   NSGH G+PMGMADV T LF + + F    P WP+RDRF+L
Sbjct: 12  DHWKKAAAIRALTLDAVHAANSGHSGMPMGMADVATVLFEKHLKFHAASPDWPDRDRFIL 71

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML Y+LL+L GY D+T++ I+NFR  G+ TAGHPEYG   GIE TTGPLGQGI+
Sbjct: 72  SAGHGSMLLYSLLHLTGYADMTLDQIRNFRQWGAITAGHPEYGHAKGIETTTGPLGQGIS 131

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           NAVG A+AE  LR  FG  L+DHYTYV+ GDGCLMEG+S EAI  AG   LSKLIV WDN
Sbjct: 132 NAVGFAMAEEMLRARFGRKLVDHYTYVIAGDGCLMEGVSHEAIGLAGRHALSKLIVFWDN 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           N I+IDG + LAD TDQ  RFRASGW  L ++GHD  AI + +  A+ S KPTMIAC+T 
Sbjct: 192 NNITIDGTVDLADRTDQVKRFRASGWQVLEIDGHDPEAIDAAITTAKSSRKPTMIACKTH 251

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           I  G   +  T+K HG+     ++ A ++A  W   PF IP D+   W   G R +    
Sbjct: 252 IALGHAAQ-DTSKGHGALTDAGQLAAAKEAYGWPYGPFEIPADVKSAWEAIGARGTAEHD 310

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            W  RL     S + EF R F+   P         LKK+    KP +ATRKSSE+VLEVV
Sbjct: 311 AWTARLGEASQSRQNEFARIFAGEAPKALSARIKALKKQISEEKPSVATRKSSEMVLEVV 370

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N  +PE +GGSADL+GSN T++  M      +  GRY+H+G+REH MAAAMNG+ALH G+
Sbjct: 371 NPIMPETVGGSADLSGSNNTRSGDMSVFDVDNRKGRYVHWGIREHGMAAAMNGMALHGGI 430

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTFM F+DY+RPA+RLA+LM +  + V+THDSIGLGEDGPTHQPVEHLA  RA P+
Sbjct: 431 RPYGGTFMCFTDYARPAMRLAALMKVPSVFVMTHDSIGLGEDGPTHQPVEHLAISRATPN 490

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-ST 556
             V RP D++ET E W++AL+    PSVLSL+RQN+P LRT++++ NL A GAY    +T
Sbjct: 491 TWVFRPCDTVETAEAWELALRSTQTPSVLSLTRQNVPTLRTEHKTANLTARGAYVLADAT 550

Query: 557 PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
              Q  + ++GSE+ IA++A ++L +  I TRVVS+PC+ELF EQ ++YR +++   P++
Sbjct: 551 GKRQALLMATGSEVAIAMQARDLLEAEGIGTRVVSMPCWELFEEQDEAYRKRVLPGGPVR 610

Query: 617 IAIEAGLRQGWDAFI-GSDGS-----FIGMQGFGASGSCDLLYQHFGINAIAIVDMVERK 670
           +A+EA +R GWD ++ G  G      FIGM  FGAS   ++LY+ FGI A A+ D V+  
Sbjct: 611 VAVEAAIRFGWDRWLYGERGKREKSGFIGMHDFGASAPAEVLYEKFGITAQAVADKVKSL 670

Query: 671 L 671
           L
Sbjct: 671 L 671


>gi|296535331|ref|ZP_06897535.1| transketolase [Roseomonas cervicalis ATCC 49957]
 gi|296264346|gb|EFH10767.1| transketolase [Roseomonas cervicalis ATCC 49957]
          Length = 699

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/663 (54%), Positives = 458/663 (69%), Gaps = 7/663 (1%)

Query: 11  VLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWP 70
           +L +   + ++MADAIR L++DA+E   SGHPG+PMGMAD  T LFT+ +  D   P W 
Sbjct: 41  ILARPMTENRRMADAIRALAIDAVEKAKSGHPGMPMGMADAATVLFTKFLKHDAADPRWA 100

Query: 71  NRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTG 130
           +RDRFVLSAGHGSML YA L+L G+  + IEDIK FR + S  AGHPE+G    IE TTG
Sbjct: 101 DRDRFVLSAGHGSMLLYAWLHLSGHAGMGIEDIKQFRQLHSVAAGHPEFGEHPAIETTTG 160

Query: 131 PLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSK 190
           PLGQG+ANAVGMA+AER L   FG  L+DH T+V+ GDGCLMEGIS EA S AGH  LSK
Sbjct: 161 PLGQGLANAVGMALAERHLAARFGKSLVDHRTWVIAGDGCLMEGISHEAASIAGHFKLSK 220

Query: 191 LIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPT 250
           L VLWD+NGI IDG + L  S D   RF + GW    V+GHD  A+   L  A  S KPT
Sbjct: 221 LTVLWDDNGICIDGDVGLTSSDDVLKRFLSYGWAVKRVDGHDPVAVEKALEAATRSKKPT 280

Query: 251 MIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGL 310
           +IAC T+IGF +P++AGT   HGS LG  E  A ++AL W   PF IP+DI   W  AG 
Sbjct: 281 IIACRTIIGFSAPSKAGTAGSHGSPLGGPEAAAAKEALGWTAAPFEIPEDIKASWEAAGR 340

Query: 311 RSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSS 370
           R + TR  W +RL++     + EFER  +  LP+ +  A    + K    KP IA+R +S
Sbjct: 341 RCAGTRRSWLKRLANHPQ--KAEFERAMAGKLPEGWHEAAAAYRAKLAEDKPKIASRVAS 398

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           +  LEV+   +PE+IGGSADLTGSN T    +  ++  +++GRY+H+G+REH MAAAMNG
Sbjct: 399 QRALEVLVPAIPEMIGGSADLTGSNNTNVKGIPVLTPENYAGRYVHWGIREHGMAAAMNG 458

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           +ALH G  PYSGTF+VF+DY RP++RLA+LM  RVIHVLTHDSIGLGEDGPTHQPVE LA
Sbjct: 459 MALHGGTIPYSGTFLVFADYLRPSLRLAALMRQRVIHVLTHDSIGLGEDGPTHQPVETLA 518

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
           +LRAIP+L V RPAD++ET ECW++A+   + P+VL+LSRQNLP LR +   N   A G 
Sbjct: 519 SLRAIPNLYVFRPADAMETAECWEIAVARADGPAVLALSRQNLPALRAEAGENK-SARGG 577

Query: 551 Y--DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           Y     S P  + T+ ++GSE+++A+ A E L +  I T VVS+PC+ELF  Q +SYRA 
Sbjct: 578 YVLAEASGPR-RATLIATGSEVQLAIAARETLEAEGIPTAVVSLPCWELFALQDESYRAA 636

Query: 609 IIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           ++G +P +I IEA L  GWD ++GSD +FIGM GFGAS   + LY+HFGI A A V  V+
Sbjct: 637 VLGDAP-RIGIEAALPFGWDRWLGSDATFIGMAGFGASAPAEDLYRHFGITADAAVAAVK 695

Query: 669 RKL 671
           RKL
Sbjct: 696 RKL 698


>gi|307946961|ref|ZP_07662296.1| transketolase [Roseibium sp. TrichSKD4]
 gi|307770625|gb|EFO29851.1| transketolase [Roseibium sp. TrichSKD4]
          Length = 669

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/644 (53%), Positives = 449/644 (69%), Gaps = 4/644 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR L+MDAI+  NSGHPG PMG+ADV T LF + +  DP  P WP+RDRFVLSAGH
Sbjct: 14  MANAIRALAMDAIQKANSGHPGAPMGLADVATVLFNRFIEIDPSEPDWPDRDRFVLSAGH 73

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
            SML YA+ +LLG+ D+ IE +K+FR +G++TAGHPEYG   GIE TTGPLGQGI+ AVG
Sbjct: 74  ASMLVYAINHLLGFDDMDIEQLKSFRQLGARTAGHPEYGHAKGIETTTGPLGQGISTAVG 133

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER     FGD L+DH+TYVL GDGCLMEGIS EA   AGHLGL +LIV WD+N I+
Sbjct: 134 MALAERMHNARFGDDLVDHFTYVLAGDGCLMEGISHEANDMAGHLGLGRLIVFWDDNSIT 193

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG   L+ S DQ ARF A+GW+ ++V+GH+   I + +  A+   +P++IAC+T+IGFG
Sbjct: 194 IDGKTDLSTSMDQKARFAAAGWHVVAVDGHNKQEIAAAIEVARADGRPSLIACKTIIGFG 253

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +PN+ G    HGS LG +EI ATR  LNW  + F +P+++ + WR    R +  R+ W +
Sbjct: 254 APNKQGKAATHGSPLGADEIAATRAQLNWTHEAFHVPNEVYEAWRAVARRGAVARSAWFK 313

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           R     +S R+ F R  +         AF   K     + P IATRK+SE+ LEV+N  +
Sbjct: 314 RWEG--ASAREVFSRSLTKPDSKAISEAFQTYKSAQIAAAPKIATRKASEMALEVLNGVI 371

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
             L GGSADLTGSN T+T +M A+S+  F G Y+HYGVREH MAAAMNGIALH G  PY 
Sbjct: 372 SNLAGGSADLTGSNNTRTKEMTAVSRGCFGGNYIHYGVREHGMAAAMNGIALHGGFIPYG 431

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           GTF+VF+DY+R A+RL++LMG+ V +V+THDSIGLGEDGPTHQPVE LA+LRA+P+L VL
Sbjct: 432 GTFLVFADYARGAMRLSALMGVPVTYVMTHDSIGLGEDGPTHQPVETLASLRAMPNLTVL 491

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQ- 560
           RPAD IET E W++A+  +N P+VL LSRQ LP LR    + N  A GAY        + 
Sbjct: 492 RPADVIETAEAWEIAVTSRNTPTVLCLSRQGLPTLRRDGAAGNPTAKGAYLLKEVGGTRD 551

Query: 561 VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIE 620
           +T+ ++GSE++IA+ A E L +  +   VVS P FELF  Q ++YR  ++G +P +I +E
Sbjct: 552 LTLIATGSEVEIAMSAAEKLEADGLKVAVVSAPSFELFAVQPETYREAVLGLAP-RIGVE 610

Query: 621 AGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           A +RQGWD F+  D +FIGM  FGASG    LY HFGI   A++
Sbjct: 611 AAVRQGWDLFLRPDDAFIGMNSFGASGPAADLYGHFGITKEAVI 654


>gi|119384434|ref|YP_915490.1| transketolase [Paracoccus denitrificans PD1222]
 gi|119374201|gb|ABL69794.1| transketolase [Paracoccus denitrificans PD1222]
          Length = 668

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/651 (54%), Positives = 461/651 (70%), Gaps = 5/651 (0%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIR L+MDA+E   SGHPG PMGMADV   LF + M  DP    WP+RDRFV+SAG
Sbjct: 15  QMANAIRALAMDAVEAAKSGHPGAPMGMADVAAVLFNRFMKIDPADASWPDRDRFVMSAG 74

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YA+ ++LGY D+ ++ +++FR +G++TAGHPEYG   GIE TTGPLGQGIA AV
Sbjct: 75  HGSMLVYAINHMLGYDDMDMDQLRSFRQLGARTAGHPEYGHAKGIETTTGPLGQGIATAV 134

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AER +   FGD L+DH+TYV+ GDGCLMEGIS EAI FAGH  L +LI++WD+NGI
Sbjct: 135 GMALAERMMNARFGDDLVDHWTYVISGDGCLMEGISHEAIDFAGHQQLGRLILMWDDNGI 194

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG   L+ STDQ ARF A+GW+  +V+GHD  A+ + +  A+  D+P++IAC+TVIG+
Sbjct: 195 TIDGGTDLSTSTDQQARFAAAGWHVQAVDGHDREAVAAAIEAAREDDRPSLIACKTVIGY 254

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PN+ G++ VHG+ LG +EI A R  L W   PF IP DI+  WR    R ++ R+ WQ
Sbjct: 255 GAPNKQGSHDVHGAPLGADEIAAARAHLGWSHPPFEIPQDILDSWRSVSARGAEARSAWQ 314

Query: 321 ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
           +RL +  S  +  F    +        +A  +   K    +P +ATRK+SE+ LEVVN  
Sbjct: 315 KRLET--SPDQGRFNAMLAAPDAAALRSAIRDHTAKLAADRPKVATRKASEMALEVVNAT 372

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
           LP  +GGSADLTGSN T++  M +++  D SGRY+HYG+REH MAA MNGIALH GL PY
Sbjct: 373 LPNTVGGSADLTGSNNTRSKGMASVTPGDRSGRYVHYGIREHGMAAIMNGIALHGGLVPY 432

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
            GTF+ FSDYSRPAIRL +LMG+ V+HV+THDSIGLGEDGPTHQPVEH+AALRAIP+L+V
Sbjct: 433 GGTFLAFSDYSRPAIRLGALMGVPVVHVMTHDSIGLGEDGPTHQPVEHVAALRAIPNLMV 492

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQ 560
            RPAD+ ET E W++AL     PSVL LSRQNLP +R +   +NL   GAY    T  A+
Sbjct: 493 FRPADAAETAESWEIALTAPASPSVLCLSRQNLPAVRLEAGDDNLTRQGAYVLRETEGAR 552

Query: 561 -VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAI 619
            VT+ ++GSE++IA+EA ++L+++ +   VVS PCFELF  +  + R  ++G +P +I +
Sbjct: 553 DVTLIATGSEVEIALEAADLLAAQGVRAAVVSAPCFELFAARPQAEREAVLGRAP-RIGV 611

Query: 620 EAGLRQGWDAFIGSDG-SFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
           EA +RQGWD  I   G  FIGM GFGAS     LY+HFGI      D+  +
Sbjct: 612 EALIRQGWDGLILRPGDGFIGMAGFGASAPAPALYRHFGITPERAADLANQ 662


>gi|83591934|ref|YP_425686.1| transketolase [Rhodospirillum rubrum ATCC 11170]
 gi|83574848|gb|ABC21399.1| transketolase [Rhodospirillum rubrum ATCC 11170]
          Length = 660

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/642 (54%), Positives = 454/642 (70%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +  +A+AIRFLS DA++   SGHPG+PMGMADV T LFT+ + FDP  P WP+RDRFVLS
Sbjct: 6   HADLANAIRFLSADAVQKAKSGHPGMPMGMADVATVLFTRFLTFDPAAPRWPDRDRFVLS 65

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML Y+LLYL GY D+ ++ IK+FR +G++TAGHPEYG  AG E TTGPLGQG+AN
Sbjct: 66  AGHGSMLLYSLLYLTGYADIDLDQIKSFRQLGARTAGHPEYGHVAGAETTTGPLGQGLAN 125

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           AVGMA+AER     FG+ +++H TYV+ GDGCLMEGISQEAIS AGH+ L +LIVLWD+N
Sbjct: 126 AVGMALAERMTAARFGEAVVNHRTYVIAGDGCLMEGISQEAISLAGHMKLERLIVLWDDN 185

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            I IDG + LA S D  ARF+ASGW TL+ +GHD   IT  L +AQ SD+PT+IAC T+I
Sbjct: 186 RICIDGDVGLASSDDVPARFQASGWRTLACDGHDPQDITRALTEAQTSDRPTLIACRTII 245

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           G G+P   GT K HGS LG  EI   R AL W   PF +P+ I+  WR AG R    R  
Sbjct: 246 GKGAPTLQGTAKTHGSPLGDAEIAGARAALGWPHAPFEVPEPILSAWRTAGARGGVARVA 305

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W++RL+S+    R    R  +  LP  +++A +  K+    ++P +A+RK+S++ LEV+ 
Sbjct: 306 WEDRLASLPGDERATLIRALAGDLPAGWEDAVLAAKRALIETRPKVASRKASQMALEVLV 365

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             +PEL+GGSADLTGSN T+      I    + G Y+HYGVREH M + MNG+ALH G+ 
Sbjct: 366 PQIPELVGGSADLTGSNLTQVKGQADILPGSYGGHYIHYGVREHGMGSLMNGLALHGGVI 425

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+VF+DY RPAIR+A+LMG+R I+VLTHDSIGLGEDGPTHQPVEHLA+LRAIP+L
Sbjct: 426 PYGGTFLVFADYMRPAIRMAALMGLRAIYVLTHDSIGLGEDGPTHQPVEHLASLRAIPNL 485

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN 558
              RPAD++ETLECW +A+   + PS+L+LSRQ+LP LR  Y   NL A GAY       
Sbjct: 486 WTFRPADAVETLECWALAVGRSDGPSLLALSRQDLPTLREAYGEENLSAKGAYVVAGEGP 545

Query: 559 AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIA 618
             VT+ ++GSE+ IA+ A E+L++  ++  VVS+P +ELF  QS  YR  ++G    ++A
Sbjct: 546 RDVTLIATGSEVTIAMAARELLAADGLAAAVVSMPSWELFEAQSAEYREAVLGPRARRVA 605

Query: 619 IEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINA 660
           +EA    GW+ ++    + +GM GFGASG    LY+HFGI A
Sbjct: 606 VEAASAFGWERWVEDKTAVVGMPGFGASGPIGDLYEHFGITA 647


>gi|58699228|ref|ZP_00374031.1| transketolase [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225630201|ref|YP_002726992.1| transketolase [Wolbachia sp. wRi]
 gi|58534255|gb|EAL58451.1| transketolase [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225592182|gb|ACN95201.1| transketolase [Wolbachia sp. wRi]
          Length = 690

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/683 (52%), Positives = 472/683 (69%), Gaps = 34/683 (4%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MA+AIRFLS+DA++  NSGHPG+P+GMADV T LF + +  +P    W NRDRFVLS 
Sbjct: 7   ESMANAIRFLSIDAVQKANSGHPGMPLGMADVATVLFAKYLNHNPDDSKWFNRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y++LYL GY  ++I+++KNFR +GSKT GHPE+G  +G+EATTGPLGQG A A
Sbjct: 67  GHGSMLLYSILYLTGY--ISIDELKNFRQMGSKTPGHPEFGLTSGVEATTGPLGQGFATA 124

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+AE  L+E+FGD LI+HYTYV++GDGCLMEGIS EA S AGHL L+KLI L+D+N 
Sbjct: 125 VGMALAESILKEQFGDSLINHYTYVMLGDGCLMEGISHEAASLAGHLKLNKLIALFDDND 184

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ISIDG   L+ S D   RF A GWN   ++GHD  AI+  + +A+ SDKPTMI C+T+IG
Sbjct: 185 ISIDGATCLSCSDDVEKRFLAYGWNVDKIDGHDFDAISLAIEQAKKSDKPTMICCKTIIG 244

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ----- 314
             S +RAGT+ VH  A  +E+IK  R+ LNW+ +PF +P+D+   W+    R+ Q     
Sbjct: 245 KFS-SRAGTSSVHSGAFSEEDIKQMREKLNWNYEPFHVPEDVKNAWKKTVERAKQNYTMS 303

Query: 315 ----TRADWQERLSSMKSSIRKE-----------------FERRFSDALPDCFDNAFINL 353
               TR + +E +    + + +E                  +RR    LPD       +L
Sbjct: 304 FQRVTRKEEKEWIPVSSTGMTRESTGMTEENAGMTGYHVELQRRLDKHLPDNIAGVLADL 363

Query: 354 KKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGR 413
           KK+     P  ATR S   V+E++   +PELIGGSADLTGSN TK   M+ I  +++SG 
Sbjct: 364 KKQICELMPNEATRSSFGKVMELLTKSMPELIGGSADLTGSNCTKYEHMQVIDSNNYSGS 423

Query: 414 YLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDS 473
           Y+HYGVREHAMAA MNG+ALH  + PY GTF+VFSDY RPAIRL++LM  +V++V+THDS
Sbjct: 424 YVHYGVREHAMAACMNGMALHGAILPYGGTFLVFSDYCRPAIRLSALMKQQVMYVMTHDS 483

Query: 474 IGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL 533
           IG+GEDGPTHQP+EHLA+LRAIP+L V RPAD++ETLEC  +AL++K  P++ +LSRQN+
Sbjct: 484 IGVGEDGPTHQPIEHLASLRAIPNLYVFRPADAVETLECVSIALEKKESPALFALSRQNV 543

Query: 534 PFLRTQY----ESNNLCALGAYDYIS-TPNAQVTIFSSGSELKIAVEACEILSSRNISTR 588
            ++R  Y    +S NL   GAY     +   +VTIF++GSE++IAVEA E L  + I TR
Sbjct: 544 SYMRKFYSDIDQSANLSKFGAYILCECSKELKVTIFATGSEVEIAVEAREKLQEKGIGTR 603

Query: 589 VVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGS 648
           +VS+PC+ LF EQSD Y+A I+ +  IK+AIEAG   GW  +IGS+G FIGM+ FG S  
Sbjct: 604 IVSMPCWRLFDEQSDEYKAAILNNDSIKVAIEAGSEMGWHKYIGSNGIFIGMKSFGESAP 663

Query: 649 CDLLYQHFGINAIAIVDMVERKL 671
              LY+HF I+A  +V  V  KL
Sbjct: 664 YKTLYEHFNISADHVVKCVCEKL 686


>gi|153010225|ref|YP_001371439.1| transketolase [Ochrobactrum anthropi ATCC 49188]
 gi|151562113|gb|ABS15610.1| transketolase [Ochrobactrum anthropi ATCC 49188]
          Length = 666

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/649 (54%), Positives = 469/649 (72%), Gaps = 4/649 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D  ++A+ IR LS+DA++  NSGHPG+P+GMAD    LF++ + FD   P W +RDRFVL
Sbjct: 9   DMLQLANCIRALSIDAVDAANSGHPGMPLGMADAAAVLFSKHLKFDASAPNWADRDRFVL 68

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           S GHGSML Y+ LYL GY+DV+I+++KNFR  GSKTAGHPEYG   G+E TTGPLGQG+A
Sbjct: 69  SNGHGSMLLYSALYLAGYKDVSIDELKNFRQWGSKTAGHPEYGHTEGVELTTGPLGQGLA 128

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           ++VGMAIAER L ++FG  ++DH TYV  GDGCLMEG+ QEAIS AGHL L KLI+L+D+
Sbjct: 129 SSVGMAIAERALADQFGKDIVDHRTYVFCGDGCLMEGVGQEAISLAGHLRLGKLILLYDD 188

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDKPTMIACET 256
           NGI+IDG   +A + D  A+F+A GWN   V+GHDH AI + L +A+  +D+PT+IA +T
Sbjct: 189 NGITIDGSTEIAFTDDIPAKFKACGWNVEKVDGHDHDAIDAALTRAKAQADRPTLIALKT 248

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIG+GSPNRAGT+ VHG+ LG  E  AT+ AL W  + F +P  ++  WR AG R    R
Sbjct: 249 VIGYGSPNRAGTSGVHGAPLGAAENAATKAALGWTAEAFEVPAPLLNAWREAGARGVSER 308

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
             WQ+R+ ++ ++ R EF+RR +  LP+ F     + K++       +ATRK+S++ LE 
Sbjct: 309 EAWQKRVDTLPATERAEFDRRIAGVLPEGFAAVVHDAKQRLLDKPLNVATRKASQIALES 368

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +   LPE+IGGSADLT SN T+   + +    + SGRY+ YGVRE AM AAMNGIA+H G
Sbjct: 369 LTAALPEMIGGSADLTHSNLTRVPAVDSDFTPEKSGRYVSYGVREFAMGAAMNGIAVHGG 428

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
             PY GTFMVFSDY+R AIRL++LMG+RVI+VLTHDSIGLGEDGPTHQPVEHLA+LRA+P
Sbjct: 429 FIPYGGTFMVFSDYARNAIRLSALMGVRVIYVLTHDSIGLGEDGPTHQPVEHLASLRAMP 488

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           +L V RPAD+IETLECW VA+ + + PSVL+LSRQN+P LRT     NL A GAY     
Sbjct: 489 NLHVFRPADTIETLECWAVAVSDPHTPSVLALSRQNVPQLRTD-NGENLSARGAYVLREA 547

Query: 557 PNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
               Q+T+ ++G+E+ +AV+A E L+   I+T VVS+P ++LF +QS  YR  ++G +P 
Sbjct: 548 KGERQITLLATGTEVSLAVKAAEKLAEEGIATAVVSMPSWDLFEKQSKDYRNGVLGDAP- 606

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           +IA+EA  + GW  ++ S+   IGM GFGAS   ++LY+ FGI A AI+
Sbjct: 607 RIAVEAAGKFGWTRYVDSEDDVIGMDGFGASAPAEVLYEKFGITAEAII 655


>gi|116686995|ref|YP_840242.1| transketolase [Burkholderia cenocepacia HI2424]
 gi|116652710|gb|ABK13349.1| transketolase [Burkholderia cenocepacia HI2424]
          Length = 681

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/660 (53%), Positives = 457/660 (69%), Gaps = 3/660 (0%)

Query: 16  DDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRF 75
           D   + +A+ IRFL+MDA++N NSGHPG PMG+ADV T LF + M FD   P+W +RDR 
Sbjct: 20  DPHLRALANCIRFLAMDAVQNANSGHPGAPMGLADVATVLFKEFMQFDASAPHWIDRDRL 79

Query: 76  VLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQG 135
           VLS GH SML Y+LLYL GY D+T++++K FR +GSKT GHPEY    GIE TTGPLGQG
Sbjct: 80  VLSNGHASMLLYSLLYLTGYADMTLDELKRFRQVGSKTPGHPEYSHADGIELTTGPLGQG 139

Query: 136 IANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLW 195
           IA +VGMA+AER +   FGD L+DHYTYV +GDGCLMEGIS EAIS AGHL L KLI  W
Sbjct: 140 IAESVGMALAERVMNAHFGDDLVDHYTYVFLGDGCLMEGISHEAISLAGHLRLGKLIAFW 199

Query: 196 DNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLS-DKPTMIAC 254
           DNN ISIDGP  LA S ++  RF ++GW+ L ++GHD  AI   +  A+ + D+PT+IAC
Sbjct: 200 DNNSISIDGPTQLAVSDNEIERFHSAGWHVLEIDGHDTDAIRRAIETARTTHDRPTLIAC 259

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
            T+IGFG P +AGT K H  A G++EI   R+ L+W   PF IPDD++K WR  G R  +
Sbjct: 260 RTIIGFGFPTKAGTEKAHSDAPGEDEIAGARQTLDWHSPPFEIPDDLLKAWREIGARGRK 319

Query: 315 TRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
            R  W ER+S    ++R EF+RR +  LPD +  A    ++ F  +   +ATRK+S  VL
Sbjct: 320 ARLAWDERVSRAPHALRTEFDRRNAGKLPDDWKTAIAAARQAFVAAGSAMATRKASGEVL 379

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           + ++D +PEL+GGSADLT SN TKT    AI    F G Y+HYGVREH MAAAMNGIALH
Sbjct: 380 DQLSDAIPELLGGSADLTQSNNTKTKNQIAIEPGQFKGSYVHYGVREHGMAAAMNGIALH 439

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            GL PY GTF+ FSDY RPAIRL+++M +R I V+THDSIGLGEDGPTHQPVEHLAALRA
Sbjct: 440 GGLIPYGGTFLCFSDYCRPAIRLSAMMRVRAIFVMTHDSIGLGEDGPTHQPVEHLAALRA 499

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI 554
           IP L V RPAD +ET ECW++ L++  R ++L+LSRQ +P LR +  + N  A GAY   
Sbjct: 500 IPQLAVYRPADPVETAECWELILEQPRRAALLALSRQPVPLLRNEPGNENKSARGAYVLR 559

Query: 555 STPNA--QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
                  ++T+ ++GSE+ +AV+A +IL    + T VVS+PC  LF EQ   Y+  ++G+
Sbjct: 560 EADGGPRRLTLLATGSEVDLAVQARDILQQEGVPTAVVSMPCRLLFEEQPRDYQRAVLGT 619

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           SP ++A+EA +  GW+ ++G +G F+GM  FG SG    +Y+ F I   A+V    + LS
Sbjct: 620 SPARVAVEAAVELGWERYLGPEGRFVGMHSFGESGKIKDVYKKFDITVDAVVRAARQVLS 679


>gi|107029127|ref|YP_626222.1| transketolase [Burkholderia cenocepacia AU 1054]
 gi|105898291|gb|ABF81249.1| transketolase [Burkholderia cenocepacia AU 1054]
          Length = 681

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/660 (53%), Positives = 457/660 (69%), Gaps = 3/660 (0%)

Query: 16  DDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRF 75
           D   + +A+ IRFL+MDA++N NSGHPG PMG+ADV T LF + M FD   P+W +RDR 
Sbjct: 20  DPHLRALANCIRFLAMDAVQNANSGHPGAPMGLADVATVLFKEFMQFDASAPHWIDRDRL 79

Query: 76  VLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQG 135
           VLS GH SML Y+LLYL GY D+T++++K FR +GSKT GHPEY    GIE TTGPLGQG
Sbjct: 80  VLSNGHASMLLYSLLYLTGYADMTLDELKRFRQVGSKTPGHPEYSHADGIELTTGPLGQG 139

Query: 136 IANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLW 195
           IA +VGMA+AER +   FGD L+DHYTYV +GDGCLMEGIS EAIS AGHL L KLI  W
Sbjct: 140 IAESVGMALAERVMNAHFGDDLVDHYTYVFLGDGCLMEGISHEAISLAGHLRLGKLIAFW 199

Query: 196 DNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLS-DKPTMIAC 254
           DNN ISIDGP  LA S ++  RF ++GW+ L ++GHD  AI   +  A+ + D+PT+IAC
Sbjct: 200 DNNSISIDGPTQLAVSDNEIERFHSAGWHVLEIDGHDTDAIRRAIETARTTHDRPTLIAC 259

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
            T+IGFG P +AGT K H  A G++EI   R+ L+W   PF IPDD++K WR  G R  +
Sbjct: 260 RTIIGFGFPTKAGTEKAHSDAPGEDEIAGARQTLDWHSPPFEIPDDLLKAWREIGARGRK 319

Query: 315 TRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
            R  W ER+S    ++R EF+RR +  LPD +  A    ++ F  +   +ATRK+S  VL
Sbjct: 320 ARLAWDERVSRAPHALRTEFDRRNAGKLPDDWKTAIAAARQAFVAAGSAMATRKASGEVL 379

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           + ++D +PEL+GGSADLT SN TKT    AI    F G Y+HYGVREH MAAAMNGIALH
Sbjct: 380 DQLSDAIPELLGGSADLTQSNNTKTKNQIAIEPGQFKGSYVHYGVREHGMAAAMNGIALH 439

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            GL PY GTF+ FSDY RPAIRL+++M +R I V+THDSIGLGEDGPTHQPVEHLAALRA
Sbjct: 440 GGLIPYGGTFLCFSDYCRPAIRLSAMMRVRAIFVMTHDSIGLGEDGPTHQPVEHLAALRA 499

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI 554
           IP L V RPAD +ET ECW++ L++  R ++L+LSRQ +P LR +  + N  A GAY   
Sbjct: 500 IPQLAVYRPADPVETAECWELILEQPRRAALLALSRQPVPLLRNEPGNENKSARGAYVLR 559

Query: 555 STPNA--QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
                  ++T+ ++GSE+ +AV+A +IL    + T VVS+PC  LF EQ   Y+  ++G+
Sbjct: 560 EADGGPRRLTLLATGSEVDLAVQARDILQQEGVPTAVVSMPCRLLFEEQPRDYQWAVLGT 619

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           SP ++A+EA +  GW+ ++G +G F+GM  FG SG    +Y+ F I   A+V    + LS
Sbjct: 620 SPARVAVEAAVELGWERYLGPEGRFVGMHSFGESGKIKDVYKKFDITVDAVVRAARQVLS 679


>gi|330814405|ref|YP_004358644.1| transketolase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487500|gb|AEA81905.1| transketolase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 653

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/649 (52%), Positives = 448/649 (69%), Gaps = 9/649 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           +A+AIRFLS+DA++  NSGHPG+PMGMADV T LF   + FDP  P W NRDRFVLSAGH
Sbjct: 9   LANAIRFLSIDAVQKANSGHPGMPMGMADVCTVLFRHFLKFDPSRPGWINRDRFVLSAGH 68

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALLYL GY+ V++ DIKNFR + S  AGHPEY +  GIE TTGPLGQGIANAVG
Sbjct: 69  GSMLLYALLYLTGYKSVSLNDIKNFRQLDSICAGHPEYENGTGIETTTGPLGQGIANAVG 128

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
            AI+E  L+ + G  + +H TYV+ GDGCLMEGIS EA+S AGHL L  L++ +DNN IS
Sbjct: 129 FAISEEILKSKKGKDIYNHKTYVVAGDGCLMEGISHEALSLAGHLKLKNLVMFFDNNSIS 188

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDGP SLA S +   R  A GW+ + +NGH+   I   ++K Q + +PT+IAC+T IGFG
Sbjct: 189 IDGPTSLAVSDNYKKRLEAYGWDCIDINGHNEKQIFKAIKKCQNAKRPTVIACKTTIGFG 248

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           SPN++G +  HGS LG EEI+  RK L W   PF IP +I+++WR  G    +    W++
Sbjct: 249 SPNKSGKSSAHGSPLGDEEIQLVRKKLKWKHAPFEIPKEILQEWRSIGENGKKEVRKWEK 308

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           +  S    I  +  ++ +    D  + A        + +KP IATRKSSE +L ++   +
Sbjct: 309 KAGSKLKKITNKNSQKLTKLFADAKNMA-------IKETKP-IATRKSSEDILNLLTVHM 360

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           PELIGGSADL GSN TKT   K I   +F+G Y+HYGVREHAM   MNGIALH  L PY 
Sbjct: 361 PELIGGSADLAGSNNTKTKSQKIIKPGNFAGSYIHYGVREHAMCGIMNGIALHGELIPYG 420

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           GTF++FSDY +P+IRL++LM  RV++V+THDSIGLGEDGPTHQPVE +A LRAIP+L V 
Sbjct: 421 GTFLIFSDYCKPSIRLSALMKQRVVYVMTHDSIGLGEDGPTHQPVEQIAGLRAIPNLNVF 480

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD-YISTPNAQ 560
           RPAD+IET+ECW +AL++ N PSVLSL+RQNL  LRT+    N C+ GAY+ Y S P   
Sbjct: 481 RPADTIETIECWDLALRQTNTPSVLSLTRQNLKLLRTKNNQMNKCSYGAYEIYRSNPEIN 540

Query: 561 VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIE 620
           +TI ++GSE++IAVEA + L+  NI ++VVS+PC ELF +Q  SY+  ++  +  KI+IE
Sbjct: 541 LTIIATGSEVEIAVEASQQLTKENIHSKVVSMPCQELFEQQESSYKKNLLEETTAKISIE 600

Query: 621 AGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
           A    GW  + G+ G  +G+  FG S     +Y+HF + +  I+   ++
Sbjct: 601 AASTMGWKKYTGNQGVELGIDTFGKSAPYKKIYEHFKLTSNNIIQQAKK 649


>gi|58584921|ref|YP_198494.1| transketolase [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58419237|gb|AAW71252.1| Transketolase [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 654

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/657 (53%), Positives = 460/657 (70%), Gaps = 11/657 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA AIRFLS+DA++  +SGHPG+P+GMADV T LF Q +  +P  P W NRDRFVLS GH
Sbjct: 1   MASAIRFLSIDAVQKASSGHPGMPLGMADVATVLFAQYLNHNPDDPKWVNRDRFVLSNGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y++LYL GY  ++I+++KNFR + SKT GHPE+G   G+EATTGPLGQG A AVG
Sbjct: 61  GSMLLYSILYLTGY--ISIDELKNFRQLTSKTPGHPEFGLTPGVEATTGPLGQGFAVAVG 118

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AE  L+ +FG   I+HYTYV++GDGCLMEGIS EA S AGHL L+KLI L+D+N IS
Sbjct: 119 MALAESILKNQFG---INHYTYVMLGDGCLMEGISHEAASLAGHLKLNKLIALFDDNDIS 175

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG   L+ S D   RF A GWN   ++GHD ++I+  + +A+ SDKPT+I C+T+IG  
Sbjct: 176 IDGATHLSCSDDAEKRFSAYGWNVNKIDGHDFNSISLAIEQARKSDKPTLICCKTIIGKF 235

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           S NRAG +  H  A  +E++K  R+ LNW+  PF +P D+   W     R+ Q       
Sbjct: 236 S-NRAGASSAHSGAFTEEDVKQMREKLNWNYVPFHVPKDVKNAWMETVERAKQNYNSVSF 294

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           +  +++ S  KE +RR    LPD  D+   NLKK+   + P  ATR S   V+E++ + +
Sbjct: 295 QRQALEPSENKELQRRLDKRLPDNIDDDLANLKKQIHETMPNEATRSSFGKVMELLTESM 354

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           PELIGGSADLTGSN TK   MK I  +++SG Y+HYGVREHAMAA MNG+ALH G+ PY 
Sbjct: 355 PELIGGSADLTGSNCTKYKHMKVIDNNNYSGSYVHYGVREHAMAACMNGMALHGGILPYG 414

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           GTF+VFSDY RPAIRL++LM  +VI+V+THDSIG+GEDGPTHQP+EHLA+LR +P+L V 
Sbjct: 415 GTFLVFSDYCRPAIRLSALMKQQVIYVMTHDSIGVGEDGPTHQPIEHLASLRTVPNLYVF 474

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQY----ESNNLCALGAYDYIS-T 556
           RP D+IETLEC  +ALK+K  P++ +LSRQNL ++R  +    +S NL   GAY     +
Sbjct: 475 RPTDAIETLECISIALKKKESPALFALSRQNLGYMRKFHFNVDQSTNLSKSGAYVVCEYS 534

Query: 557 PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
              +VTIF++GSE++IA+E  + L  + I TRVVS+PC+ LF EQSD Y+  I+ +  IK
Sbjct: 535 EKLEVTIFATGSEVEIAIETRKKLQEKGIGTRVVSMPCWRLFDEQSDEYKDAILNNDSIK 594

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
           +AIEAG   GW  +IGS+G FIGM+ FG S     LY+HF IN   +V  V  KL +
Sbjct: 595 VAIEAGSEIGWHKYIGSNGIFIGMKSFGESAPYKTLYEHFNINTDYVVKCVCEKLFI 651


>gi|221369280|ref|YP_002520376.1| transketolase [Rhodobacter sphaeroides KD131]
 gi|221162332|gb|ACM03303.1| Transketolase [Rhodobacter sphaeroides KD131]
          Length = 657

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/654 (54%), Positives = 464/654 (70%), Gaps = 10/654 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIR L+MDA+E   SGHPG+PMGMADV T LF + +  DP  P WP+RDRFVLSAG
Sbjct: 11  RMANAIRALAMDAVEKAKSGHPGMPMGMADVATVLFNRFLTVDPSAPKWPDRDRFVLSAG 70

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YA+ +LLGY D+ ++ I++FR +G++TAGHPEYG   GIE TTGPLGQGIA AV
Sbjct: 71  HGSMLLYAIHHLLGYADMDMDQIRSFRQLGARTAGHPEYGHAEGIEVTTGPLGQGIATAV 130

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AER     +GD L+DH+TYV+ GDGCLMEGIS EAI  AGHLGL +LIVLWD+N I
Sbjct: 131 GMALAERMKNARYGDDLVDHFTYVIAGDGCLMEGISHEAIDMAGHLGLGRLIVLWDDNRI 190

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG   ++ STDQ ARF ASGW+ L+ +GH    I + +  A+   +P+MIAC TVIG+
Sbjct: 191 TIDGDTDISTSTDQKARFAASGWHVLACDGHAPEEIAAAIEAARRDPRPSMIACRTVIGY 250

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PN+ G + VHG+ LG  EI A R+ L WD  PF IP D+ + W     R ++ RA W+
Sbjct: 251 GAPNKQGGHDVHGAPLGAAEIAAARERLGWDHPPFEIPADLYEAWGRIAARGAEARAAWE 310

Query: 321 ERLSSMKSSIRKEFERRF---SDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            RL +  S +R  FE      + ALP     A    K +     P +ATRK+SE+ L VV
Sbjct: 311 TRLQA--SPLRAAFETAEAADTSALPP----AIAAYKARLSAEAPKVATRKASEMALGVV 364

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N+ LP  +GGSADLTGSN T++  M +I+   F+G Y+HYG+REH MAAAMNGIALH GL
Sbjct: 365 NEALPFAVGGSADLTGSNLTRSKGMVSIAPGAFAGSYIHYGIREHGMAAAMNGIALHGGL 424

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTFM F+DY RP+IRL++LMG+ V +V+THDSIGLGEDGPTHQPVEHLA+LRAIP+
Sbjct: 425 RPYGGTFMAFADYCRPSIRLSALMGVAVTYVMTHDSIGLGEDGPTHQPVEHLASLRAIPN 484

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           L V+RPAD++ET E W++A+   + P++L LSRQNLP +RT++   NL A GAY      
Sbjct: 485 LAVIRPADAVETAEAWEIAMTATSTPTLLVLSRQNLPTVRTEHRDENLTARGAYLLRDPG 544

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             QVT+ ++GSEL++A+ A ++L++  I+  VVS PCFELF  Q   YRA+++G +P ++
Sbjct: 545 ERQVTLIATGSELELALAAADLLAAEGIAAAVVSAPCFELFAAQPADYRAKVLGQAP-RV 603

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
             EA LRQGWD F+G    F+GM GFGAS     LYQHF I A  IV   + ++
Sbjct: 604 GCEAALRQGWDLFLGPQDGFVGMTGFGASAPAPALYQHFNITAETIVSSAKERI 657


>gi|77465274|ref|YP_354777.1| transketolase [Rhodobacter sphaeroides 2.4.1]
 gi|77389692|gb|ABA80876.1| transketolase [Rhodobacter sphaeroides 2.4.1]
          Length = 657

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/654 (54%), Positives = 463/654 (70%), Gaps = 10/654 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIR L+MDA+E   SGHPG+PMGMADV T LF + +  DP  P WP+RDRFVLSAG
Sbjct: 11  RMANAIRALAMDAVEKAKSGHPGMPMGMADVATVLFNRFLTVDPSAPKWPDRDRFVLSAG 70

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YA+ +LLGY D+ ++ I++FR +G++TAGHPEYG   GIE TTGPLGQGIA AV
Sbjct: 71  HGSMLLYAIHHLLGYADMDMDQIRSFRQLGARTAGHPEYGHAEGIEVTTGPLGQGIATAV 130

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AER     +GD L+DH+TYV+ GDGCLMEGIS EAI  AGHLGL +LIVLWD+N I
Sbjct: 131 GMALAERMKNARYGDDLVDHFTYVIAGDGCLMEGISHEAIDMAGHLGLGRLIVLWDDNRI 190

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG   ++ STDQ ARF ASGW+ L+ +GH    I + +  A+   +P+MIAC TVIG+
Sbjct: 191 TIDGDTGISTSTDQKARFAASGWHVLACDGHAPEEIAAAIEAARRDPRPSMIACRTVIGY 250

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PN+ G + VHG+ LG  EI A R+ L WD  PF IP D+ + W     R +  RA W+
Sbjct: 251 GAPNKQGGHDVHGAPLGAAEIAAARERLGWDHPPFEIPADLYEAWGRIAARGADARAAWE 310

Query: 321 ERLSSMKSSIRKEFERRF---SDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            RL +  S +R  FE      + ALP     A    K +     P +ATRK+SE+ L VV
Sbjct: 311 TRLQA--SPLRAAFETAEAADTSALPP----AIAAYKARLSAEAPKVATRKASEMALGVV 364

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N+ LP  +GGSADLTGSN T++  M +++   F+G Y+HYG+REH MAAAMNGIALH GL
Sbjct: 365 NEALPFAVGGSADLTGSNLTRSKGMVSVAPGAFAGSYIHYGIREHGMAAAMNGIALHGGL 424

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTFM F+DY RP+IRL++LMG+ V +V+THDSIGLGEDGPTHQPVEHLA+LRAIP+
Sbjct: 425 RPYGGTFMAFADYCRPSIRLSALMGVPVTYVMTHDSIGLGEDGPTHQPVEHLASLRAIPN 484

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           L V+RPAD++ET E W++A+   + P++L LSRQNLP +RT++   NL A GAY      
Sbjct: 485 LAVIRPADAVETAEAWEIAMTATSTPTLLVLSRQNLPTVRTEHRDENLTARGAYLLRDPG 544

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             QVT+ ++GSEL++A+ A ++L++  I+  VVS PCFELF  Q   YRA ++G +P ++
Sbjct: 545 ERQVTLIATGSELELALAAADLLAAEGIAAAVVSAPCFELFAAQPADYRATVLGRAP-RV 603

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
             EA LRQGWD F+G    F+GM GFGAS     LYQHF I A AIV   + ++
Sbjct: 604 GCEAALRQGWDLFLGPQDGFVGMTGFGASAPAPALYQHFNITAEAIVKSAKERI 657


>gi|295691442|ref|YP_003595135.1| transketolase [Caulobacter segnis ATCC 21756]
 gi|295433345|gb|ADG12517.1| transketolase [Caulobacter segnis ATCC 21756]
          Length = 653

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/642 (53%), Positives = 456/642 (71%), Gaps = 8/642 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           KMADAIR LSMDA+    SGH G+PMGMADV T L+++ + FD   P W +RDRFVLSAG
Sbjct: 7   KMADAIRVLSMDAVHKAKSGHQGMPMGMADVATVLWSKFLKFDASKPDWADRDRFVLSAG 66

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y+LL+L G++ VT+++I+NFR  GS T GHPE     G+E TTGPLGQG+A AV
Sbjct: 67  HGSMLLYSLLHLTGFKAVTMKEIENFRQWGSLTPGHPEVHHTPGVETTTGPLGQGLATAV 126

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AE  L   FG  L+DH T+V+ GDGCLMEG+S EAIS AG L L KL VL+D+N  
Sbjct: 127 GMAMAEAHLAARFGHELVDHRTWVIAGDGCLMEGVSHEAISIAGRLRLKKLTVLFDDNNT 186

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG  +++++ DQ ARF+A+GW    V+GHDH  I + LR A   D+PTMIAC+T+I  
Sbjct: 187 TIDGEATISETGDQVARFKAAGWAVKVVDGHDHGKIAAALRWATKQDRPTMIACKTLISK 246

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+  + G    HG  L  ++IKA R+A+ WD  PF +PDDI K W+  G R  + R  W+
Sbjct: 247 GAGPKEGDPHSHGYTLFDDQIKAAREAMGWDAAPFTMPDDIAKAWKSVGRRGGKVRKAWE 306

Query: 321 ERLSSMKSSIRKEFERRFSDALP-DCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
            +L++  ++   +F+R  +  LP + F+    ++ K  E +KP+ ATR  S   L+ +  
Sbjct: 307 AKLAAAINA--SDFKRAMAGELPANAFEALDAHIAKALE-TKPVNATRVHSGSALDHLVP 363

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            +PE+IGGSADLTGSN T    M A    D+ GRY+HYGVRE  MAAAMNG++LH G+ P
Sbjct: 364 TIPEMIGGSADLTGSNNTLVKGMGAFDTPDYKGRYVHYGVREFGMAAAMNGMSLHGGVIP 423

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           YSGTF+ F+DYSR AIRL +LM  RVIHV+THDSIGLGEDGPTHQPVEH+A+LRAIP+LL
Sbjct: 424 YSGTFLAFADYSRAAIRLGALMEARVIHVMTHDSIGLGEDGPTHQPVEHVASLRAIPNLL 483

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP-- 557
           V RPAD++E  ECW+VAL++   PSV++LSRQ  P +R Q    +L A GAY+ ++    
Sbjct: 484 VFRPADAVEAAECWKVALQQTRTPSVMTLSRQKTPHVRAQ--GGDLSAKGAYELLAAEGG 541

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
            AQVTIF+SG+E+ +AV A +IL ++   TRVVS PC+ELF +Q  +Y+A +IG +P+++
Sbjct: 542 EAQVTIFASGTEVGVAVAARDILQAKGKPTRVVSTPCWELFDKQDAAYQAAVIGKAPVRV 601

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           A+EAG+R GW+ FIG  G F+GM+ FGAS   ++LYQ FGI 
Sbjct: 602 AVEAGIRMGWERFIGETGKFVGMKSFGASAPFEVLYQKFGIT 643


>gi|163731387|ref|ZP_02138834.1| transketolase [Roseobacter litoralis Och 149]
 gi|161394841|gb|EDQ19163.1| transketolase [Roseobacter litoralis Och 149]
          Length = 681

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/659 (52%), Positives = 452/659 (68%), Gaps = 12/659 (1%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+   A+AIR L++DA+   NSGH G+P+GMAD  T LF + M FDP  P WP+RDRFVL
Sbjct: 12  DHWSKANAIRALALDAVAAANSGHSGMPIGMADAATVLFEKHMNFDPSAPNWPDRDRFVL 71

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALL+L GY+D+T+E IKNFR  G+ TAGHPEYG   GIE TTGPLGQGI+
Sbjct: 72  SAGHGSMLLYALLHLTGYKDMTLEQIKNFRQWGAITAGHPEYGHATGIETTTGPLGQGIS 131

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           NAVG A+AE   R  +G  ++DHYTYV+ GDGCLMEG+SQEAI+ AG   LSKL+VLWDN
Sbjct: 132 NAVGFAMAEEIQRAHYGKKVVDHYTYVIAGDGCLMEGVSQEAITLAGRHQLSKLVVLWDN 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           N I+IDGP+SL+D TDQ  RF ++GW+ + ++GHD   I + L +A+ + KPTMIAC+T 
Sbjct: 192 NNITIDGPVSLSDRTDQVGRFVSAGWDVIEIDGHDPKEIDAALTQAKKNQKPTMIACKTH 251

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           I  G   +  T+K HG+    E+  A + A  W   PF +PD +M  WR  G R   TR 
Sbjct: 252 IALGHAAQ-DTSKGHGALTNDEQNAAAKAAWGWTTGPFEVPDAVMDGWRAIGARGKSTRE 310

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            W+ R  ++    R+ F R ++  +P          KK+     P +ATR SSE VLEV+
Sbjct: 311 AWEARFDTLPRGKRETFNRAYALDVPKKLSATIKAFKKQMSEGAPKLATRASSEKVLEVI 370

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N  +PE +GGSADLTGSN TKTS +      +  GRY+++G+REH MAAAMNG+ALH GL
Sbjct: 371 NPIMPETVGGSADLTGSNNTKTSDLGVFDTDNRGGRYVYWGIREHGMAAAMNGMALHGGL 430

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTFM F+DY+RPA+RLA+LM I  + V+THDSIGLGEDGPTHQPVEHLA  RA P+
Sbjct: 431 RPYGGTFMCFTDYARPAMRLAALMKIPTVFVMTHDSIGLGEDGPTHQPVEHLAISRATPN 490

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY---DYI 554
             V RPAD+IET E W++AL  K+ PSVLSL+RQ LP +RT++++ N+ A G Y   D I
Sbjct: 491 TYVFRPADTIETAEAWELALSSKSTPSVLSLTRQGLPTVRTEHKTKNMVAQGGYVLADAI 550

Query: 555 STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSP 614
                Q  + ++GSE+ +A++A +IL +  I TRVVS+PC+ELF EQ ++ R +++   P
Sbjct: 551 G--KRQAILMATGSEVSLAMQARDILHAEGIGTRVVSMPCWELFEEQDEALRKRVLPGGP 608

Query: 615 IKIAIEAGLRQGWDAFI-GSDGS-----FIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           +++AIEAG+R GWD ++ G  G      FIGM  FGAS   D+L++  GI A A    V
Sbjct: 609 VRVAIEAGIRMGWDRWLFGERGKREKSGFIGMHDFGASAPADVLFKELGITAEATAQKV 667


>gi|118591563|ref|ZP_01548960.1| transketolase [Stappia aggregata IAM 12614]
 gi|118435891|gb|EAV42535.1| transketolase [Stappia aggregata IAM 12614]
          Length = 662

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/640 (54%), Positives = 444/640 (69%), Gaps = 5/640 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR L+MDA++   SGHPG PMG+ADV T LF + +  DP  P WP+RDRFVLSAGH
Sbjct: 14  MANAIRALAMDAVQAAKSGHPGAPMGLADVATVLFNRFIRIDPTDPAWPDRDRFVLSAGH 73

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
            SML YA+ +LLGY D+  E ++ FR +GS+TAGHPEYG   GIE TTGPLGQGIA AVG
Sbjct: 74  ASMLLYAIHHLLGYDDMDAEQLRRFRQLGSRTAGHPEYGHAKGIETTTGPLGQGIATAVG 133

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+ ER L   FGD L+DHYTYVL GDGCLMEGIS EAI  AGHLGL +L+V WD+N I+
Sbjct: 134 MALGERMLNARFGDDLVDHYTYVLAGDGCLMEGISHEAIDLAGHLGLGRLVVFWDDNRIT 193

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHD-HHAITSTLRKAQLSDKPTMIACETVIGF 260
           IDG   L+ S DQ  RF A+GW   +++GHD      +     + +D+P++IAC TVIG 
Sbjct: 194 IDGTTDLSTSMDQMKRFNAAGWQVQAIDGHDMDAIAAAIANACEETDRPSLIACNTVIGK 253

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PN+AG++KVHG  LG EEI ATRKAL+W    F IP  +   W     R       W+
Sbjct: 254 GAPNKAGSHKVHGEPLGDEEIAATRKALDWPHAAFEIPQPVRDAWEAVSRRGRIANEAWK 313

Query: 321 ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
            R ++       EF+  F++   D    A  + K++     P IATRK+SEL LEVVN  
Sbjct: 314 RRKAAHPRG--AEFDASFAEPDADTLGKAISDHKRQLSVDAPKIATRKASELALEVVNSV 371

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
           LP  IGGSADLTGSN T+TS M+A+S+++F G YLHYG+REH MAAAMNGI LH G   Y
Sbjct: 372 LPNTIGGSADLTGSNNTRTSGMRAVSRTNFGGNYLHYGIREHGMAAAMNGITLHGGFRAY 431

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
            GTF+ F+DY RP+IRL++LMG+ V +V+THDSIGLGEDGPTHQPVE LA+LRA+P+L+V
Sbjct: 432 GGTFLAFADYCRPSIRLSALMGVPVTYVMTHDSIGLGEDGPTHQPVETLASLRAMPNLIV 491

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQ 560
           +RPAD++ET E W++A   K  P+VL LSRQ LP +RT +   N    GAY       A+
Sbjct: 492 IRPADAVETAEAWEIAATAKKTPTVLCLSRQGLPTVRTDHTCENRTRRGAYLLKEPCGAR 551

Query: 561 -VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAI 619
            +T+ ++GSE++IA+ A ++L+   I   VVS P FELF  Q  +YR  ++G++P ++ +
Sbjct: 552 HLTLIATGSEVEIALAAADLLAINGIKAAVVSAPSFELFACQDQAYRDAVLGTAP-RVGV 610

Query: 620 EAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           EA +RQGWD  IGS G+F+GM GFGAS     LY+HFGI 
Sbjct: 611 EAAVRQGWDVLIGSGGTFVGMTGFGASAPASDLYEHFGIT 650


>gi|83859811|ref|ZP_00953331.1| transketolase [Oceanicaulis alexandrii HTCC2633]
 gi|83852170|gb|EAP90024.1| transketolase [Oceanicaulis alexandrii HTCC2633]
          Length = 662

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/647 (52%), Positives = 449/647 (69%), Gaps = 3/647 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + +A+A+R LSMDA+E  NSGHPG+PMGMAD  T L+T+ + FDP+   W +RDRFVLSA
Sbjct: 12  QPLANAVRALSMDAVEAANSGHPGMPMGMADAATVLWTRHIKFDPKDTEWADRDRFVLSA 71

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y++L+L+G   ++++++KNFR +GSKTAGHPE+G   GIE TTGPLGQG++ A
Sbjct: 72  GHGSMLLYSILHLIGVDALSLDELKNFRQLGSKTAGHPEFGHAPGIETTTGPLGQGLSTA 131

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+ ER +   +GD L+DH T+V+  DG L EG+SQEAIS AGHL L+KL+VLWD+N 
Sbjct: 132 VGMALGERIMNAHYGDDLVDHRTWVIASDGDLQEGVSQEAISIAGHLKLNKLVVLWDDNS 191

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           I IDG  +L+D+ +   RF ++GW T+ V+GHD  A+   L  A++SDKP +IAC+T IG
Sbjct: 192 IQIDGDTALSDTVNHRQRFESAGWTTMEVDGHDAAAVDKALNDAKMSDKPVLIACKTTIG 251

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
           FG+P +AGT   HG+ LG EEIK  R+AL W  +PF IPDDI + WR A     QTR  W
Sbjct: 252 FGAPTKAGTAGSHGAPLGAEEIKGAREALGWSHEPFVIPDDIYEGWRFAAELGGQTREAW 311

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           + RL++  S   + F+ + S   P    +A     KK    KP +ATR SS   +E   +
Sbjct: 312 EARLAA--SDKAEAFKAQISGQPPKAALDALDAHIKKTLADKPALATRASSGKAIEAFWE 369

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
             P LIGGSADLTGSN T+   M +I+  DFSG Y+HYGVRE  MAAAMNG+ALH GL P
Sbjct: 370 AFPGLIGGSADLTGSNNTRAPGMASITPDDFSGSYVHYGVREFGMAAAMNGLALHGGLRP 429

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           YSGTF+VFSDY R AIRL++LM   VI+V THDSIGLGEDGPTHQPVEHL ALR++P++ 
Sbjct: 430 YSGTFLVFSDYCRGAIRLSALMNQPVIYVFTHDSIGLGEDGPTHQPVEHLIALRSMPNVA 489

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP-N 558
           V RP D++E  E W+ AL+  + P+VL LSRQ  P  R    S NL A GAY        
Sbjct: 490 VYRPGDAVEAAEAWKCALERTDGPTVLVLSRQKAPHARQDDGSENLSAKGAYVIREAEGE 549

Query: 559 AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIA 618
           AQ+T+  +G+EL +A+EA + L +R ++ RVVS P  E F +Q  +YR  ++      +A
Sbjct: 550 AQITLIGTGTELGLALEAQDKLKARGVNARVVSAPSLETFLKQDAAYRKSVVNPDLPVVA 609

Query: 619 IEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
           +EA +R GWD  IG +G F+GM+GFGAS   + L++HFGI A A+V+
Sbjct: 610 VEAAIRWGWDGLIGLEGGFVGMEGFGASAPAEALFEHFGITADAVVE 656


>gi|300023139|ref|YP_003755750.1| transketolase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524960|gb|ADJ23429.1| transketolase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 669

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/651 (55%), Positives = 459/651 (70%), Gaps = 7/651 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MA+AIR L+MDA++  NSGHPG+PMGMADV T LFT+ + FDP  P W NRDRFVLSA
Sbjct: 17  RDMANAIRALAMDAVQAANSGHPGMPMGMADVATVLFTEALKFDPAVPGWANRDRFVLSA 76

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY  +TIE++KNFR  GSKTAGHPEYG   GIE TTGPLGQG+ANA
Sbjct: 77  GHGSMLLYALLHLTGYPGMTIEELKNFRQFGSKTAGHPEYGHAPGIETTTGPLGQGLANA 136

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VG+A++ER L    G+ LID++TYV+ GDGCLMEGISQEAIS AGHL L KLIVLWD+N 
Sbjct: 137 VGIALSERLLAARVGNDLIDYHTYVIAGDGCLMEGISQEAISLAGHLKLGKLIVLWDDNS 196

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDKPTMIACETVI 258
           ISIDG  SLA S ++  RF ASGWNT  V+GHD  AI + ++ A+  S +P +IAC+TVI
Sbjct: 197 ISIDGATSLAVSDNELERFAASGWNTARVDGHDPAAIAAAIKAAKGDSSRPWLIACKTVI 256

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           G+G+PN+AG +  HG  LG EEIKATR+ L+W   PF +PD I+  WR  G R ++T AD
Sbjct: 257 GYGAPNKAGKSSAHGEPLGGEEIKATRERLDWPYQPFDVPDHILSAWRAVGSRGAKTYAD 316

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W +RLS   +  +     R  D        A           +   ATR  S+L LE + 
Sbjct: 317 WAKRLSGANAEAKALISGRKLDTALASAIAAAKTAFAADATKR---ATRVWSQLTLEHLV 373

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             LPEL+GGSADLTGSN TKT    +I+  +F+G Y+HYGVREH MAAAMNGIAL     
Sbjct: 374 PALPELVGGSADLTGSNLTKTKAQVSITPENFAGNYVHYGVREHGMAAAMNGIALSGSFI 433

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+VF+DY RP+IRL++LM  RV++V+THDSIGLGEDGPTHQPVEHL+ALRAIP+L
Sbjct: 434 PYGGTFLVFTDYCRPSIRLSALMEQRVVYVMTHDSIGLGEDGPTHQPVEHLSALRAIPNL 493

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN 558
            V RPAD IET ECW++A+  K  PS+L+LSRQ +P LR+    N   A GAY   ++  
Sbjct: 494 NVFRPADGIETAECWELAIAAKKTPSILALSRQAVPNLRSDGPENQ-SAKGAYVVKASEG 552

Query: 559 AQ-VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
           A+ VT+ ++GSE+ +A+EA   L+   +S  VVS+P FELF  Q +SYR  ++G +P ++
Sbjct: 553 ARDVTLIATGSEVGVAIEAAAALAKNGVSAAVVSMPSFELFRAQPESYRNSVLGEAP-RV 611

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           AIEAG+ Q W  ++     F+GM GFGAS     L+QHFGI A  + D+ +
Sbjct: 612 AIEAGVAQSWYEWLRPSDKFVGMPGFGASAPAAKLFQHFGITAAHVADIAQ 662


>gi|146280018|ref|YP_001170175.1| transketolase [Rhodobacter sphaeroides ATCC 17025]
 gi|145558259|gb|ABP72870.1| transketolase [Rhodobacter sphaeroides ATCC 17025]
          Length = 657

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/652 (54%), Positives = 457/652 (70%), Gaps = 6/652 (0%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA AIR L+MDA+E   SGHPG+PMGMADV T LF + M  DP  P WP+RDRFVLSAG
Sbjct: 11  RMAHAIRALAMDAVEKAKSGHPGMPMGMADVATVLFNRFMTIDPAAPKWPDRDRFVLSAG 70

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YA+ +LLGY D+ ++ I++FR +G++TAGHPEYG   GIE TTGPLGQGIA AV
Sbjct: 71  HGSMLLYAIHHLLGYADMDMDQIRSFRQLGARTAGHPEYGHADGIEVTTGPLGQGIATAV 130

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AER     +G+ L+DHYTYV+ GDGCLMEGIS EAI  AGHLGL +LIVLWD+N I
Sbjct: 131 GMALAERMKAARYGEALVDHYTYVIAGDGCLMEGISHEAIDMAGHLGLGRLIVLWDDNRI 190

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG  +++ STDQ ARF A+GW+  + +GH    I + +  A+   +P+MIAC TVIGF
Sbjct: 191 TIDGDTAISTSTDQMARFAAAGWHVQACDGHAPEEIAAAIEAARRDPRPSMIACRTVIGF 250

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWR-LAGLRSSQTRADW 319
           G+PN+ G + VHG+ LG EEI A R  L W+  PF IP D+   W  +A   ++   A  
Sbjct: 251 GAPNKQGGHDVHGAPLGAEEIAAARAFLGWEHAPFEIPADLYAAWHGIAERGAAARAAWE 310

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
               +S   +  +  E   + ALP     A    K K    KP +ATRK+SE+ LEVVN 
Sbjct: 311 ARLAASPARAAFEAAEAGDTSALPP----AIAAYKAKLSADKPKVATRKASEMALEVVNA 366

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            LP  +GGSADLTGSN T++  M +++   F G Y+HYG+REH MAAAMNGIALH GL P
Sbjct: 367 ALPFSVGGSADLTGSNLTRSKGMVSVTPGAFGGSYIHYGIREHGMAAAMNGIALHGGLRP 426

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTFM F+DY RP+IRL++LMG+ V +V+THDSIGLGEDGPTHQPVEHLA+LRAIP+L 
Sbjct: 427 YGGTFMAFADYCRPSIRLSALMGVPVTYVMTHDSIGLGEDGPTHQPVEHLASLRAIPNLT 486

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA 559
           V+RPAD++ET E W++A+     P++L LSRQNLP +RT++ + NL A GAY      N 
Sbjct: 487 VIRPADAVETAEAWEIAMTATATPTLLVLSRQNLPTVRTEHGAENLTARGAYLLRDPANR 546

Query: 560 QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAI 619
           QVT+ ++GSEL++A+ A + L+   I+  VVS P FELF  Q   YRA+I+G++P ++  
Sbjct: 547 QVTLIATGSELELALAAADRLAEEGIAAAVVSAPAFELFAAQPADYRAKILGTAP-RVGC 605

Query: 620 EAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           EA LRQGWD F+G    F+GM GFGAS     LYQHF I A AIV   + ++
Sbjct: 606 EAALRQGWDLFLGPQDGFVGMTGFGASAPAPALYQHFNITADAIVAEAKNRI 657


>gi|254295175|ref|YP_003061198.1| transketolase [Hirschia baltica ATCC 49814]
 gi|254043706|gb|ACT60501.1| transketolase [Hirschia baltica ATCC 49814]
          Length = 660

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/654 (53%), Positives = 461/654 (70%), Gaps = 4/654 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MA+AIR LS DAIE    GH GLP+GMAD  T LF+Q + FD   P W +RDRF+LSA
Sbjct: 9   RDMANAIRALSTDAIEQAGIGHLGLPLGMADAATVLFSQFLKFDASKPDWADRDRFILSA 68

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY  V++E+I+NFR +GSKT GHPE     G+E TTGPLGQGIA A
Sbjct: 69  GHGSMLIYSLLHLTGYPSVSMEEIRNFRQLGSKTPGHPENFVTEGVETTTGPLGQGIATA 128

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VG A+AER +   +GD L+DHYTYV+ GDGCLMEGISQEAI+ AGHL L KLIVL+D+N 
Sbjct: 129 VGFAVAERSMNARYGDDLVDHYTYVIAGDGCLMEGISQEAIALAGHLKLGKLIVLFDDNA 188

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDKPTMIACETVI 258
           ++IDG   +ADSTDQ ARF AS W+  +++GHD  A+ + L  A+  +D+P+MIAC+T I
Sbjct: 189 VTIDGGTDVADSTDQCARFAASKWHVQAIDGHDPVAVAAALTAAKANTDQPSMIACKTTI 248

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFG+P  AG  K HG     +E  A R+ L    + F +  ++++ WR  G+R+S  RA 
Sbjct: 249 GFGAPTFAGQGKAHGGPYPADETAALRENLGLPKERFTVVPEVLEAWRAVGVRASDERAG 308

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W+  L++  S    EF R     LP   D A    KK    +    ATRK S   LEV+ 
Sbjct: 309 WEASLAA--SGKADEFTRAMDGRLPAGVDEAVNAHKKAVSEANKSDATRKWSGAALEVLT 366

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             +PE+IGGSADLTGSN T+TS   A++ SD++GRY+HYGVREH MAAAMNG+ALH G+ 
Sbjct: 367 GIIPEMIGGSADLTGSNNTRTSHTSALNSSDWAGRYMHYGVREHGMAAAMNGMALHGGVF 426

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PYSGTFM F+DYSR AIRL +LM   V+HV+THDSIGLGEDGPTHQPVEH+A+LRA+P+L
Sbjct: 427 PYSGTFMAFADYSRGAIRLGALMEAPVVHVMTHDSIGLGEDGPTHQPVEHVASLRAMPNL 486

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP- 557
            V RP D +ET+E WQVAL  +  PS+++L+RQ +   R ++   NL A G Y       
Sbjct: 487 YVFRPCDGVETMEAWQVALGLRQSPSIMTLTRQGVVPARIEHTDENLVAKGGYILREAEG 546

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
            AQ+ +  +GSE+ +A+EA E+L ++ ++ RVVS+PC +LFFEQS++Y+++++G S  K+
Sbjct: 547 EAQIVLIGTGSEVGLALEAQELLKAKGVAARVVSMPCMDLFFEQSEAYQSEVLGGSLPKV 606

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           A EAG+R GWDA IG++G F+GM GFGAS   + LY+HF I + A+V+   +++
Sbjct: 607 ATEAGVRFGWDAIIGTEGGFVGMTGFGASAPAEDLYKHFNITSEAVVEEALKRV 660


>gi|89054191|ref|YP_509642.1| transketolase [Jannaschia sp. CCS1]
 gi|88863740|gb|ABD54617.1| transketolase [Jannaschia sp. CCS1]
          Length = 671

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/668 (50%), Positives = 452/668 (67%), Gaps = 8/668 (1%)

Query: 11  VLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWP 70
            L   + D+   A  IR L++DA+   NSGH G+PMGMADV T LF + + FD   P WP
Sbjct: 5   ALASANPDHWARAACIRTLTLDAVAAANSGHSGMPMGMADVATVLFDKHLSFDASNPDWP 64

Query: 71  NRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTG 130
           NRDRF+LSAGHGSML Y+LL+L GY+D+T+E IKNFR +G+ TAGHPEYG   G+E TTG
Sbjct: 65  NRDRFILSAGHGSMLIYSLLHLTGYKDMTLEQIKNFRQLGAITAGHPEYGHVKGVETTTG 124

Query: 131 PLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSK 190
           PLGQGIANAVG A+AE  LR ++G  +IDHYTY + GDGCLMEGISQEA++ AGH  LS+
Sbjct: 125 PLGQGIANAVGFAMAEEHLRAKWGKKIIDHYTYCIAGDGCLMEGISQEALALAGHQELSR 184

Query: 191 LIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPT 250
           LIV+WDNN I+IDG +SL+D TDQ ARF ASGW+  S +GHD   I   L +A+ S  P 
Sbjct: 185 LIVMWDNNNITIDGEVSLSDRTDQMARFAASGWDVFSCDGHDPADIDRALTEAKASPGPA 244

Query: 251 MIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGL 310
           MIAC+T I  GS  +  T K HG+    + I  T++A  W   PF IP D+   W   G 
Sbjct: 245 MIACKTHIAIGSSAQ-DTGKGHGALTDDKLIADTKEAYGWPHAPFDIPKDLKSWWEGVGS 303

Query: 311 RSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSS 370
           + ++ R  W+E+  +M +  R EF R F+  +P          KK+    KP +ATRK+S
Sbjct: 304 KGAEARQAWEEQFDAMSAGKRAEFNRTFAGEMPKKLSATIKAFKKQLSDEKPKVATRKAS 363

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           ++ LEV+N  +PE +GGSADLTGSN T T  +   +  D  GR++HYG+REHAMAAAMNG
Sbjct: 364 QMALEVINTVVPETLGGSADLTGSNLTNTGGLGTFAPDDRKGRHIHYGIREHAMAAAMNG 423

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           + LH G+ PY GTF  F+DY+RP++RLA+LM I  ++V+THDSIG+GEDGPTHQPVEHLA
Sbjct: 424 MILHGGVKPYGGTFFTFTDYARPSMRLAALMKIAPVYVMTHDSIGVGEDGPTHQPVEHLA 483

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
            LRA P++ V RPAD++ET E W++AL   + PS L+LSRQ LP LRT++++ NL A G 
Sbjct: 484 MLRATPNMNVFRPADAVETAEAWELALTSTDTPSTLALSRQGLPLLRTEHKTKNLTAQGG 543

Query: 551 YDYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
           Y         Q  + ++GSE+ IA+ A ++L +  I TRVVS+PC+ELF  Q ++YR ++
Sbjct: 544 YVLADAEGKRQAILMATGSEVAIAMAARDLLQAEGIGTRVVSLPCWELFEAQDEAYRKRV 603

Query: 610 IGSSPIKIAIEAGLRQGWDAFIGSD------GSFIGMQGFGASGSCDLLYQHFGINAIAI 663
           +   P+++A+EA +R GWD ++  +      G F+GM  FGAS   + LY HFGI A  +
Sbjct: 604 LPGGPVRVAVEAAIRFGWDRWLYGERGKRDKGGFVGMHDFGASAPAEDLYTHFGITAEDV 663

Query: 664 VDMVERKL 671
              V+  L
Sbjct: 664 AAKVKSLL 671


>gi|304320123|ref|YP_003853766.1| transketolase [Parvularcula bermudensis HTCC2503]
 gi|303299026|gb|ADM08625.1| transketolase [Parvularcula bermudensis HTCC2503]
          Length = 655

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/651 (56%), Positives = 473/651 (72%), Gaps = 10/651 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA A+  L+ DA+E   SGHPG+PMGMADV T LFT+ MVFD   P WP+RDRFVLSAGH
Sbjct: 1   MAAALSVLAADAVEAAKSGHPGMPMGMADVATVLFTKHMVFDAGAPDWPDRDRFVLSAGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y LL+LLGY+D+T+E+IK FR IG+KTAGHPEYG   GIE TTGPLGQG+ANAVG
Sbjct: 61  GSMLLYGLLHLLGYEDMTLEEIKQFRQIGAKTAGHPEYGHAKGIETTTGPLGQGLANAVG 120

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MAIAE  L   FG  L++HYTYV+ GDGCLMEGISQEA+S AGHL L+KLIVLWD+NGI+
Sbjct: 121 MAIAEAHLAARFGADLVNHYTYVIAGDGCLMEGISQEALSLAGHLRLNKLIVLWDDNGIT 180

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG +S+AD TDQ ARF+ASGW TLS +GHD  AI + L +A+  D P +IAC+T IG G
Sbjct: 181 IDGKVSVADRTDQLARFKASGWATLSCDGHDPDAIDAALTEAKSLDAPVLIACKTTIGRG 240

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +P +AGT  +HG+ LG +E+   RKAL+W+ DPF +PDDI+  WR AG +    R++W+ 
Sbjct: 241 APQKAGTAGIHGAPLGADELAGLRKALSWEDDPFVVPDDIVGAWRAAGTKGRAARSEWEA 300

Query: 322 RLSS--MKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           RL +   K ++   F    S A     D A    +   E +KP +ATRK+S+ VLEV+N+
Sbjct: 301 RLEANGQKEALTALFSGDTSSAQAAVLDYA---ARLTTEDAKP-VATRKASQNVLEVINE 356

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
                +GGSADLTGSN TKT      +    +GRYLHYG+REHAMAAAMNG+ALH G+ P
Sbjct: 357 TTTLTMGGSADLTGSNNTKTGATSPFTADSPAGRYLHYGIREHAMAAAMNGMALHGGVLP 416

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTF+VFSDY R A+RL++LMGI+VI+VLTHDSIGLGEDGPTHQPVEHLA+LRA+P++ 
Sbjct: 417 YGGTFLVFSDYMRGAMRLSALMGIQVIYVLTHDSIGLGEDGPTHQPVEHLASLRAMPNMT 476

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA 559
           VLRPAD++ET E W VAL  +  P+ L+L+RQNLP LR +    N  A G Y       A
Sbjct: 477 VLRPADAVETAEAWAVALGHRTGPTALALTRQNLPLLRGEAGGENRTARGGYVLAEAAGA 536

Query: 560 QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAI 619
             TI ++GSE++IAV+A + L +   + R+VS+P  +LF  Q ++Y+ Q++G++P ++A+
Sbjct: 537 AATIIATGSEVEIAVDAAKQLEAEGHAIRIVSMPSVDLFASQDETYQQQVLGTAP-RVAV 595

Query: 620 EAGLRQGWDAFI---GSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           EAG+ QGWD ++   G  G+F+GM  FGASG    LYQHFG+ A  + + V
Sbjct: 596 EAGVAQGWDRWLFAFGGRGAFVGMDSFGASGPYKDLYQHFGLTAERVAETV 646


>gi|6694730|gb|AAF25377.1|AF211846_4 transketolase [Sinorhizobium medicae WSM419]
          Length = 695

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/651 (53%), Positives = 451/651 (69%), Gaps = 13/651 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MADAIRFLSMDA+E  NSGHPG+PMGMAD VT LF + +  DP  P WP+RDRFVLSA
Sbjct: 16  RNMADAIRFLSMDAVEKANSGHPGMPMGMADAVTVLFNRFIRIDPSLPDWPDRDRFVLSA 75

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+L +L+G+ D+ + ++ +FR +GSKTAGHPEYG   GIE TTGPLGQG++ A
Sbjct: 76  GHGSMLLYSLHHLIGFADMPMAELSSFRQLGSKTAGHPEYGHALGIETTTGPLGQGMSTA 135

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+AE+ +   FG VL +H+TYV+ GDGCL EGIS E +  AGHL L KL VLWD+N 
Sbjct: 136 VGMAMAEQMMASRFGSVLCNHFTYVVAGDGCLQEGISHEVMDLAGHLKLRKLFVLWDDNR 195

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ISIDG   L+   +Q+ARFRA+ W+  +V+GHD  A+   L +A+ + KP++IAC T IG
Sbjct: 196 ISIDGSTDLSTWMNQFARFRAASWDAQAVDGHDPEAVAKALERARRTRKPSLIACRTRIG 255

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
            G+ +  G++K HG+ALG +EI ATR+ L W   PFF+P +I   W     R    R  W
Sbjct: 256 KGAASMEGSHKTHGAALGDKEIAATREKLGWPHPPFFVPPEIRAAWAKVAARGRTAREAW 315

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSK----PMIATRKSSELVLE 375
             RL + +S      ++R+   +   FD    +L  KF  +       +ATR++S++ LE
Sbjct: 316 DIRLDASRS------KKRYEQTIRRQFDGELGDLLAKFRSAHRTRATKVATRQASQMALE 369

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
           V+N      IGG AD TGSN T TSQ + IS  +F GRYLHYG+R+H MAAAMNGIALH 
Sbjct: 370 VINGATALTIGGWADRTGSNLTMTSQTQPISPGNFKGRYLHYGIRQHGMAAAMNGIALHG 429

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
           G  PY GTF+VFSDY+R A+RL++LMG+ VI+V   DSIGLGEDGPTHQPVEHLA LRA 
Sbjct: 430 GFIPYGGTFLVFSDYARGAMRLSALMGLPVIYVKKKDSIGLGEDGPTHQPVEHLAMLRAT 489

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI- 554
           P+L V RPAD IET ECW++AL EKN PSVL+LSRQ LP LR    + N  ALGAY    
Sbjct: 490 PNLNVFRPADIIETAECWEIALGEKNTPSVLALSRQALPMLRRTEGNENQSALGAYVLRE 549

Query: 555 STPNAQVTIFSSGSELKIAVEACEILSSRN-ISTRVVSVPCFELFFEQSDSYRAQIIGSS 613
           +  N  +TI ++GSE++IAV A E L +   I+  VVS+PC+E F  Q  +YR +++G +
Sbjct: 550 ARGNRDITILATGSEVEIAVAAAERLQAEEGIAAAVVSMPCWEKFEVQDLAYRRKVLGDA 609

Query: 614 PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           P +IAIEA  R GWD ++G DG+F+GM GFGAS     LY+HFGI A  +V
Sbjct: 610 P-RIAIEAAGRLGWDRWMGPDGAFVGMTGFGASAPAGDLYRHFGITADHVV 659


>gi|170734718|ref|YP_001773832.1| transketolase [Burkholderia cenocepacia MC0-3]
 gi|169820756|gb|ACA95337.1| transketolase [Burkholderia cenocepacia MC0-3]
          Length = 681

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/660 (53%), Positives = 456/660 (69%), Gaps = 3/660 (0%)

Query: 16  DDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRF 75
           D   + +A+ IRFL+MDA++N NSGHPG PMG+ADV T LF + M FD   P+W +RDR 
Sbjct: 20  DPHLRALANCIRFLAMDAVQNANSGHPGAPMGLADVATVLFKEFMQFDASAPHWIDRDRL 79

Query: 76  VLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQG 135
           VLS GH SML Y+LLYL GY D+T++++K FR +GSKT GHPEY    GIE TTGPLGQG
Sbjct: 80  VLSNGHASMLLYSLLYLTGYADMTLDELKRFRQVGSKTPGHPEYSHADGIELTTGPLGQG 139

Query: 136 IANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLW 195
           IA +VGMA+AER +   FGD L+DHYTYV +GDGCLMEGIS+EAIS AGHL L +LI  W
Sbjct: 140 IAESVGMALAERVMNAHFGDDLVDHYTYVFLGDGCLMEGISREAISLAGHLRLGRLIAFW 199

Query: 196 DNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLS-DKPTMIAC 254
           DNN ISIDG   LA S ++  RF ++GW+ L ++GHD  AI   +  A+ + D+PT+IAC
Sbjct: 200 DNNSISIDGATKLAVSDNEIERFHSAGWHVLEIDGHDTDAIRRAIETARTTHDRPTLIAC 259

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFG P +AGT K H  A G++EI   R+AL+W   PF IPDD++K WR  G R   
Sbjct: 260 KTIIGFGFPTKAGTEKAHSDAPGEDEIAGARQALDWHSPPFEIPDDLLKAWREIGARGRT 319

Query: 315 TRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
            R  W ER+     ++R EF+RR +  LPD +  A    ++ F  +   +ATRK+S  VL
Sbjct: 320 ARLAWDERVRRAPQALRTEFDRRNAGKLPDDWKTAIAAARQAFVAAGSAMATRKASGEVL 379

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           + + D +PEL+GGSADLT SN TKT    AI    F G Y+HYGVREH MAAAMNGIALH
Sbjct: 380 DHLFDAIPELLGGSADLTQSNNTKTKNQIAIEPGQFKGSYVHYGVREHGMAAAMNGIALH 439

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            GL PY GTF+ FSDY RPAIRL+++M +R I V+THDSIGLGEDGPTHQPVEHLAALRA
Sbjct: 440 GGLIPYGGTFLCFSDYCRPAIRLSAMMRVRAIFVMTHDSIGLGEDGPTHQPVEHLAALRA 499

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI 554
           IP L V RPAD +ET ECW++ L++  R ++L+LSRQ +P LR +  + N  A GAY   
Sbjct: 500 IPQLAVYRPADPVETAECWELILEQPRRAALLALSRQPVPLLRNEPGNENKSARGAYVLR 559

Query: 555 STPNA--QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
                  ++T+ ++GSE+ +AV+A +IL    + T VVS+PC  LF EQ   Y+  ++G+
Sbjct: 560 EADGGPRRLTLLATGSEVDLAVQARDILQQEGVPTAVVSMPCRLLFEEQPRDYQRAVLGT 619

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           SP ++A+EA +  GW+ ++G +G F+GM  FG SG    +Y+ F I   A+V    + LS
Sbjct: 620 SPARVAVEAAVELGWERYLGPEGRFVGMHSFGESGKIKDVYKKFDITVGAVVRAAHQVLS 679


>gi|1063590|gb|AAB06805.1| transketolase [Rhodobacter capsulatus]
          Length = 672

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/661 (51%), Positives = 452/661 (68%), Gaps = 7/661 (1%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ K+A AIR L++DA++  NSGHPG+PMGMADV T LF   + FD + P W +RDRFVL
Sbjct: 12  DHWKLATAIRVLAIDAVQAANSGHPGMPMGMADVATVLFRNHLKFDAKAPNWADRDRFVL 71

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALL+L GY+  T++++KNFR  G++ AGHPEYG   G+E TTGPLGQGI+
Sbjct: 72  SAGHGSMLLYALLHLTGYEQATLDEVKNFRQWGARMAGHPEYGHLEGVETTTGPLGQGIS 131

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
            AVGMAIAE+ +   FG  L+DH  +V+ GDGCLMEGISQEAI  AG   L  LIVLWDN
Sbjct: 132 TAVGMAIAEKSMAARFGKKLVDHKIWVIAGDGCLMEGISQEAIGLAGKQELDNLIVLWDN 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           N I+IDG ++++D TDQ ARF ASGW+ LS +GHD   I   L  A+ + +P ++ C+T+
Sbjct: 192 NNITIDGRVTVSDVTDQKARFAASGWDVLSCDGHDAEDIDRALTAAKKAKRPVLVDCKTL 251

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IGFGSPN+A +  VHG+ LG  EIK TR+A  W+  PF IP +I  +W   G + +  RA
Sbjct: 252 IGFGSPNKADSYAVHGAPLGDAEIKLTREAYGWEHGPFVIPAEIKAEWEAIGAKGAAERA 311

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
           +W+ RL+++ +  R EFER+ +  +      A    KK    + P +ATRK+SE+VL  V
Sbjct: 312 EWEARLAALPAGKRAEFERQMARGVAPKLAGAIRAFKKAQSEAAPKVATRKASEMVLAAV 371

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N  +       ADLTGSN TKTS ++     +  GRY+ YG+REHAMAAAMNG+ LH G+
Sbjct: 372 NPVVLRNHRRLADLTGSNLTKTSDIEDFMPGNHKGRYMRYGIREHAMAAAMNGMWLHGGV 431

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTF  F+DY+R A+RL+SLMG+  ++V+THDSIGLGEDGPTHQPVEHL   RA P+
Sbjct: 432 RPYGGTFFCFTDYARGAMRLSSLMGVPTVYVMTHDSIGLGEDGPTHQPVEHLTICRATPN 491

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
               RPAD IET E W++AL  +  PSVL+LSRQNLP LRT++E+ NL A GAY      
Sbjct: 492 TWTFRPADVIETAEAWELALSSERTPSVLALSRQNLPTLRTKHEAKNLTAKGAYVIAEAE 551

Query: 558 NA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
              Q  + ++GSE++IA++A  +L +  I TRVVS+PC ELF  Q ++YR +I+ +  ++
Sbjct: 552 GKRQAILMATGSEVEIALKARALLQAEAIGTRVVSMPCMELFAAQDEAYRKRILPAGGVR 611

Query: 617 IAIEAGLRQGWDAF-IGSDG-----SFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERK 670
           +A+EA +RQ WD + +G  G      F+GM+GFGAS   + LY  FGI   AI   V+  
Sbjct: 612 VAVEAAIRQPWDRWLLGERGMERKAGFVGMEGFGASAPAERLYAEFGITPEAIAAKVKSL 671

Query: 671 L 671
           L
Sbjct: 672 L 672


>gi|126464738|ref|YP_001045851.1| transketolase [Rhodobacter sphaeroides ATCC 17029]
 gi|126106549|gb|ABN79079.1| transketolase [Rhodobacter sphaeroides ATCC 17029]
          Length = 657

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/654 (54%), Positives = 461/654 (70%), Gaps = 10/654 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIR L+MDA+E   SGHPG+PMGMAD  T LF + +  DP  P WP+RDRFVLSAG
Sbjct: 11  RMANAIRALAMDAVEKAKSGHPGMPMGMADAATVLFNRFLTVDPSAPKWPDRDRFVLSAG 70

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YA+ +LLGY D+ ++ I++FR +G++TAGHPEYG   GIE TTGPLGQGIA AV
Sbjct: 71  HGSMLLYAIHHLLGYADMDMDQIRSFRQLGARTAGHPEYGHADGIEVTTGPLGQGIATAV 130

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AER     + D L+DH+TYV+ GDGCLMEGIS EAI  AGHLGL +LIVLWD+N I
Sbjct: 131 GMALAERMKNARYDDDLVDHFTYVIAGDGCLMEGISHEAIDMAGHLGLGRLIVLWDDNRI 190

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG   ++ STDQ ARF ASGW+ L+ +GH    I + +  A+   +P+MIAC TVIG+
Sbjct: 191 TIDGDTGISTSTDQKARFAASGWHVLACDGHAPEEIAAAIEAARRDPRPSMIACRTVIGY 250

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PN+ G + VHG+ LG  EI A R+ L WD  PF IP D+ + W     R +  RA W+
Sbjct: 251 GAPNKQGGHDVHGAPLGAAEIAAARERLGWDHPPFEIPADLYEAWGRIAARGADARAAWE 310

Query: 321 ERLSSMKSSIRKEFERRF---SDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            RL +  S +R  FE      + ALP     A    K +     P +ATRK+SE+ L VV
Sbjct: 311 TRLQA--SPLRAAFETAEAADTSALPP----AIAAYKARLSAEAPKVATRKASEMALGVV 364

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N+ LP  +GGSADLTGSN T++  M +++   F+G Y+HYG+REH MAAAMNGIALH GL
Sbjct: 365 NEALPFAVGGSADLTGSNLTRSKGMVSVAPGAFAGSYIHYGIREHGMAAAMNGIALHGGL 424

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTFM F+DY RP+IRL++LMG+ V +V+THDSIGLGEDGPTHQPVEHLA+LRAIP+
Sbjct: 425 RPYGGTFMAFADYCRPSIRLSALMGVPVTYVMTHDSIGLGEDGPTHQPVEHLASLRAIPN 484

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           L V+RPAD++ET E W++A+   + P++L LSRQNLP +RT++   NL A GAY      
Sbjct: 485 LAVIRPADAVETAEAWEIAMTATSTPTLLVLSRQNLPTVRTEHRDENLTARGAYLLRDPG 544

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             QVT+ ++GSEL++A+ A ++L++  I+  VVS PCFELF  Q   YRA ++G +P ++
Sbjct: 545 ERQVTLIATGSELELALAAADLLAAEGIAAAVVSAPCFELFAAQPADYRATVLGQAP-RV 603

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
             EA LRQGWD F+G    F+GM GFGAS     LYQHF I A AIV   + ++
Sbjct: 604 GCEAALRQGWDLFLGPQDGFVGMTGFGASAPAPALYQHFNITAEAIVSSAKERI 657


>gi|254250592|ref|ZP_04943911.1| transketolase [Burkholderia cenocepacia PC184]
 gi|124879726|gb|EAY67082.1| transketolase [Burkholderia cenocepacia PC184]
          Length = 681

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/660 (52%), Positives = 453/660 (68%), Gaps = 3/660 (0%)

Query: 16  DDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRF 75
           D   + +A+ IRFL+MDA++N NSGHPG PMG+ADV T LF + M FD   P+W +RDR 
Sbjct: 20  DPHLRALANCIRFLAMDAVQNANSGHPGAPMGLADVATVLFKEFMQFDASAPHWIDRDRL 79

Query: 76  VLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQG 135
           VLS GH SML Y+LLYL GY D+T++++K FR +GSKT GHPEY    GIE TTGPLGQG
Sbjct: 80  VLSNGHASMLLYSLLYLTGYADMTLDELKRFRQVGSKTPGHPEYSHADGIELTTGPLGQG 139

Query: 136 IANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLW 195
           IA ++GMA+AER +   FGD L+DHYTYV +GDGCLMEGIS EAIS AGHL L +LI  W
Sbjct: 140 IAESIGMALAERVMNAHFGDDLVDHYTYVFLGDGCLMEGISHEAISLAGHLRLGRLIAFW 199

Query: 196 DNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLS-DKPTMIAC 254
           DNN ISIDG   LA S ++  RF ++GW+ L ++GHD  AI   +  A+ + D+PT+IAC
Sbjct: 200 DNNSISIDGATKLAVSDNEIERFHSAGWHVLEIDGHDTDAIRRAIETARTTNDQPTLIAC 259

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
            T+IGFG P +AGT K H  A G++EI   R+AL+W   PF IPDD++K WR  G R   
Sbjct: 260 RTIIGFGFPTKAGTEKAHSDAPGEDEIAGARQALDWHSPPFEIPDDLLKAWREIGARGRT 319

Query: 315 TRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
            R  W ER+     ++R EF+RR +  LPD +  A    +  F  +   +ATRK+S  VL
Sbjct: 320 ARLAWDERVRRAPQALRTEFDRRNAGKLPDDWKTAIAAARHAFVAAGSAMATRKASGEVL 379

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           + + D +PEL+GGSADLT SN TKT    AI    F G Y+HYGVREH MAAAMNGIALH
Sbjct: 380 DHLFDAIPELLGGSADLTQSNNTKTKNQIAIEPGQFKGSYVHYGVREHGMAAAMNGIALH 439

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            GL PY GTF+ FSDY RPAIRL+++M +R I V+THDSIGLGEDGPTHQPVEHLAALRA
Sbjct: 440 GGLIPYGGTFLCFSDYCRPAIRLSAMMRVRAIFVMTHDSIGLGEDGPTHQPVEHLAALRA 499

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI 554
           IP L V RPAD +ET ECW++ L++  R ++L+LSRQ +P LR +  + N  A GAY   
Sbjct: 500 IPQLAVYRPADPVETAECWELILEQPRRAALLALSRQPVPLLRNEPGNENKSARGAYVLR 559

Query: 555 STPNA--QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
                  ++T+ ++GSE+ +AV+A +IL    + T VVS+PC  LF EQ   Y+  ++G+
Sbjct: 560 EADGGPRRLTLLATGSEVDLAVQARDILQQEGVPTAVVSMPCRLLFEEQPRDYQRAVLGT 619

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           SP ++A+EA +  GW+ ++G +G F+GM  FG SG    +Y+ F I   A+V    + LS
Sbjct: 620 SPARVAVEAAVELGWERYLGPEGRFVGMHSFGESGKIKDVYKKFDITVDAVVRAAHQVLS 679


>gi|221236671|ref|YP_002519108.1| transketolase [Caulobacter crescentus NA1000]
 gi|220965844|gb|ACL97200.1| transketolase [Caulobacter crescentus NA1000]
          Length = 671

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/642 (53%), Positives = 452/642 (70%), Gaps = 8/642 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           KMADAIR LSMDA+    SGH G+PMGMADV T L+ + + FD   P W +RDRFVLSAG
Sbjct: 25  KMADAIRVLSMDAVHKAKSGHQGMPMGMADVATVLWGKFLKFDASKPDWADRDRFVLSAG 84

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y+LL+L G++ +T+++I+NFR  G+ T GHPE     G+E TTGPLGQG+A AV
Sbjct: 85  HGSMLLYSLLHLTGFKAMTMKEIENFRQWGALTPGHPEVHHTPGVETTTGPLGQGLATAV 144

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AE  L   +G  L+DH T+V+ GDGCLMEG+S EAIS AG L LSKL VL+D+N  
Sbjct: 145 GMAMAEAHLAARYGSDLVDHRTWVIAGDGCLMEGVSHEAISIAGRLKLSKLTVLFDDNNT 204

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG  ++A++ DQ ARF+A+GW    V+GHDH  I + LR A   D+PTMIAC+T+I  
Sbjct: 205 TIDGVATIAETGDQVARFKAAGWAVKVVDGHDHGKIAAALRWATKQDRPTMIACKTLISK 264

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+  + G    HG  L   EI A+R A+ WD  PF +PDDI K W+  G R ++ R  W+
Sbjct: 265 GAGPKEGDPHSHGYTLFDNEIAASRVAMGWDAAPFTVPDDIAKAWKSVGRRGAKVRKAWE 324

Query: 321 ERLSSMKSSIRKEFERRFSDALP-DCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
            +L++  S    +F R     LP + F+    ++ K  E +KP+ ATR  S   LE +  
Sbjct: 325 AKLAA--SPKGADFTRAMKGELPANAFEALDAHIAKALE-TKPVNATRVHSGSALEHLIP 381

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            +PE+IGGSADLTGSN T    M A     + GRY+HYGVRE  MAAAMNG+ALH G+ P
Sbjct: 382 AIPEMIGGSADLTGSNNTLVKGMGAFDAPGYEGRYVHYGVREFGMAAAMNGMALHGGIIP 441

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           YSGTF+ F+DYSR AIRL +LM  RV+HV+THDSIGLGEDGPTHQPVEH+A+LRAIP+LL
Sbjct: 442 YSGTFLAFADYSRAAIRLGALMEARVVHVMTHDSIGLGEDGPTHQPVEHVASLRAIPNLL 501

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP-- 557
           V RPAD++E  ECW+ AL+ +  PSV++LSRQ  P +RTQ    +L A GAY+ ++    
Sbjct: 502 VFRPADAVEAAECWKAALQHQRTPSVMTLSRQKTPHVRTQ--GGDLSAKGAYELLAAEGG 559

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
            AQVTIF+SG+E+ +AV A +IL ++   TRVVS PC+ELF +Q  +Y+A +IG +P+++
Sbjct: 560 EAQVTIFASGTEVGVAVAARDILQAKGKPTRVVSTPCWELFDQQPAAYQAAVIGKAPVRV 619

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           A+EAG++ GW+ FIG +G FIGM+GFGAS   + LY+ FGI 
Sbjct: 620 AVEAGVKMGWERFIGENGKFIGMKGFGASAPFERLYKEFGIT 661


>gi|135908|sp|P29277|TKT_RHOSH RecName: Full=Transketolase; Short=TK
 gi|151990|gb|AAA26155.1| transketolase [Rhodobacter sphaeroides]
          Length = 657

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/654 (54%), Positives = 461/654 (70%), Gaps = 10/654 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIR L+MDA+E   SGHPG+PMGMADV T LF + +  DP  P WP+RDRFVLSAG
Sbjct: 11  RMANAIRALAMDAVEKAKSGHPGMPMGMADVATVLFNRFLTVDPSAPKWPDRDRFVLSAG 70

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YA+ +LLGY D+ ++ I++FR +G++TAGHPEYG   GIE TTGPLGQGIA AV
Sbjct: 71  HGSMLLYAIHHLLGYADMDMDQIRSFRQLGARTAGHPEYGHAEGIEVTTGPLGQGIATAV 130

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AER     +GD L+DH+TYV+ GDGCLMEGIS EAI   GHLGL +LIVLWD+N I
Sbjct: 131 GMALAERMKNARYGDDLVDHFTYVIAGDGCLMEGISHEAIDMGGHLGLGRLIVLWDDNRI 190

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG   ++ STDQ A F ASGW+ L+ +GH    I + +  A+   +P+MIAC TVIG+
Sbjct: 191 TIDGDSGISTSTDQKAPFAASGWHVLACDGHAPEEIAAAIEAARRDPRPSMIACRTVIGY 250

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PN+ G + VHG+ LG  EI A R+ L WD  PF IP D+ + W     R +  RA W+
Sbjct: 251 GAPNKQGGHDVHGAPLGAAEIAAARERLGWDHPPFEIPADLYEAWGRIAARGADARAAWE 310

Query: 321 ERLSSMKSSIRKEFERRF---SDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            RL +  S +R  FE      + ALP     A    K +     P +ATRK+SE+ L VV
Sbjct: 311 TRLQA--SPLRAAFETAEAADTSALPP----AIAAYKARLSAEAPKVATRKASEMALGVV 364

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N+ LP  +GGSADLTGSN T++  M +++   F+G Y+HYG+REH MAAAMNGIALH GL
Sbjct: 365 NEALPFAVGGSADLTGSNLTRSKGMVSVAPGAFAGSYIHYGIREHGMAAAMNGIALHGGL 424

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTFM F+DY RP+IRL++LMG+ V +V+THDSIGLGEDGPTHQPVEHLA+LRAIP+
Sbjct: 425 RPYGGTFMAFADYCRPSIRLSALMGVPVTYVMTHDSIGLGEDGPTHQPVEHLASLRAIPN 484

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           L V+RPAD++ET E W++A+   + P++L LSRQNLP +RT++   NL A GAY      
Sbjct: 485 LAVIRPADAVETAEAWEIAMTATSTPTLLVLSRQNLPTVRTEHRDENLTARGAYLLRDPG 544

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             QVT+ ++GSEL++A+ A ++L++  I+  VVS PCFELF  Q   YRA ++G +P ++
Sbjct: 545 ERQVTLIATGSELELALAAADLLAAEGIAAAVVSAPCFELFAAQPADYRATVLGRAP-RV 603

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
             EA LRQGWD F+G    F+GM GFGAS     LYQHF I A AIV   + ++
Sbjct: 604 GCEAALRQGWDLFLGPQDGFVGMTGFGASAPAPALYQHFNITAEAIVKSAKERI 657


>gi|16127850|ref|NP_422414.1| transketolase [Caulobacter crescentus CB15]
 gi|13425370|gb|AAK25582.1| transketolase I [Caulobacter crescentus CB15]
          Length = 653

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/642 (53%), Positives = 452/642 (70%), Gaps = 8/642 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           KMADAIR LSMDA+    SGH G+PMGMADV T L+ + + FD   P W +RDRFVLSAG
Sbjct: 7   KMADAIRVLSMDAVHKAKSGHQGMPMGMADVATVLWGKFLKFDASKPDWADRDRFVLSAG 66

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y+LL+L G++ +T+++I+NFR  G+ T GHPE     G+E TTGPLGQG+A AV
Sbjct: 67  HGSMLLYSLLHLTGFKAMTMKEIENFRQWGALTPGHPEVHHTPGVETTTGPLGQGLATAV 126

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AE  L   +G  L+DH T+V+ GDGCLMEG+S EAIS AG L LSKL VL+D+N  
Sbjct: 127 GMAMAEAHLAARYGSDLVDHRTWVIAGDGCLMEGVSHEAISIAGRLKLSKLTVLFDDNNT 186

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG  ++A++ DQ ARF+A+GW    V+GHDH  I + LR A   D+PTMIAC+T+I  
Sbjct: 187 TIDGVATIAETGDQVARFKAAGWAVKVVDGHDHGKIAAALRWATKQDRPTMIACKTLISK 246

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+  + G    HG  L   EI A+R A+ WD  PF +PDDI K W+  G R ++ R  W+
Sbjct: 247 GAGPKEGDPHSHGYTLFDNEIAASRVAMGWDAAPFTVPDDIAKAWKSVGRRGAKVRKAWE 306

Query: 321 ERLSSMKSSIRKEFERRFSDALP-DCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
            +L++  S    +F R     LP + F+    ++ K  E +KP+ ATR  S   LE +  
Sbjct: 307 AKLAA--SPKGADFTRAMKGELPANAFEALDAHIAKALE-TKPVNATRVHSGSALEHLIP 363

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            +PE+IGGSADLTGSN T    M A     + GRY+HYGVRE  MAAAMNG+ALH G+ P
Sbjct: 364 AIPEMIGGSADLTGSNNTLVKGMGAFDAPGYEGRYVHYGVREFGMAAAMNGMALHGGIIP 423

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           YSGTF+ F+DYSR AIRL +LM  RV+HV+THDSIGLGEDGPTHQPVEH+A+LRAIP+LL
Sbjct: 424 YSGTFLAFADYSRAAIRLGALMEARVVHVMTHDSIGLGEDGPTHQPVEHVASLRAIPNLL 483

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP-- 557
           V RPAD++E  ECW+ AL+ +  PSV++LSRQ  P +RTQ    +L A GAY+ ++    
Sbjct: 484 VFRPADAVEAAECWKAALQHQRTPSVMTLSRQKTPHVRTQ--GGDLSAKGAYELLAAEGG 541

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
            AQVTIF+SG+E+ +AV A +IL ++   TRVVS PC+ELF +Q  +Y+A +IG +P+++
Sbjct: 542 EAQVTIFASGTEVGVAVAARDILQAKGKPTRVVSTPCWELFDQQPAAYQAAVIGKAPVRV 601

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           A+EAG++ GW+ FIG +G FIGM+GFGAS   + LY+ FGI 
Sbjct: 602 AVEAGVKMGWERFIGENGKFIGMKGFGASAPFERLYKEFGIT 643


>gi|332560882|ref|ZP_08415200.1| transketolase [Rhodobacter sphaeroides WS8N]
 gi|332274680|gb|EGJ19996.1| transketolase [Rhodobacter sphaeroides WS8N]
          Length = 657

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/654 (54%), Positives = 462/654 (70%), Gaps = 10/654 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIR L+MDA+E   SGHPG+PMGMADV T LF + +  DP  P WP+RDRFVLSAG
Sbjct: 11  RMANAIRALAMDAVEKARSGHPGMPMGMADVATVLFNRFLTVDPSAPKWPDRDRFVLSAG 70

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YA+ +LLGY D+ ++ I++FR +G++TAGHPEYG   GIE TTGPLGQGIA AV
Sbjct: 71  HGSMLLYAIHHLLGYADMDMDQIRSFRQLGARTAGHPEYGHADGIEVTTGPLGQGIATAV 130

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AER     +GD L+DH+TYV+ GDGCLMEGIS EAI  AGHLGL +LIVLWD+N I
Sbjct: 131 GMALAERMKNARYGDDLVDHFTYVIAGDGCLMEGISHEAIDMAGHLGLGRLIVLWDDNRI 190

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG   ++ STDQ ARF ASGW+ ++ +GH    I + +  A+   +P+MIAC TVIG+
Sbjct: 191 TIDGDTGISTSTDQKARFAASGWHVVACDGHAPEEIAAAIEAARRDPRPSMIACRTVIGY 250

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PN+ G + VHG+ LG  EI A R+ L WD  PF IP D+ + W     R +  RA W+
Sbjct: 251 GAPNKQGGHDVHGAPLGAAEIAAARERLGWDHPPFEIPADLYEAWGRIAARGADARAAWE 310

Query: 321 ERLSSMKSSIRKEFERRF---SDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            RL +  S +R  FE      + ALP     A    K +     P +ATRK+SE+ L VV
Sbjct: 311 TRLQA--SPLRAAFETAEAADTSALPP----AIAAYKARLSAEAPKVATRKASEMALGVV 364

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N+ LP  +GGSADLTGSN T++  M +++   F+G Y+HYG+REH MAAAMNGIALH GL
Sbjct: 365 NEALPFAVGGSADLTGSNLTRSKGMVSVAPGAFAGSYIHYGIREHGMAAAMNGIALHGGL 424

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTFM F+DY RP+IRL++LMG+ V +V+THDSIGLGEDGPTHQPVEHLA+LRAIP+
Sbjct: 425 RPYGGTFMAFADYCRPSIRLSALMGVPVTYVMTHDSIGLGEDGPTHQPVEHLASLRAIPN 484

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           L V+RPAD++ET E W++A+   + P++L LSRQNLP +RT++   N  A GAY      
Sbjct: 485 LAVIRPADAVETAEAWEIAMTATSTPTLLVLSRQNLPTVRTEHRDENPTARGAYLLRDPG 544

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             QVT+ ++GSEL++A+ A ++L++  I+  VVS PCFELF  Q   YRA+++G +P ++
Sbjct: 545 ERQVTLIATGSELELALAAADLLAAEGIAAAVVSAPCFELFAAQPADYRAKVLGQAP-RV 603

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
             EA LRQGWD F+     F+GM GFGAS     LYQHF I A AIV   + ++
Sbjct: 604 GCEAALRQGWDLFLAPQDGFVGMTGFGASAPAPALYQHFNITAEAIVKSAKERI 657


>gi|310816552|ref|YP_003964516.1| transketolase [Ketogulonicigenium vulgare Y25]
 gi|308755287|gb|ADO43216.1| transketolase [Ketogulonicigenium vulgare Y25]
          Length = 682

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/660 (51%), Positives = 446/660 (67%), Gaps = 18/660 (2%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+   A AIR L++DA+   NSGH G+PMGMADV T LF + + FDP+ P W +RDRF+L
Sbjct: 12  DHWMKAAAIRTLTLDAVAAANSGHSGMPMGMADVATVLFEKHLRFDPKAPRWADRDRFIL 71

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YAL+YL GY+D+T++ IK+FR  G++TAGHPEYG  AGIE TTGPLGQGIA
Sbjct: 72  SAGHGSMLVYALMYLTGYEDITLQQIKDFRQWGARTAGHPEYGHAAGIETTTGPLGQGIA 131

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           N+VG AIAE  LR  FG  LI+HYTYV+ GDGCLMEG+SQEAI  AG   LS LIV WDN
Sbjct: 132 NSVGFAIAEEHLRARFGTSLINHYTYVIAGDGCLMEGVSQEAIGLAGKQELSHLIVFWDN 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           NGI+IDG + +AD T+Q ARF ASGW+   ++GHD  AI + +  A+   +P+MIAC+T 
Sbjct: 192 NGITIDGKVDIADVTNQPARFAASGWHVQEIDGHDPVAINTAIEAAKKDKRPSMIACKTH 251

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           I  GS  +  T+K HG+    + I   + A  W    F +P  I   W   G R +   A
Sbjct: 252 IALGSSAQ-DTSKGHGALTDAKLIADAKAAYGWTAGAFEVPAQIKAGWEAMGQRGAAAHA 310

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
           +W  R +++  + + +FER F    P         LKK+    +P +ATRKSSE+VL+VV
Sbjct: 311 EWTARFNALSDTKKADFERIFRAEAPKGLPAKIRALKKEISEKQPKVATRKSSEMVLDVV 370

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N  + E IGGSADLTGSN T T  +      +  GRY+++G+REH MAAAMNG+ LH G+
Sbjct: 371 NPLMKETIGGSADLTGSNNTLTKDLGTFGVENRKGRYVYFGIREHGMAAAMNGMVLHGGV 430

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTFM F+DY+R A+RL++LMG  VI+V+THDSIGLGEDGPTHQPVEHL+ LRA P+
Sbjct: 431 RPYGGTFMAFTDYARGAMRLSALMGAPVIYVMTHDSIGLGEDGPTHQPVEHLSMLRATPN 490

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-ST 556
             V RPAD++ET E W++AL   + PSVL+LSRQNLP +R  + + NL A GAY    +T
Sbjct: 491 TYVFRPADTVETAEAWEIALTSTSTPSVLALSRQNLPTVRKTHTNTNLTAKGAYVLAEAT 550

Query: 557 PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
              QV + +SGSE++IA+ A + L +  I TRVVSVP  ELF  Q ++YR +++ + P +
Sbjct: 551 GKRQVILMASGSEVEIALAARDQLEAAGIGTRVVSVPSMELFRAQDEAYRKRVLPAGPAR 610

Query: 617 IAIEAGLRQGWDAFIG----------------SDGSFIGMQGFGASGSCDLLYQHFGINA 660
           IAIEAG+RQ WD  +G                +  +F+GM+GFGAS   ++LY+ FGI A
Sbjct: 611 IAIEAGVRQSWDWLVGVRQSWDWLLLGERGREAKAAFVGMEGFGASAPAEVLYEKFGITA 670


>gi|307293280|ref|ZP_07573126.1| transketolase [Sphingobium chlorophenolicum L-1]
 gi|306881346|gb|EFN12562.1| transketolase [Sphingobium chlorophenolicum L-1]
          Length = 654

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/654 (52%), Positives = 452/654 (69%), Gaps = 8/654 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K +A+AIR LSMDA++  NSGHPG+PMGMADV T LF   + FDP+ P W +RDRFVLSA
Sbjct: 6   KSLANAIRALSMDAVQAANSGHPGMPMGMADVATVLFKDYLKFDPKAPKWADRDRFVLSA 65

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY   TI+DI NFR IGS  AGHPE    AG+EATTGPLG G+A A
Sbjct: 66  GHGSMLIYSLLHLTGYAKPTIQDIANFRQIGSPCAGHPENFELAGVEATTGPLGSGLATA 125

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAER L  +FGD ++DH T+VL GDGCLMEG++ EAI  AGHL L +LIVLWD+N 
Sbjct: 126 VGMAIAERHLNAQFGDEIVDHRTWVLAGDGCLMEGVNHEAIGLAGHLNLGRLIVLWDDNK 185

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           I+IDG + L+ S D  AR+ A+GW+ +S +GHD   +   + +A    +P+++AC T IG
Sbjct: 186 ITIDGAVDLSSSEDVRARYAATGWHVVSCDGHDVADVRRAIDEALADPRPSLVACATKIG 245

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
           +G+PN+AGT+ VHGSALG+ E+ A R+ L W  +PF IP+DI   W+  G +     A W
Sbjct: 246 YGAPNKAGTSGVHGSALGEAEVAAAREFLGWTAEPFVIPEDIAAAWKAIGAKGGDAHAAW 305

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFD-NAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
            +RL S  +  + EFERR +  LP  F  +A+I+       +   +ATR++SEL L  +N
Sbjct: 306 ADRLGS--NGQKAEFERRMAGELPAGFSLDAYID---TLIANPQKVATRRASELALGAIN 360

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
           D LPE +GGSADLTGSN TKT     ++K D+SGRY++YG+RE  MA AMNG+ALH G+ 
Sbjct: 361 DLLPETLGGSADLTGSNNTKTKSTGPLTKDDYSGRYVYYGIREFGMACAMNGMALHGGVI 420

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+VFSDY R  IRLA+L   RVIHVLTHDSIGLGEDGPTHQP+EH+ +LR IP+L
Sbjct: 421 PYGGTFLVFSDYMRGGIRLAALQQTRVIHVLTHDSIGLGEDGPTHQPIEHVMSLRMIPNL 480

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY-ISTP 557
            V RPAD +ET ECW++ALK+ N PSVL+L+RQNLP LRT+ +S NL A GAY    +T 
Sbjct: 481 DVYRPADIVETAECWELALKDANGPSVLALTRQNLPQLRTE-KSENLSAKGAYRLKAATA 539

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             +V + ++GSE++IAV    +L  + I   VVS+P +  F  Q  +Y+  ++    ++ 
Sbjct: 540 ERKVVLVATGSEVEIAVATAALLEEQGIGADVVSMPSWAHFDAQPQAYKDDLLPHHVLRA 599

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +IEAG   GW+ + G  G   G+  FGAS   ++LY HFG+ A  I   +   L
Sbjct: 600 SIEAGTTFGWERYTGIAGLRFGIDSFGASAPAEVLYDHFGLTAAKIAPQIAAAL 653


>gi|85373868|ref|YP_457930.1| transketolase [Erythrobacter litoralis HTCC2594]
 gi|84786951|gb|ABC63133.1| transketolase [Erythrobacter litoralis HTCC2594]
          Length = 659

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/651 (52%), Positives = 451/651 (69%), Gaps = 5/651 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR LSMDA++  NSGHPG+PMGMADV T L++Q + FDP  P W +RDRFVLSAGH
Sbjct: 11  MANAIRALSMDAVQAANSGHPGMPMGMADVATVLWSQFLKFDPAAPDWADRDRFVLSAGH 70

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+LL+L GY   T+EDI+NFR +GS  AGHPE     G+E TTGPLGQG+A AVG
Sbjct: 71  GSMLIYSLLHLSGYAQPTMEDIRNFRQLGSPCAGHPENFLLPGVECTTGPLGQGLAMAVG 130

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER L   FGD L+DH T+V+ GDGCLMEGI+ EAI  AGHL L +L VLWD+N I+
Sbjct: 131 MAMAERHLNALFGDDLVDHRTWVIAGDGCLMEGINHEAIGLAGHLKLGRLNVLWDDNNIT 190

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG   L+ S D  AR+ A+GW+    +GHD   I   L +A   D+P+++AC+TVIG G
Sbjct: 191 IDGETDLSTSEDIKARYAATGWHVAECDGHDFADIARALEEAAADDRPSLVACKTVIGKG 250

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +PN+ GT+  HG+ALG++E+ A R+ L WD +PF IP+DI+  WR  G R       W+ 
Sbjct: 251 APNKQGTSATHGAALGEDEVAAARETLGWDAEPFVIPEDILADWRSTGERGRDAHGAWES 310

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           R+    S  + EF+RR +  LP    +A  +       +   +ATRK+SE+ L  +N  L
Sbjct: 311 RVDG--SEHKDEFQRRMAGELP--HGDASKDYIASLVENPAKVATRKASEMALAEINSRL 366

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           P+ IGGSADLTGSN TK   ++A++  D+SGRY++YG+RE  MAAAMNG+ALH G+ PY 
Sbjct: 367 PDTIGGSADLTGSNNTKAGGIEAMTADDYSGRYVYYGIREFGMAAAMNGMALHGGVIPYG 426

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           GTF+VF+DY+R AIRL++L   RVI+V+THDSIGLGEDGPTHQPVEHLA+LRA+P+LLV+
Sbjct: 427 GTFLVFTDYARGAIRLSALQEARVIYVMTHDSIGLGEDGPTHQPVEHLASLRAMPNLLVM 486

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA-Q 560
           RPAD++ET ECW++AL+   RPS+L+LSRQ LP +R +    NL   G Y   +     +
Sbjct: 487 RPADAVETAECWEIALRNATRPSILALSRQGLPQMRLEAVDGNLSEKGGYRIKAAETERR 546

Query: 561 VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIE 620
           V I +SGSEL +A E    L  + I   VVS+   ELF EQ +SY+A ++ +   K++IE
Sbjct: 547 VVIVASGSELHVAAECAAKLEEQGIGAEVVSMVSTELFEEQDESYQADLLPADVFKVSIE 606

Query: 621 AGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           AG   GWD ++GSDG  IG+  FGAS     L++ FG  A AIV  +  K+
Sbjct: 607 AGSTFGWDRYVGSDGLKIGLDRFGASAPAGDLFEKFGFTADAIVPQILNKI 657


>gi|110680181|ref|YP_683188.1| transketolase [Roseobacter denitrificans OCh 114]
 gi|109456297|gb|ABG32502.1| transketolase [Roseobacter denitrificans OCh 114]
          Length = 681

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/662 (51%), Positives = 451/662 (68%), Gaps = 8/662 (1%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+   A+AIR L++DA+   NSGH G+P+GMAD  T LF + + FDP  P WP+RDRF+L
Sbjct: 12  DHWSKANAIRALALDAVAAANSGHSGMPIGMADAATVLFEKHLNFDPTAPNWPDRDRFIL 71

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALL+L GY+D+T+E IKNFR  G+ TAGHPEYG   GIE TTGPLGQGI+
Sbjct: 72  SAGHGSMLLYALLHLTGYEDMTLEQIKNFRQWGAITAGHPEYGHATGIETTTGPLGQGIS 131

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           NAVG A+AE   R  +G  ++DHYTYV+ GDGCLMEG+SQEAI+ AG   LSKL+VLWDN
Sbjct: 132 NAVGFAMAEEIQRAHYGKKVVDHYTYVIAGDGCLMEGVSQEAITLAGRHQLSKLVVLWDN 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           N I+IDGP+SL+D TDQ  RF ++GW+ + ++GHD   I + L +A+ + KPTMIAC+T 
Sbjct: 192 NNITIDGPVSLSDRTDQVGRFVSAGWDVIEIDGHDPVEIDAALTRAKKNQKPTMIACKTH 251

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           I  G   +  T+K HG+    E+  A + A  W   PF +PD +++ W   G R    R 
Sbjct: 252 IALGHAAQ-DTSKGHGALTNAEQNTAAKAAWGWTTGPFEVPDAVLQSWHAIGARGKAARE 310

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            W+ R  S+    R+ F R ++  +P          KK+     P +ATR SSE VLEV+
Sbjct: 311 AWEARFDSLPRGKRETFNRAYALEVPKKLSATVKAFKKQMSEGAPKLATRASSEKVLEVI 370

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N  +PE +GGSADLTGSN TKTS +      +  GRY+++G+REH MAAAMNG+ALH GL
Sbjct: 371 NPIMPETVGGSADLTGSNNTKTSDLGVFDTDNRGGRYVYWGIREHGMAAAMNGMALHGGL 430

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTFM F+DY+RPA+RLA+LM I  + V+THDSIGLGEDGPTHQPVEHLA  RA P+
Sbjct: 431 RPYGGTFMCFTDYARPAMRLAALMKIPTVFVMTHDSIGLGEDGPTHQPVEHLAISRATPN 490

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-ST 556
             V RPAD+IET E W++AL  K  PSVLSL+RQ LP +RT++++ N+ A GAY    + 
Sbjct: 491 TYVFRPADTIETAESWELALSSKTTPSVLSLTRQGLPTVRTEHKTRNMVAQGAYVLADAV 550

Query: 557 PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
              Q  + ++GSE+ +A+ A +IL +  I TRVVS+PC+ELF EQ ++ R +++   P++
Sbjct: 551 GKRQAILMATGSEVSLAMAARDILHAEGIGTRVVSMPCWELFEEQDEALRKRVLPGGPVR 610

Query: 617 IAIEAGLRQGWDAFI-GSDGS-----FIGMQGFGASGSCDLLYQHFGINAIAIVDMVERK 670
           +AIEAG+R GWD ++ G  G      FIGM  FGAS   D+L++  GI A A    V   
Sbjct: 611 VAIEAGIRMGWDRWLFGERGKREKSGFIGMHDFGASAPADVLFKELGITAEAAAQKVRDL 670

Query: 671 LS 672
           L+
Sbjct: 671 LA 672


>gi|84503066|ref|ZP_01001162.1| transketolase [Oceanicola batsensis HTCC2597]
 gi|84388610|gb|EAQ01482.1| transketolase [Oceanicola batsensis HTCC2597]
          Length = 672

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/655 (51%), Positives = 447/655 (68%), Gaps = 9/655 (1%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+   A AIR L++DA+   NSGH G+PMGMADV T LF + + FD   P W +RDRF+L
Sbjct: 12  DHWSKATAIRALTLDAVAAANSGHSGMPMGMADVATVLFGKHLKFDASAPLWHDRDRFIL 71

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML Y+LL+L GY+D  +E I+NFR +GS+TAGHPE      IE TTGPLGQGIA
Sbjct: 72  SAGHGSMLLYSLLHLTGYEDFPLEQIRNFRQLGSRTAGHPENFLAKAIETTTGPLGQGIA 131

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           N+VG AIAE  LR  FG  L+DH+TYV+ GDGCLMEG+SQEAI+ AG   LSKLIV WDN
Sbjct: 132 NSVGFAIAEEALRARFGKKLVDHHTYVIAGDGCLMEGVSQEAIALAGRQQLSKLIVFWDN 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           N I+IDG + LAD TDQ ARF+ASGW+   ++GHD  AI + + +A+   +P MIAC+T 
Sbjct: 192 NNITIDGEVGLADRTDQVARFQASGWDVQEIDGHDPEAIDAAITRAKKGTRPQMIACKTH 251

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           I  G   +  T K HG+    +++ A ++A  W   PF +P ++   W   G R ++ R 
Sbjct: 252 IALGHAAQ-DTAKGHGALTDADQLAAAKEAYGWTTGPFEVPAEVKSAWEEIGRRGTEDRY 310

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            W+ RL+ +    R EFER  +   P    +    LKK+   ++  +ATRK+SE+VLEVV
Sbjct: 311 AWEGRLADVSDRKRAEFERTMAGEAPKKLTSVIRALKKQAAEARHKVATRKASEMVLEVV 370

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N  +PE +GGSADLTGSN TKT  +         GR++HYG+REH MAAAMNG+ALH GL
Sbjct: 371 NPVMPETMGGSADLTGSNNTKTGDLGIFDIDSRDGRFVHYGIREHGMAAAMNGMALHGGL 430

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PYSGTFM F+DY+RPA+RL++LM   V++V+THDSIGLGEDGPTHQPVEHLA  RA P+
Sbjct: 431 RPYSGTFMCFTDYARPAMRLSALMQQPVVYVMTHDSIGLGEDGPTHQPVEHLAISRATPN 490

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
            LV RPAD +ET E W++AL +   PSVLSL+RQ +P +R Q+++ NL   GAY      
Sbjct: 491 TLVFRPADVVETAEAWELALTQGGTPSVLSLTRQGVPAVRQQHKAKNLTEQGAYVLADAE 550

Query: 558 --NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
               QV + ++GSE+ +A+EA   L +  I TRVVS+PC ELF  Q ++YR +++ + P+
Sbjct: 551 AGKRQVILIATGSEVSLAMEARATLEAEGIGTRVVSMPCMELFAAQPEAYRKRVLPAGPV 610

Query: 616 KIAIEAGLRQGWDAF-IGSDG-----SFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           +I +EAG+R GWD + +G  G     +F+GM  FGAS   ++L++HFGI A  +V
Sbjct: 611 RIGVEAGVRMGWDRWLLGERGREAKAAFVGMSSFGASAPAEVLFEHFGITAEGVV 665


>gi|294011295|ref|YP_003544755.1| transketolase [Sphingobium japonicum UT26S]
 gi|292674625|dbj|BAI96143.1| transketolase [Sphingobium japonicum UT26S]
          Length = 655

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/646 (53%), Positives = 448/646 (69%), Gaps = 7/646 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K +A+AIR LSMDA++  NSGHPG+PMGMADV T LF   + FDP+ P W +RDRFVLSA
Sbjct: 6   KSLANAIRALSMDAVQAANSGHPGMPMGMADVATVLFKDYLKFDPKAPKWADRDRFVLSA 65

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY   T+EDI NFR +GS  AGHPE    AG+EATTGPLG G+A A
Sbjct: 66  GHGSMLIYSLLHLTGYARPTMEDIANFRQLGSPCAGHPENFELAGVEATTGPLGSGLATA 125

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAER L  +FGD L+DH T+VL GDGCLMEG++ EAI  AGHL L +LIVLWD+N 
Sbjct: 126 VGMAIAERHLNAQFGDDLVDHRTWVLAGDGCLMEGVNHEAIGLAGHLNLGRLIVLWDDNK 185

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           I+IDG + L+ S D  AR+ A+GW+ +S +GHD   +   + +A    +P+++AC T IG
Sbjct: 186 ITIDGAVDLSSSEDVRARYAATGWHVVSCDGHDVADVRRAIDEALADPRPSLVACATKIG 245

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
           +G+PN+AGT+ VHGSALG  E+ A R+ L W  +PF IP+DI   W+  G +     A W
Sbjct: 246 YGAPNKAGTSGVHGSALGDAEVAAAREFLGWSAEPFVIPEDIAAAWKAIGAKGGDAHAAW 305

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFD-NAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
            +RL +  ++ + EFERR +  LP  F  +A+I+       +   +ATR++SEL L  +N
Sbjct: 306 ADRLGA--NAQKAEFERRMAGELPAGFSLDAYID---TLIANPQKVATRRASELALGAIN 360

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
           D LPE +GGSADLTGSN TKT     ++K D+SGRY++YG+RE  MA AMNG+ALH G+ 
Sbjct: 361 DLLPETLGGSADLTGSNNTKTKSTGPLTKDDYSGRYVYYGIREFGMACAMNGMALHGGVI 420

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+VFSDY R  IRLA+L   RVIHVLTHDSIGLGEDGPTHQPVEH+ +LR IP+L
Sbjct: 421 PYGGTFLVFSDYMRGGIRLAALQQARVIHVLTHDSIGLGEDGPTHQPVEHVMSLRMIPNL 480

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY-ISTP 557
            V RPAD +ET ECW++ALK+   PSVL+L+RQNLP LRT+    NL A GAY    +T 
Sbjct: 481 DVYRPADIVETAECWELALKDATGPSVLALTRQNLPQLRTEKAGENLSARGAYRLKAATA 540

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             +V + ++GSE++IAV    +L  + I   VVS+P +  F  Q  +Y+  ++    ++ 
Sbjct: 541 ERKVVLVATGSEVEIAVATAALLEEQGIGADVVSMPSWAHFDAQPQAYKDDLLPHHVLRA 600

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAI 663
           +IEAG   GW+ ++G  G   G+  FGAS   D+LY HFG+ A  I
Sbjct: 601 SIEAGTPFGWERYVGIAGLRFGIDTFGASAPADVLYDHFGLTAAKI 646


>gi|221639376|ref|YP_002525638.1| transketolase [Rhodobacter sphaeroides KD131]
 gi|221160157|gb|ACM01137.1| Transketolase [Rhodobacter sphaeroides KD131]
          Length = 672

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/661 (53%), Positives = 450/661 (68%), Gaps = 10/661 (1%)

Query: 12  LMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPN 71
           L +   D+ K A AIR L++DA+   NSGH G+PMGMADV T L+ + MVFD + P WPN
Sbjct: 6   LREQHPDHWKKACAIRALTLDAVAAANSGHSGMPMGMADVATVLYEKHMVFDARSPDWPN 65

Query: 72  RDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGP 131
           RDRFVLSAGHGSML YALL+L G  +  IE I+NFR  GSKTAGHPE     GIE TTGP
Sbjct: 66  RDRFVLSAGHGSMLVYALLHLTGDPEFPIEQIRNFRQWGSKTAGHPENFLAKGIETTTGP 125

Query: 132 LGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKL 191
           LGQG+A +VG+A+AE  LR  +G  +IDHYTY + GDGCLMEG+SQEAI  AG   LS L
Sbjct: 126 LGQGLAMSVGLAMAEESLRARWGAKIIDHYTYCIAGDGCLMEGVSQEAIGLAGRHELSHL 185

Query: 192 IVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTM 251
           IV+WDNNGI+IDG +SL+D TDQ ARF A+GW+    +GHD   I   L +A+ S+ P  
Sbjct: 186 IVMWDNNGITIDGKVSLSDRTDQKARFAAAGWDVFECDGHDPADIDRALTEAKASEGPAF 245

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLR 311
           IAC T I  GS  +  T+K HG+    + I  T+ A  W    F IP D+ K W   G R
Sbjct: 246 IACTTHIALGSSAQ-DTSKGHGALTDAKLIADTKAAYGWTSAAFEIPADVKKAWEAIGAR 304

Query: 312 SSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
            ++ R  W ERL+++    R  F+++FS   P    +A   +KK      P +ATR++SE
Sbjct: 305 GAEARKAWDERLAALSDGKRALFQQQFSCEPPKKLASAIRAVKKDAVEKMPKVATRRASE 364

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
           +VLE VN  +PE IGGSADLTGSN TKT+ +      +  GRY++YG+REH MAAAMNG+
Sbjct: 365 MVLEAVNPVMPETIGGSADLTGSNNTKTADLGVFDPINRKGRYVYYGIREHGMAAAMNGM 424

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH GL PY GTFM F+DY RPAIRL++LM + V++V THDSIGLGEDGPTHQPVEHLA 
Sbjct: 425 ALHGGLRPYGGTFMCFADYCRPAIRLSALMHMPVVYVFTHDSIGLGEDGPTHQPVEHLAM 484

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LRA P+++V RPAD +ET E W++AL  K  PSVL+LSRQNLP +R  + + NL A G Y
Sbjct: 485 LRATPNMMVFRPADLVETAEAWEIALGAKATPSVLALSRQNLPAVRKSHTNKNLVAQGGY 544

Query: 552 DY-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
               +T   QV + +SGSE+++A++A E L +  I TRVVS+PC ELF +Q ++YR +++
Sbjct: 545 VLEEATGKRQVILIASGSEVEVALKAREALEADGIGTRVVSMPCMELFAQQDEAYRRKVL 604

Query: 611 GSSPIKIAIEAGLRQGWDAFI-------GSDGSFIGMQGFGASGSCDLLYQHFGINAIAI 663
            +  ++IAIEAG+R GWD ++       G DG FIGM GFGAS   + L+Q FGI   A 
Sbjct: 605 PAGAVRIAIEAGVRMGWDRWLLGERGREGKDG-FIGMTGFGASAPAERLFQEFGITPEAT 663

Query: 664 V 664
           V
Sbjct: 664 V 664


>gi|260433858|ref|ZP_05787829.1| transketolase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417686|gb|EEX10945.1| transketolase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 673

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/670 (51%), Positives = 455/670 (67%), Gaps = 9/670 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + D+   A AIR L++DA+   NSGH G+PMGMADV T LF + + FD   P W
Sbjct: 4   TALRNANPDHWAKAAAIRTLTLDAVAAANSGHSGMPMGMADVATVLFEKHLKFDASAPKW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
           P+RDRF+LSAGHGSML Y+LLYL GY+ VT+++IKNFR +G+KTAGHPE     G+E TT
Sbjct: 64  PDRDRFILSAGHGSMLIYSLLYLTGYEQVTLDEIKNFRQLGAKTAGHPENFLLDGVETTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGIANAVG A+AE   R  +G  ++DHYTYV+ GDGCLMEG+SQEAI+ AG   LS
Sbjct: 124 GPLGQGIANAVGFAMAEEIQRAHYGKKVVDHYTYVIAGDGCLMEGVSQEAITLAGRHELS 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           KLIV WDNN I+IDG + +AD TDQ  RF ASGW+ + ++GHD  AI + + +A+ S KP
Sbjct: 184 KLIVFWDNNNITIDGTVDIADRTDQVRRFAASGWHVIEIDGHDPKAIDAAITQAKASKKP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           +MIAC+T I  G   +  T+K HG+    E++KA ++A  W   PF IP ++   W   G
Sbjct: 244 SMIACKTHIALGHAAQ-DTSKGHGALTDAEQLKAAKEAYGWPYGPFEIPAEVKAAWEAIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R +  RA W+ER + +    + EF R ++  +P     A   LKK+    +P +ATR S
Sbjct: 303 ARGAADRAAWEERFAQLSERKQAEFNRAYAFEVPKKLAGAIRALKKQISEDQPKLATRAS 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE VL VVN  + E +GGSADLTGSN T+++ M      +  GRY+HYG+REH MAAAMN
Sbjct: 363 SEKVLNVVNPIMTETVGGSADLTGSNNTRSADMGVFLPENRKGRYIHYGIREHGMAAAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G+ PY GTFM F+DY+RP++RLA+LM I  + V+THDSIGLGEDGPTHQPVEHL
Sbjct: 423 GMALHGGIRPYGGTFMAFTDYARPSMRLAALMKIPSVFVMTHDSIGLGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  RA P+  V RPAD++ET E W++AL  K+ PSVLSL+RQ +P +RTQ+++ NL A G
Sbjct: 483 AISRATPNTYVFRPADTVETAEAWELALTFKDSPSVLSLTRQGVPTVRTQHKAKNLTAQG 542

Query: 550 AYDYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           AY         Q  + ++GSE+ +A+EA  +L +  I TRVVS+PC ELF EQ ++YR +
Sbjct: 543 AYVLAEAEGKRQAILIATGSEVSLAMEAKAMLEAEGIGTRVVSMPCMELFAEQDEAYRKK 602

Query: 609 IIGSSPIKIAIEAGLRQ-GWDAF-IGSDG-----SFIGMQGFGASGSCDLLYQHFGINAI 661
           ++ + P+++ IEA +R  GWD + +G  G      FIGM  FGAS     LY+HFGI A 
Sbjct: 603 VLPAGPVRVGIEAAVRAGGWDRWLLGERGREAKAGFIGMSSFGASAPAGELYKHFGITAE 662

Query: 662 AIVDMVERKL 671
           A V  V+  L
Sbjct: 663 ATVAKVKELL 672


>gi|238024478|ref|YP_002908710.1| transketolase [Burkholderia glumae BGR1]
 gi|237879143|gb|ACR31475.1| Transketolase [Burkholderia glumae BGR1]
          Length = 678

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/652 (53%), Positives = 442/652 (67%), Gaps = 3/652 (0%)

Query: 16  DDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRF 75
           D   ++MA+ IRFLSMDA++  NSGHPG PMGMAD+ T L    M FD   P+W +RDRF
Sbjct: 15  DPQLREMANCIRFLSMDAVQQANSGHPGAPMGMADIATVLLRDFMRFDAADPHWLDRDRF 74

Query: 76  VLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQG 135
           VLS GH SML Y+LLYL GY D+ +E ++ FR +GS+T GHPEY    GIE TTGPLGQG
Sbjct: 75  VLSNGHASMLLYSLLYLTGYADMPLEQLERFRQVGSRTPGHPEYRHADGIELTTGPLGQG 134

Query: 136 IANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLW 195
           IA +VGMA+AER L   FGD L+DHYTYV +GDGCLMEG+SQEAIS AGHL L +LI  W
Sbjct: 135 IAESVGMALAERVLNARFGDELVDHYTYVFLGDGCLMEGVSQEAISLAGHLKLDRLIAFW 194

Query: 196 DNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKA-QLSDKPTMIAC 254
           DNN ISIDGP +LA S ++  RFRASGW  L ++GHD  AI   +  A + S +PT+IAC
Sbjct: 195 DNNSISIDGPTTLAVSDNEVERFRASGWRVLEIDGHDTDAIHGAIATAREPSGQPTLIAC 254

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
            T+IGFG P RAGT K H  A G EEI   R+ L W   PF IP  ++K WR  G +  +
Sbjct: 255 RTIIGFGFPTRAGTQKAHSDAPGAEEIAGARQLLGWHSPPFEIPAPLLKAWREIGAKGRE 314

Query: 315 TRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
            R  W +R+     ++R+EFERR    LP  +  A    +  F  S   +ATRK+S  VL
Sbjct: 315 ARLAWADRVKQAPDALREEFERRNEGRLPPDWKAAIAAARDAFTASGDEMATRKASGTVL 374

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           + + D +PEL+GGSADLT SN T+      I    + G Y+HYGVREH MAAAMNGIALH
Sbjct: 375 DHLFDAIPELLGGSADLTPSNNTRAKHQTEIGPGRYDGAYVHYGVREHGMAAAMNGIALH 434

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            GL PY GTF+ FSDY RPAIRLA++M +R I V+THDSIGLGEDGPTHQPVEHLAALRA
Sbjct: 435 GGLIPYGGTFLCFSDYCRPAIRLAAMMQVRTIFVMTHDSIGLGEDGPTHQPVEHLAALRA 494

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI 554
           IP L V RPAD +ET ECW++ L +  R ++++LSRQ +P LR +  + N  A GAY   
Sbjct: 495 IPHLGVYRPADPVETAECWELILDQPRRAALIALSRQPVPLLRKEGGTENRSARGAYVLH 554

Query: 555 STPNA--QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
                  ++T+ ++GSEL++AV+A E L    + T VVS+PC  LF EQ  SYR  ++G 
Sbjct: 555 EAEGGPRRLTLLATGSELQLAVQARERLQREGVPTAVVSMPCRLLFEEQDASYRRAVLGD 614

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           +P ++A+EA +  GW+ ++G  G F+GM GFG SG    LY+ FGI   A+V
Sbjct: 615 TPARVAVEAAVELGWERYLGPQGRFVGMHGFGESGKMQDLYEKFGITVEAVV 666


>gi|148555515|ref|YP_001263097.1| transketolase [Sphingomonas wittichii RW1]
 gi|148500705|gb|ABQ68959.1| transketolase [Sphingomonas wittichii RW1]
          Length = 655

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/643 (53%), Positives = 452/643 (70%), Gaps = 8/643 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIR L+MDA++  NSGHPG+PMGMADV T LFT+ + +DP  P W +RDRFVLSA
Sbjct: 6   RQLANAIRALAMDAVQAANSGHPGMPMGMADVATELFTKHLKYDPAQPRWADRDRFVLSA 65

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY   TIEDI+NFR + S  AGHPE    AG+EATTGPLG G+A A
Sbjct: 66  GHGSMLIYALLHLTGYARPTIEDIRNFRQLHSPCAGHPENFELAGVEATTGPLGSGLATA 125

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAER L   FG  L+DH+T+V+ GDGCLMEGI+ EAI  AGHL L +LIVLWD+N 
Sbjct: 126 VGMAIAERHLNASFGTDLVDHHTWVIAGDGCLMEGINHEAIGLAGHLKLGRLIVLWDDNR 185

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           I+IDG +SL+ S D  AR+ A+GW+T+S +GHD  +I + L  A+   +P+++ C TVIG
Sbjct: 186 ITIDGAVSLSSSEDVLARYAATGWHTVSCDGHDPDSINTALEAAKADPRPSIVQCTTVIG 245

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
           +G+PN+ GT+  HG+ALG +E+ A R  L W  +PF IP+DI   W  AG R + TR+ W
Sbjct: 246 YGAPNKQGTSATHGAALGVDEVAAARGYLGWTAEPFVIPEDIKAAWAEAGHRGTATRSAW 305

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFD-NAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           + RL + K   R EFERR + ALP  F  +A+I   K+   +   +ATRK+SE+ L  +N
Sbjct: 306 EARLVASKD--RAEFERRMAGALPAGFSLDAYI---KELAANPQKVATRKASEMALGPIN 360

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
           + LPE +GGSADLTGSN TKT     ++  D++GRY++YG+RE  M  AMNG+ALH G+ 
Sbjct: 361 EQLPETVGGSADLTGSNNTKTKGQAPLTAEDYAGRYIYYGIREFGMGCAMNGLALHGGVI 420

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTFMVFSDY RPAIRL++L   RV++V+THDSIGLGEDGPTHQPVEHL +LRA+P+L
Sbjct: 421 PYGGTFMVFSDYCRPAIRLSALQQQRVVYVMTHDSIGLGEDGPTHQPVEHLMSLRAMPNL 480

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY-ISTP 557
            V RP D+IET ECWQ+AL++ + PS+L+LSR+ LP +RT   S N  A GAY    +  
Sbjct: 481 DVYRPCDAIETAECWQLALEKADGPSLLALSREGLPQVRTDI-SENFSAKGAYRLKAAEA 539

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             +V + +SGSE++IA+   + L        VVS+P +E F  Q +SYR  I+    + +
Sbjct: 540 TRKVVLIASGSEVEIALATAKKLEEAGHGADVVSMPSWERFDAQPESYRDAILPEGVLLV 599

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINA 660
           +IEAG   GW+ ++G  G   G+ GFGAS     LY HFG+ A
Sbjct: 600 SIEAGTTMGWERYVGRKGLRFGVDGFGASAPVKALYDHFGLTA 642


>gi|227821233|ref|YP_002825203.1| transketolase I [Sinorhizobium fredii NGR234]
 gi|227340232|gb|ACP24450.1| transketolase I [Sinorhizobium fredii NGR234]
          Length = 663

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/647 (53%), Positives = 463/647 (71%), Gaps = 3/647 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + +A+AIR LS+D +E  NSGHPG+PMGMAD    LF + + FD   P WP+RDRFVLS 
Sbjct: 7   RDLANAIRVLSIDGVEAANSGHPGMPMGMADAAAVLFGKHLKFDASEPGWPDRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+++TIE+I+NFR   SKT GHPEYG  AG+E TTGPLGQGIA+A
Sbjct: 67  GHGSMLLYSLLHLTGYKEMTIEEIRNFRQWDSKTPGHPEYGHTAGVETTTGPLGQGIASA 126

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAER+L  EFG  L+DH+TYV  GDGCLMEG+ QEA S AGHL L KLIVL+D+N 
Sbjct: 127 VGMAIAERRLGAEFGTALVDHHTYVFCGDGCLMEGVGQEAASLAGHLQLGKLIVLYDDNS 186

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDKPTMIACETVI 258
           I+IDG  ++A S D  ARF A GW+T  V+GHD  AI + +  A+  + +P+++A +T+I
Sbjct: 187 ITIDGSTAIAFSEDVLARFDAYGWHTQRVDGHDAEAIDAAISNAKAETSRPSLVALKTII 246

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSP++AG + VHG+ LG  E  AT+ A  W  DPF IP  I++ WR  G + +++R +
Sbjct: 247 GFGSPSKAGKSSVHGAPLGASEAAATKTAYGWTADPFEIPTPILETWRAIGAKGAKSRRE 306

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           WQ RL + +  ++ EFERR + +LP  ++      K         +ATRK+S++ LE + 
Sbjct: 307 WQARLEAAEPDVKSEFERRTAGSLPPHYEETVNAAKANLLDRPQSVATRKASQIALEALT 366

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
           + LPE+IGGSADLT SN T+   + +   +  SGRY+ YGVRE AMAAAMNG+A+H G  
Sbjct: 367 ELLPEMIGGSADLTHSNLTRVPAVDSDFTAVRSGRYVSYGVREFAMAAAMNGMAVHGGFI 426

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+VFSDY R AIR+A+LMG R I V+THDSIGLGEDGPTHQPVEHLA+LRA+P+L
Sbjct: 427 PYGGTFLVFSDYCRNAIRVAALMGARSIFVMTHDSIGLGEDGPTHQPVEHLASLRAMPNL 486

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN 558
            V RPAD+IETLECW +A+  KN PSVL+LSRQN+P LR++ + +N CA GAY       
Sbjct: 487 HVFRPADTIETLECWDIAITSKNTPSVLALSRQNVPQLRSERDGSNRCARGAYVLREASR 546

Query: 559 AQ-VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
            + VT+ ++G+E+ +A++A E L +RNI   VVS+P ++LF +Q+  YR  ++G +P +I
Sbjct: 547 ERAVTLIATGTEVVLAIQAAEELEARNIPAAVVSMPSWDLFEKQARDYRHAVLGDAP-RI 605

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           A+EA  + GW  ++ S+   IGM GFGAS   + LY+ FGI   AIV
Sbjct: 606 AVEALSKFGWTRYVDSEDDVIGMSGFGASAPAETLYEKFGITRDAIV 652


>gi|146276938|ref|YP_001167097.1| transketolase [Rhodobacter sphaeroides ATCC 17025]
 gi|145555179|gb|ABP69792.1| transketolase [Rhodobacter sphaeroides ATCC 17025]
          Length = 672

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/661 (53%), Positives = 447/661 (67%), Gaps = 10/661 (1%)

Query: 12  LMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPN 71
           L +   D+ K A AIR L++DA+   NSGH G+PMGMADV T L+ + MVFD Q P WPN
Sbjct: 6   LREQHPDHWKKACAIRALTLDAVAAANSGHSGMPMGMADVATVLYEKHMVFDAQSPDWPN 65

Query: 72  RDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGP 131
           RDRFVLSAGHGSML Y+LL+L G  +  IE I+NFR  GS+TAGHPE     GIE TTGP
Sbjct: 66  RDRFVLSAGHGSMLVYSLLHLTGDPEFPIEQIRNFRQWGSRTAGHPENFLAKGIETTTGP 125

Query: 132 LGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKL 191
           LGQG+A AVG+A+AE  LR  +G  +IDHYTY + GDGCLMEG+SQEAI  AG   LS+L
Sbjct: 126 LGQGLAMAVGLAMAEESLRARWGAKIIDHYTYCIAGDGCLMEGVSQEAIGLAGRHELSRL 185

Query: 192 IVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTM 251
           IV+WDNNGI+IDG ++L+D TDQ ARF A+GW+    +GHD   I   L +A+ S  P  
Sbjct: 186 IVMWDNNGITIDGKVALSDRTDQKARFAAAGWDVFECDGHDPADIDRALTEAKASKGPAF 245

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLR 311
           IAC T I  GS  +  T+K HG+    + I  T+ A  W    F IP DI   W   G R
Sbjct: 246 IACTTHIALGSSAQ-DTSKGHGALTDAKLITDTKAAYGWTAGAFEIPADIKTAWETIGSR 304

Query: 312 SSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
            ++ R  W ER +++  S R  F+++FS   P     A   +KK      P +ATR++SE
Sbjct: 305 GAEARKAWDERFAALSDSKRALFQQQFSCEPPKKLAAAIRAVKKDAVEKMPKVATRRASE 364

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
           +VLE VN  + E IGGSADLTGSN TKT+ +      +  GRY++YG+REH MAAAMNG+
Sbjct: 365 MVLEAVNPIMTETIGGSADLTGSNNTKTADLGVFDPINRKGRYVYYGIREHGMAAAMNGM 424

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH GL PY GTFM F+DY RPA+RL++LM + V++V THDSIGLGEDGPTHQPVEHLA 
Sbjct: 425 ALHGGLRPYGGTFMCFADYCRPAVRLSALMHMPVVYVFTHDSIGLGEDGPTHQPVEHLAM 484

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LRA P++LV RPAD  ET E W++AL EK  PSVL+LSRQNLP +R  + + NL A GAY
Sbjct: 485 LRATPNMLVFRPADLTETAEAWEIALSEKATPSVLALSRQNLPAVRKTHTNKNLVAQGAY 544

Query: 552 DY-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
               +T   QV + +SGSE+++A++A E L +  I TRVVS+PC ELF  Q ++YR +++
Sbjct: 545 VLEEATAKRQVILIASGSEVEVALKAREALEAEGIGTRVVSMPCMELFARQDEAYRRKVL 604

Query: 611 GSSPIKIAIEAGLRQGWDAFI-------GSDGSFIGMQGFGASGSCDLLYQHFGINAIAI 663
            +  ++IAIEAG+R GWD ++       G DG FIGM GFGAS   + L+Q FGI   A 
Sbjct: 605 PAGAVRIAIEAGVRMGWDRWLLGERGREGKDG-FIGMSGFGASAPAERLFQEFGITPEAT 663

Query: 664 V 664
           V
Sbjct: 664 V 664


>gi|126462369|ref|YP_001043483.1| transketolase [Rhodobacter sphaeroides ATCC 17029]
 gi|126104033|gb|ABN76711.1| transketolase [Rhodobacter sphaeroides ATCC 17029]
          Length = 672

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/661 (53%), Positives = 449/661 (67%), Gaps = 10/661 (1%)

Query: 12  LMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPN 71
           L +   D+ K A AIR L++DA+   NSGH G+PMGMADV T L+ + MVFD + P WPN
Sbjct: 6   LREQHPDHWKKACAIRALTLDAVAAANSGHSGMPMGMADVATVLYEKHMVFDARSPDWPN 65

Query: 72  RDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGP 131
           RDRFVLSAGHGSML YALL+L G  +  IE I+NFR  GSKTAGHPE     GIE TTGP
Sbjct: 66  RDRFVLSAGHGSMLVYALLHLTGDPEFPIEQIRNFRQWGSKTAGHPENFLAKGIETTTGP 125

Query: 132 LGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKL 191
           LGQG+A +VG+A+AE  LR  +G  +IDHYTY + GDGCLMEG+SQEAI  AG   LS L
Sbjct: 126 LGQGLAMSVGLAMAEESLRARWGAKIIDHYTYCIAGDGCLMEGVSQEAIGLAGRHELSHL 185

Query: 192 IVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTM 251
           IV+WDNNGI+IDG +SL+D TDQ ARF A+GW+    +GHD   I   L +A+ S  P  
Sbjct: 186 IVMWDNNGITIDGKVSLSDRTDQKARFAAAGWDVFECDGHDPADIDRALTEAKASKGPAF 245

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLR 311
           IAC T I  GS  +  T+K HG+    + I  T+ A  W    F IP D+   W   G R
Sbjct: 246 IACTTHIALGSSAQ-DTSKGHGALTDAKLIADTKAAYGWTSAAFEIPADVKTAWEAIGAR 304

Query: 312 SSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
            ++ R  W ERL+++    R  F+++FS   P    +A   +KK      P +ATR++SE
Sbjct: 305 GAEARKAWDERLAALSDGKRALFQQQFSCEPPKKLASAIRAVKKDAVEKMPKVATRRASE 364

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
           +VLE VN  +PE IGGSADLTGSN TKT+ +      +  GRY++YG+REH MAAAMNG+
Sbjct: 365 MVLEAVNPVMPETIGGSADLTGSNNTKTADLGVFDPINRKGRYVYYGIREHGMAAAMNGM 424

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH GL PY GTFM F+DY RPAIRL++LM + V++V THDSIGLGEDGPTHQPVEHLA 
Sbjct: 425 ALHGGLRPYGGTFMCFADYCRPAIRLSALMHMPVVYVFTHDSIGLGEDGPTHQPVEHLAM 484

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LRA P+++V RPAD +ET E W++AL  K  PSVL+LSRQNLP +R  + + NL A G Y
Sbjct: 485 LRATPNMMVFRPADLVETAEAWEIALGAKATPSVLALSRQNLPAVRKNHTNKNLVAQGGY 544

Query: 552 DY-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
               +T   QV + +SGSE+++A++A E L +  I TRVVS+PC ELF +Q ++YR +++
Sbjct: 545 VLEEATGKRQVILIASGSEVEVALKAREALEADGIGTRVVSMPCMELFAQQDEAYRRKVL 604

Query: 611 GSSPIKIAIEAGLRQGWDAFI-------GSDGSFIGMQGFGASGSCDLLYQHFGINAIAI 663
            +  ++IAIEAG+R GWD ++       G DG FIGM GFGAS   + L+Q FGI + A 
Sbjct: 605 PAGAVRIAIEAGVRMGWDRWLLGERGREGKDG-FIGMTGFGASAPAERLFQEFGITSEAT 663

Query: 664 V 664
           V
Sbjct: 664 V 664


>gi|190570679|ref|YP_001975037.1| transketolase [Wolbachia endosymbiont of Culex quinquefasciatus
           Pel]
 gi|213019073|ref|ZP_03334880.1| transketolase [Wolbachia endosymbiont of Culex quinquefasciatus
           JHB]
 gi|190356951|emb|CAQ54337.1| transketolase [Wolbachia endosymbiont of Culex quinquefasciatus
           Pel]
 gi|212995182|gb|EEB55823.1| transketolase [Wolbachia endosymbiont of Culex quinquefasciatus
           JHB]
          Length = 654

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/650 (53%), Positives = 459/650 (70%), Gaps = 18/650 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K MA+A+RFLS+DA++  NSGHPG+P+GMADV T LF + +  +P    W +RDRFVLS 
Sbjct: 7   KSMANAVRFLSIDAVQKANSGHPGMPLGMADVATVLFAKYLNHNPDDSQWISRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y++LYL GY  ++I+++KNFR + SKT GHPE+G  +GIEATTGPLGQG A A
Sbjct: 67  GHGSMLQYSILYLTGY--ISIDELKNFRQLTSKTPGHPEFGLTSGIEATTGPLGQGFATA 124

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+AE  L ++F    I HYTYV++GDGCLMEGIS EA S AGHL L+KLI L+D+N 
Sbjct: 125 VGMALAESILEKQFE---ISHYTYVMLGDGCLMEGISHEAASLAGHLKLNKLIALFDDND 181

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ISIDG  SL+ S D   RF A GWN   ++GHD  AI+  + +AQ SDKPT+I C+T+IG
Sbjct: 182 ISIDGSTSLSCSDDVEKRFSAYGWNVDKIDGHDFDAISLAIEQAQKSDKPTLICCKTIIG 241

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
             S +RAGT+  H  A  +E++K  R+ LNWD +PF +P+D+   W     R+ Q     
Sbjct: 242 KFS-SRAGTSSAHSGAFTEEDVKQMREKLNWDYEPFHVPEDVRNAWIETVKRAKQ----- 295

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
                +  S I KE +RR    LP+  ++   +LKK+     P  ATR S   V+E++  
Sbjct: 296 -----NYTSLINKELQRRLEKRLPNNIESDLADLKKQICKLMPNEATRSSFGRVMELLTK 350

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            +PELIGGSADLTGSN TK   M+AI  +++SG Y+HYGVREHAMA  MNG+ALH G+ P
Sbjct: 351 SMPELIGGSADLTGSNCTKYKHMQAIDSNNYSGSYVHYGVREHAMAVCMNGMALHGGIIP 410

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTF+VFSDY RPAIRL++LM  +VI+V+THDSIG+GEDGPTHQP+EHLA+LRAIP+L 
Sbjct: 411 YGGTFLVFSDYCRPAIRLSALMKQQVIYVMTHDSIGVGEDGPTHQPIEHLASLRAIPNLY 470

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYES-NNLCALGAYDYIS-TP 557
           V RPAD+IETLEC  +AL++K  P++ +LSRQN+ ++ +  +   NL   GAY     + 
Sbjct: 471 VFRPADAIETLECISIALEKKESPALFALSRQNINYMHSYTDQLANLSKFGAYILCEYSG 530

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             +VTIF++GSE++IAVEA E L  + + TRV+S+PC+ LF EQSD Y+  I+ +  IK+
Sbjct: 531 KLEVTIFATGSEVEIAVEAREKLQEKGVGTRVISMPCWRLFDEQSDEYKGVILNNDSIKV 590

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           AIEAG   GW  +IGS+G FIGM+ FG S   + LY+HF I+A  +V  V
Sbjct: 591 AIEAGSEVGWHKYIGSNGIFIGMKNFGESAPYEALYKHFNISADYVVKCV 640


>gi|254510920|ref|ZP_05122987.1| transketolase [Rhodobacteraceae bacterium KLH11]
 gi|221534631|gb|EEE37619.1| transketolase [Rhodobacteraceae bacterium KLH11]
          Length = 673

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/657 (51%), Positives = 443/657 (67%), Gaps = 9/657 (1%)

Query: 23  ADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHG 82
           A AIR L++DA+   NSGH G+PMGMADV T LF + + FD   P WP+RDRF+LSAGHG
Sbjct: 17  AAAIRTLTLDAVAAANSGHSGMPMGMADVATVLFEKHLKFDASSPNWPDRDRFILSAGHG 76

Query: 83  SMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGM 142
           SML Y+LLYL G+ DVT++ IKNFR +G+KTAGHPE     GIE TTGPLGQGI+NAVG 
Sbjct: 77  SMLIYSLLYLTGHADVTLDQIKNFRQLGAKTAGHPENFLVDGIETTTGPLGQGISNAVGF 136

Query: 143 AIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISI 202
           A+AE   R  +G  ++DHYTYV+ GDGCLMEG+SQEAI+ AG   L KLIV WDNN I+I
Sbjct: 137 AMAEEIQRAHYGKKVVDHYTYVIAGDGCLMEGVSQEAITLAGRHELGKLIVFWDNNNITI 196

Query: 203 DGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGS 262
           DG + +AD TDQ  RF ASGW  + ++GHD  AI + + +A+ S KPTMIACE+ I  G 
Sbjct: 197 DGTVDIADRTDQVRRFAASGWQVIEIDGHDPQAIDAAIVQAKKSKKPTMIACESHIALGH 256

Query: 263 PNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQER 322
             +  T+K HG+   Q+++KA ++   W  D F IP ++   W   G R +  RA W+ER
Sbjct: 257 AAQ-DTSKGHGALTDQDQLKAAKEGYGWPHDAFHIPAEVKSAWEAIGARGTAERAAWEER 315

Query: 323 LSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLP 382
            + +    + EF R ++   P     A    KK+    +P +ATR SSE VL VVN  + 
Sbjct: 316 FAQISERKQAEFNRAYAFEAPKKLAGAIRAFKKQMSEDQPKLATRASSEKVLNVVNPIMS 375

Query: 383 ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSG 442
           E +GGSADLTGSN TK++ M      +  GRY+HYG+REH MAAAMNG+ALH G+ PY G
Sbjct: 376 ETVGGSADLTGSNNTKSADMGVFLPENRKGRYIHYGIREHGMAAAMNGMALHGGIRPYGG 435

Query: 443 TFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLR 502
           TFM F+DY+RP++RLA+LM +  + V+THDSIGLGEDGPTHQPVEHLA  RA P+  V R
Sbjct: 436 TFMAFTDYARPSMRLAALMKVPTVFVMTHDSIGLGEDGPTHQPVEHLAISRATPNTYVFR 495

Query: 503 PADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA-QV 561
           PAD++ET E W++AL  K  PSVLSL+RQ +P +RT +++ NL A GAY         Q 
Sbjct: 496 PADTVETAEAWELALTFKESPSVLSLTRQGVPTVRTDHKTKNLTAQGAYVLADAEGKRQA 555

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
            + ++GSE+ +A+EA  +L +  I TRVVS+PC ELF +Q ++YR +++   P+++ IEA
Sbjct: 556 ILIATGSEVSLAMEAKAMLEAEGIGTRVVSMPCMELFAQQDEAYRKRVLPGGPVRVGIEA 615

Query: 622 GLRQ-GWDAF-IGSDG-----SFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +R  GWD + +G  G      FIGM  FGAS     LY+HFGI A A V  V+  L
Sbjct: 616 AMRAGGWDRWLLGERGREAKAGFIGMSSFGASAPAGELYRHFGITAEATVAKVKELL 672


>gi|77463513|ref|YP_353017.1| transketolase [Rhodobacter sphaeroides 2.4.1]
 gi|77387931|gb|ABA79116.1| transketolase [Rhodobacter sphaeroides 2.4.1]
          Length = 672

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/661 (53%), Positives = 448/661 (67%), Gaps = 10/661 (1%)

Query: 12  LMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPN 71
           L +   D+ K A AIR L++DA+   NSGH G+PMGMADV T L+ + MVFD + P WPN
Sbjct: 6   LREQHPDHWKKACAIRALTLDAVAAANSGHSGMPMGMADVATVLYEKHMVFDARSPDWPN 65

Query: 72  RDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGP 131
           RDRFVLSAGHGSML YALL+L G  +  IE I+NFR  GSKTAGHPE     GIE TTGP
Sbjct: 66  RDRFVLSAGHGSMLVYALLHLTGDPEFPIEQIRNFRQWGSKTAGHPENFLAKGIETTTGP 125

Query: 132 LGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKL 191
           LGQG+A +VG+A+AE  LR  +G  +IDHYTY + GDGCLMEG+SQEAI  AG   LS L
Sbjct: 126 LGQGLAMSVGLAMAEESLRARWGAKIIDHYTYCIAGDGCLMEGVSQEAIGLAGRHELSHL 185

Query: 192 IVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTM 251
           IV+WDNNGI+IDG +SL+D TDQ ARF A+GW+    +GHD   I   L  A+ S  P  
Sbjct: 186 IVMWDNNGITIDGKVSLSDRTDQKARFAAAGWDVFECDGHDPADIDRALTAAKASKGPAF 245

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLR 311
           IAC T I  GS  +  T+K HG+    + I  T+ A  W    F IP D+ K W   G R
Sbjct: 246 IACTTHIALGSSAQ-DTSKGHGALTDAKLIADTKAAYGWTSAAFEIPADVKKAWEAIGAR 304

Query: 312 SSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
            ++ R  W ERL+++    R  F+++FS   P    +A   +KK      P +ATR++SE
Sbjct: 305 GAEARKAWDERLAALSDGKRALFQQQFSCEPPKKLASAIRAVKKDAVEKMPKVATRRASE 364

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
           +VLE VN  +PE IGGSADLTGSN TKT+ +      +  GRY++YG+REH MAAAMNG+
Sbjct: 365 MVLEAVNPVMPETIGGSADLTGSNNTKTADLGVFDPINRKGRYVYYGIREHGMAAAMNGM 424

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH GL PY GTFM F+DY RPAIRL++LM + V++V THDSIGLGEDGPTHQPVEHLA 
Sbjct: 425 ALHGGLRPYGGTFMCFADYCRPAIRLSALMHMPVVYVFTHDSIGLGEDGPTHQPVEHLAM 484

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LRA P+++V RPAD +ET E W++AL  K  PSVL+LSRQNLP +R  + + NL A G Y
Sbjct: 485 LRATPNMMVFRPADLVETAEAWEIALGAKATPSVLALSRQNLPAVRKNHTNKNLVAQGGY 544

Query: 552 DY-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
               +T   QV + +SGSE+++A++A E L +  I TRVVS+PC ELF +Q ++YR +++
Sbjct: 545 VLEEATGKRQVILIASGSEVEVALKAREALEADGIGTRVVSMPCMELFAQQDEAYRRKVL 604

Query: 611 GSSPIKIAIEAGLRQGWDAFI-------GSDGSFIGMQGFGASGSCDLLYQHFGINAIAI 663
            +  ++IAIEAG+R GWD ++       G DG F+GM GFGAS   + L+Q FGI   A 
Sbjct: 605 PAGAVRIAIEAGVRMGWDRWLLGERGREGKDG-FVGMTGFGASAPAERLFQEFGITYEAT 663

Query: 664 V 664
           V
Sbjct: 664 V 664


>gi|315498657|ref|YP_004087461.1| transketolase [Asticcacaulis excentricus CB 48]
 gi|315416669|gb|ADU13310.1| transketolase [Asticcacaulis excentricus CB 48]
          Length = 670

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/652 (53%), Positives = 461/652 (70%), Gaps = 7/652 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MADAIR LSM+A+    SGH G+PMGMADV T L+T+ + +DP+ P W +RDRFVLSAGH
Sbjct: 19  MADAIRVLSMEAVHRAKSGHQGMPMGMADVATVLWTKFLKYDPKKPDWADRDRFVLSAGH 78

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+LL+L G++ V++EDIKNFR  GS TAGHPEYG  AG+E TTGPLGQG+A AVG
Sbjct: 79  GSMLIYSLLHLTGFKSVSMEDIKNFRQWGSTTAGHPEYGHTAGVECTTGPLGQGLATAVG 138

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER L   FGD ++DH T+V+ GDGCLMEG+S EAIS AG L L+KLIVLWD+N ++
Sbjct: 139 MAMAERHLNARFGDEIVDHRTWVIAGDGCLMEGVSHEAISLAGRLKLNKLIVLWDDNNVT 198

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG  ++A++ DQ ARF+A+GW   +V+GHDH  I + +R A    KP ++AC+T+I  G
Sbjct: 199 IDGVATIAETGDQLARFKAAGWAVKAVDGHDHAKIAAAMRWATQQSKPVLLACKTLISKG 258

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +  + G    HG  L   +I+ +RKA+ WD + + +P  I K W  AG ++++ R  W+ 
Sbjct: 259 AGPKEGDPHSHGYTLFDSDIELSRKAMGWDAETWTVPAPIKKAWEAAGRKAARPRKAWEA 318

Query: 322 RLSSMKSSIRKEFERRFSDALP-DCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
            L +     R+ FER  +  LP + FD    +++K+ E  K   ATR +S   L  +   
Sbjct: 319 ALKAHPQ--REAFERGMTGDLPTNAFDALDAHIEKQLE-LKAGDATRSASGAALAQLVPH 375

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
           + E+IGGSADLTGSN T    M A     + GRY+HYG+RE  M+AA+NG+ALH G+ PY
Sbjct: 376 IDEMIGGSADLTGSNNTLVKGMTAFDAPAYDGRYVHYGIREFGMSAALNGMALHGGIIPY 435

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
           SGTF VFSDYSRPAIRLA+LMGIRVI+VLTHDSIG+GEDGPTHQPVEHLA+ RA+P+LL 
Sbjct: 436 SGTFFVFSDYSRPAIRLAALMGIRVINVLTHDSIGVGEDGPTHQPVEHLASFRAMPNLLT 495

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY-ISTPNA 559
            RPAD +E  ECW+ AL E+  PS++ LSRQ +P +R  ++  NL A GAY+   ++  A
Sbjct: 496 FRPADIVEAAECWKAALVERKTPSLMVLSRQKVPAVR--HQGGNLSAKGAYELKTASAPA 553

Query: 560 QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAI 619
            V+IFSSG+E+ +AV A E L ++ I TRVVS PC+ LF  Q   Y+A++IGS+P+ +AI
Sbjct: 554 TVSIFSSGTEVSVAVAAAEALEAQGIPTRVVSTPCWALFDRQPAKYQAEVIGSAPVNVAI 613

Query: 620 EAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           EA +  GW+ FIG DG F+GM  FGAS   D+LY+ FGI   A+++ V  KL
Sbjct: 614 EAAVSLGWERFIGQDGIFVGMNSFGASAPQDVLYKQFGITKEAVIEKVTAKL 665


>gi|332558393|ref|ZP_08412715.1| transketolase [Rhodobacter sphaeroides WS8N]
 gi|332276105|gb|EGJ21420.1| transketolase [Rhodobacter sphaeroides WS8N]
          Length = 672

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/661 (53%), Positives = 447/661 (67%), Gaps = 10/661 (1%)

Query: 12  LMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPN 71
           L +   D+ K A AIR L++DA+   NSGH G+PMGMADV T L+ + MVFD + P WPN
Sbjct: 6   LREQHPDHWKKACAIRALTLDAVAAANSGHSGMPMGMADVATVLYEKHMVFDARSPDWPN 65

Query: 72  RDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGP 131
           RDRFVLSAGHGSML YALL+L G  +  IE I+NFR  GSKTAGHPE     GIE TTGP
Sbjct: 66  RDRFVLSAGHGSMLVYALLHLTGDPEFPIEQIRNFRQWGSKTAGHPENFLAKGIETTTGP 125

Query: 132 LGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKL 191
           LGQG+A +VG A+AE  LR  +G  +IDHYTY + GDGCLMEG+SQEAI  AG   LS L
Sbjct: 126 LGQGLAMSVGFAMAEESLRARWGAKIIDHYTYCIAGDGCLMEGVSQEAIGLAGRHELSHL 185

Query: 192 IVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTM 251
           IV+WDNNGI+IDG +SL+D TDQ ARF A+GW+    +GHD   I   L  A+ S  P  
Sbjct: 186 IVMWDNNGITIDGKVSLSDRTDQKARFAAAGWDVFECDGHDPADIDRALTAAKASKGPAF 245

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLR 311
           IAC T I  GS  +  T+K HG+    + I  T+ A  W    F IP D+   W   G R
Sbjct: 246 IACTTHIALGSSAQ-DTSKGHGALTDAKLIADTKAAYGWTSAAFEIPADVKTAWEAIGAR 304

Query: 312 SSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
            ++ R  W ERL+++    R  F+++FS   P    +A   +KK      P +ATR++SE
Sbjct: 305 GAEARKAWDERLAALSDGKRALFQQQFSCEPPKKLASAIRAVKKDAVEKMPKVATRRASE 364

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
           +VLE VN  +PE IGGSADLTGSN TKT+ +      +  GRY++YG+REH MAAAMNG+
Sbjct: 365 MVLEAVNPVMPETIGGSADLTGSNNTKTADLGVFDPINRKGRYVYYGIREHGMAAAMNGM 424

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH GL PY GTFM F+DY RPAIRL++LM + V++V THDSIGLGEDGPTHQPVEHLA 
Sbjct: 425 ALHGGLRPYGGTFMCFADYCRPAIRLSALMHMPVVYVFTHDSIGLGEDGPTHQPVEHLAM 484

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LRA P+++V RPAD +ET E W++AL  K  PSVL+LSRQNLP +R  + + NL A G Y
Sbjct: 485 LRATPNMMVFRPADLVETAEAWEIALGAKATPSVLALSRQNLPAVRKNHTNKNLVAQGGY 544

Query: 552 DY-ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
               +T   QV + +SGSE+++A++A E L +  I TRVVS+PC ELF +Q ++YR +++
Sbjct: 545 VLEEATGKRQVILIASGSEVEVALKAREALEADGIGTRVVSMPCMELFAQQDEAYRRKVL 604

Query: 611 GSSPIKIAIEAGLRQGWDAFI-------GSDGSFIGMQGFGASGSCDLLYQHFGINAIAI 663
            +  ++IAIEAG+R GWD ++       G DG FIGM GFGAS   + L+Q FGI + A 
Sbjct: 605 PAGAVRIAIEAGVRMGWDRWLLGERGREGKDG-FIGMTGFGASAPAERLFQEFGITSEAT 663

Query: 664 V 664
           V
Sbjct: 664 V 664


>gi|83310480|ref|YP_420744.1| transketolase [Magnetospirillum magneticum AMB-1]
 gi|82945321|dbj|BAE50185.1| Transketolase [Magnetospirillum magneticum AMB-1]
          Length = 657

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/644 (52%), Positives = 452/644 (70%), Gaps = 5/644 (0%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +  MA+AIRFL+MDAIE   SGHPG+PMGMADV T LFT+ + +D + P W +RDRF+LS
Sbjct: 4   HAAMANAIRFLTMDAIEKAKSGHPGMPMGMADVATVLFTRFLKYDAKAPKWADRDRFILS 63

Query: 79  AGHGSMLYYALLYLLGYQDVT-IEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           AGHGSML YAL YL G++D++ IE IKNFR +G +TAGHPE+G  A  E TTGPLGQG+A
Sbjct: 64  AGHGSMLLYALGYLTGFEDLSDIEQIKNFRQMGYRTAGHPEFGHVAIAETTTGPLGQGVA 123

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           NAVG A+AE+      G  ++DHYTYV+ GDGCLMEGISQEAIS AG   LSKLI+LWD+
Sbjct: 124 NAVGFALAEKMAAARHGKDVVDHYTYVMAGDGCLMEGISQEAISLAGVWNLSKLILLWDD 183

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           N I IDG  +++ S DQ ARF+AS W+   V+GHD  AI + +  AQ S +P++IAC T 
Sbjct: 184 NHICIDGDTAISTSDDQLARFQASNWDVCRVDGHDPEAIATAIAAAQKSGQPSLIACRTT 243

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IG G+P +AG+ KVHG+ LG +EI A R A  W   PF IP D++  WR AG + +  RA
Sbjct: 244 IGKGAPTKAGSEKVHGAPLGGDEIAAARAAAGWSAGPFEIPADVLDAWRAAGTKGASARA 303

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
           +W++R ++     + EF R  +  LP  +  A    K+K    +P  ATRK+ + VLE +
Sbjct: 304 EWEKRFAAYAG--KDEFLRTNAGTLPQGWKQAVSAFKQKVSAEQPKWATRKAGQEVLEAL 361

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
              +PE+IGGSADLT SN T T   K +S SD SGRY+HYGVREH MA+ MNG++LH G 
Sbjct: 362 TPVIPEMIGGSADLTHSNLTITKATKPVSASDCSGRYIHYGVREHGMASIMNGLSLHGGF 421

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTF++F++Y  PA+R++++M  RV++VLTHDSIGLGEDGPTHQP+E +AALRA P+
Sbjct: 422 IPYGGTFLIFANYLWPALRMSAMMDQRVLYVLTHDSIGLGEDGPTHQPIETVAALRATPN 481

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           +LV RPAD +ET+E ++ AL     PSV +LSRQNLP LRT +   NL A GAY      
Sbjct: 482 VLVFRPADPVETMEAYEAALDNAKGPSVFALSRQNLPTLRTTHTDENLTAKGAYVLAEAE 541

Query: 558 NA--QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
               QVT+ ++GSE+ +A+EA ++L+ + I+  VVS+PC+ELF  Q   YR  ++G   +
Sbjct: 542 GKKRQVTLIATGSEVSLAMEARKLLADKGIAAAVVSMPCWELFERQPKEYRNSVLGEGTV 601

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           ++A+EA    GW+ ++G +G+ IGM GFGAS   + LY+HFGI 
Sbjct: 602 RVAVEALGTFGWERWVGENGAVIGMNGFGASAPAEKLYEHFGIT 645


>gi|116254893|ref|YP_770729.1| putative transketolase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115259541|emb|CAK10679.1| putative transketolase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 678

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/652 (53%), Positives = 444/652 (68%), Gaps = 3/652 (0%)

Query: 16  DDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRF 75
           D   + +AD IRFLSMDA++   SGHPG+PMGMAD+   LF++ + FD   PYW +RDRF
Sbjct: 16  DQRLRDLADCIRFLSMDAVQQAKSGHPGMPMGMADIAAVLFSEFLKFDAADPYWFDRDRF 75

Query: 76  VLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQG 135
           V+S GHGSML Y+LLYL GY+D+TIE+IK FR I S+TAGHPEY    GIE TTGPLGQG
Sbjct: 76  VISNGHGSMLLYSLLYLTGYKDMTIEEIKRFRQIDSRTAGHPEYRHATGIETTTGPLGQG 135

Query: 136 IANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLW 195
           IAN+VG+A+ ER +   FGD L++H+TYV +GDGCLMEGIS EAIS AGHL L KLI  W
Sbjct: 136 IANSVGLALGERIMNASFGDNLVNHHTYVFLGDGCLMEGISHEAISLAGHLKLGKLIAFW 195

Query: 196 DNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           D+N ISIDG  SLA+S D  ARFRA+ W+   ++GHD  AI + + +AQ ++D+P+MIAC
Sbjct: 196 DDNSISIDGATSLAESDDHPARFRAANWHVQQIDGHDTDAIRAAIIEAQKVTDRPSMIAC 255

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFG P RAGT K H  A G++EI   RK L W   PF IP+ ++  WR  G +   
Sbjct: 256 KTIIGFGFPTRAGTQKAHSDAPGEDEIAGARKILGWASPPFEIPEALLNDWRKIGAKGGP 315

Query: 315 TRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
            R  W  R+ +     R +FERR +  LP  +  A    K++   S+  +ATR++S +VL
Sbjct: 316 ARMAWAVRVQTASPDKRDDFERRMNGELPSGWRAAIAAAKQELSGSEKDLATRQASGIVL 375

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
             + D +PEL+GGSADLT SN TK      I   ++ G YLHYGVREH MAAAMNG+ALH
Sbjct: 376 NHLFDAIPELLGGSADLTPSNNTKAKNQVEIKPGEYGGSYLHYGVREHGMAAAMNGLALH 435

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            GL PY GTF+ FSDY RPAIRLA++M +R I V+THDSIGLGEDGPTHQP+EHL+ALRA
Sbjct: 436 GGLIPYGGTFLTFSDYCRPAIRLAAIMEVRSIFVMTHDSIGLGEDGPTHQPIEHLSALRA 495

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI 554
           IP L V RP D IET ECW+  +    + ++++LSRQ +P LR      N  A GAY   
Sbjct: 496 IPRLAVYRPGDPIETAECWEAIMDAPRQAALIALSRQPMPLLRRGPSDENRSARGAYVLQ 555

Query: 555 STPNA--QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
                  Q+TI +SGSEL +AVEA  +L    I T VVS+PC  LF +Q  +Y+  ++G 
Sbjct: 556 EAEGGERQLTILASGSELNLAVEARSVLQDEGIRTAVVSMPCRLLFEKQDAAYKKSVLGG 615

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           S  ++A+EA +R  WD ++G DG F+GM  FGASG  D +Y  F I   A++
Sbjct: 616 SRARVAVEAAVRDSWDRYLGLDGVFVGMHEFGASGKIDDVYTKFDITTDAVI 667


>gi|159044287|ref|YP_001533081.1| transketolase [Dinoroseobacter shibae DFL 12]
 gi|157912047|gb|ABV93480.1| transketolase 1 [Dinoroseobacter shibae DFL 12]
          Length = 657

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/656 (50%), Positives = 449/656 (68%), Gaps = 8/656 (1%)

Query: 23  ADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHG 82
           A AIR L++DA+   NSGH G+P+GMADV T LF + + FD   P W +RDRF+LSAGHG
Sbjct: 3   ATAIRTLALDAVAAANSGHSGMPIGMADVATVLFEKHLKFDASAPDWADRDRFILSAGHG 62

Query: 83  SMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGM 142
           SML YALL+L GY+ + + +IKNFR +G+ TAGHPE+G  AGIE TTGPLGQGIA AVG 
Sbjct: 63  SMLLYALLHLTGYESMPLSEIKNFRQLGAATAGHPEFGHAAGIETTTGPLGQGIATAVGF 122

Query: 143 AIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISI 202
           A+AE  LR  +G  ++DH+T+V+ GDGCLMEGISQEA++ AG   LS+LIVLWD+NGI+I
Sbjct: 123 AMAEEILRARWGAKIMDHHTWVIAGDGCLMEGISQEALTLAGRQELSRLIVLWDDNGITI 182

Query: 203 DGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGS 262
           DG + L+D TDQ ARF ASGW+  S +GHD   I   L  A+ SDKP M+AC+T I  G 
Sbjct: 183 DGKVDLSDRTDQMARFAASGWDVFSCDGHDPEDIDRALSAAKASDKPAMVACKTHIALGH 242

Query: 263 PNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQER 322
             +  T+K HG+     + +A R+A  W   PF IP +I  +W   G R +  +A W  R
Sbjct: 243 AAQ-DTSKGHGALTDDSQNQAAREAWGWTHGPFEIPAEIKSQWEAIGARGAAEKAAWDAR 301

Query: 323 LSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLP 382
            + + ++ + EF R F+  LP         LKK+   + P +ATRK+SE+ LEV+N  +P
Sbjct: 302 FAKLSNAKQVEFSRAFARQLPRKLSATIKALKKQTSETAPKVATRKASEMALEVINPIMP 361

Query: 383 ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSG 442
           E +GGSADLTGSN TKT  +         GRY++YG+REH MAAAMNG++LH G+ PY G
Sbjct: 362 ETVGGSADLTGSNNTKTGDLGVFMPESRDGRYVYYGIREHGMAAAMNGMSLHGGIRPYGG 421

Query: 443 TFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLR 502
           TF+ F+DY+R A+RL++LM   V++V+THDSIGLGEDGPTHQPVEHLA LRA P+ LV+R
Sbjct: 422 TFLCFTDYARGAMRLSALMKQPVVYVMTHDSIGLGEDGPTHQPVEHLAMLRATPNTLVIR 481

Query: 503 PADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA-QV 561
           PAD++ET E W++AL++   P+VL+LSRQ LP LRT++++ NL A G Y         Q 
Sbjct: 482 PADAVETAEAWEIALEQTETPTVLALSRQGLPTLRTEHKTKNLTAQGGYVLAEAEGKRQA 541

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
            + ++GSE+ IA+ A ++L +  I TRVVS+PC+E+F EQ D+YR +++ + P+++A+EA
Sbjct: 542 ILMATGSEVAIAMAARDLLQAEGIGTRVVSMPCWEIFEEQPDAYRRKVLPAGPVRVAVEA 601

Query: 622 GLRQGWDAFIGSD------GSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +R GWD ++  +      G F+GM  FG S     LY+HF I   A+   V+  L
Sbjct: 602 AIRFGWDRWLYGERGKREKGGFVGMHDFGGSAPAGDLYKHFEITPEAVAAKVKEML 657


>gi|42520264|ref|NP_966179.1| transketolase [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|42410002|gb|AAS14113.1| transketolase [Wolbachia endosymbiont of Drosophila melanogaster]
          Length = 690

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/686 (51%), Positives = 468/686 (68%), Gaps = 40/686 (5%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K MA+AIRFLS+DA++  NSGHPG+P+GMADV T LF + +  +P    W NRDRFVLS 
Sbjct: 7   KSMANAIRFLSIDAVQKANSGHPGMPLGMADVATVLFAKYLNHNPDDSKWFNRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y++LYL GY  ++++++KNFR +GSKT GHPE+G  +G+EATTGPLGQG A A
Sbjct: 67  GHGSMLLYSILYLTGY--ISVDELKNFRQMGSKTPGHPEFGLTSGVEATTGPLGQGFAAA 124

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+AE  L ++F    I+HYTYV++GDG LMEGIS EA S AGHL L+KLI L+D+N 
Sbjct: 125 VGMALAESILEKQF---RINHYTYVMLGDGSLMEGISHEAASLAGHLKLNKLIALFDDND 181

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ISIDG   L+ S D   RF A GWN   ++GHD  AI+  + +A+ SDKPTMI C+T+IG
Sbjct: 182 ISIDGATCLSCSDDVEKRFLAYGWNVDKIDGHDFDAISLAIEQAKKSDKPTMICCKTIIG 241

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ----- 314
             S +RAGT+  H  A  +E+IK  R+ LNW+ +PF +P+D+   W+    R+ Q     
Sbjct: 242 KFS-SRAGTSSAHSGAFSEEDIKQMREKLNWNYEPFHVPEDVKNAWKKTVERAKQNYTMS 300

Query: 315 -------TRADWQERLSSMKSSIRKE-----------------FERRFSDALPDCFDNAF 350
                  +R + +E +    + + +E                  +RR    LPD      
Sbjct: 301 FQRVTLESRKEEKEWIPVSSTGMTRESTGMTEENAGMTGYHAELQRRLDKHLPDNIAGVL 360

Query: 351 INLKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDF 410
            +LKK+     P  ATR S   V+E++ + +PELIGGSADLTGSN TK   M+ I+ +++
Sbjct: 361 ADLKKQICELMPNEATRSSFGRVMELLTESMPELIGGSADLTGSNCTKYEHMQVINSNNY 420

Query: 411 SGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLT 470
           SG Y+HYGVREHAMAA MNG+ALH  + PY GTF+VFSDY RPAIRL++LM  +V++V+T
Sbjct: 421 SGSYVHYGVREHAMAACMNGMALHGAILPYGGTFLVFSDYCRPAIRLSALMKQQVMYVMT 480

Query: 471 HDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSR 530
           HDSIG+GEDGPTHQP+EHLA+LRAIP+L V RPAD++ETLEC  +AL++K  P++ +LSR
Sbjct: 481 HDSIGVGEDGPTHQPIEHLASLRAIPNLYVFRPADAVETLECVSIALEKKESPALFALSR 540

Query: 531 QNLPFLRTQY----ESNNLCALGAYDYIS-TPNAQVTIFSSGSELKIAVEACEILSSRNI 585
           QN+ ++R  Y    +S NL   GAY     +   +VTIF++GSE++IAVEA E L  + I
Sbjct: 541 QNVSYMRKFYSDIDQSANLSKFGAYILCECSKELKVTIFATGSEVEIAVEAREKLQEKGI 600

Query: 586 STRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGA 645
            TR+VS+PC+ LF EQSD Y+A I+ +  IK+AIEAG   GW  +IGS+G FIGM+ FG 
Sbjct: 601 GTRIVSMPCWRLFDEQSDEYKAAILNNDSIKVAIEAGSEMGWHKYIGSNGIFIGMKSFGE 660

Query: 646 SGSCDLLYQHFGINAIAIVDMVERKL 671
           S     LY+HF I+A  +V  V  KL
Sbjct: 661 SAPYKTLYEHFNISADHVVKCVCEKL 686


>gi|99034785|ref|ZP_01314707.1| hypothetical protein Wendoof_01000473 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 682

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/684 (51%), Positives = 468/684 (68%), Gaps = 40/684 (5%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA++IRFLS+DA++  NSGHPG+P+GMADV T LF + +  +P    W NRDRFVLS GH
Sbjct: 1   MANSIRFLSIDAVQKANSGHPGMPLGMADVATVLFAKYLNHNPDDSKWFNRDRFVLSNGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y++LYL GY  ++++++KNFR +GSKT GHPE+G  +G+EATTGPLGQG A AVG
Sbjct: 61  GSMLLYSILYLTGY--ISVDELKNFRQMGSKTPGHPEFGLTSGVEATTGPLGQGFAAAVG 118

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AE  L ++F    I+HYTYV++GDGCLMEGIS EA S AGHL L+KLI L+D+N IS
Sbjct: 119 MALAESILEKQF---RINHYTYVMLGDGCLMEGISHEAASLAGHLKLNKLIALFDDNDIS 175

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG   L+ S D   RF A GWN   ++GHD  AI+  + +A+ SDKPTMI C+T+IG  
Sbjct: 176 IDGATCLSCSDDVEKRFLAYGWNVDKIDGHDFDAISLAIEQAKKSDKPTMICCKTIIGKF 235

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ------- 314
           S +RAGT+  H  A  +E+IK  R+ LNW+ +PF +P+D+   W+    R+ Q       
Sbjct: 236 S-SRAGTSSAHSGAFSEEDIKQMREKLNWNYEPFHVPEDVKNAWKKTVERAKQNYTMSFQ 294

Query: 315 -----TRADWQERLSSMKSSIRKE-----------------FERRFSDALPDCFDNAFIN 352
                +R + +E +    + + +E                  +RR    LP+       +
Sbjct: 295 RVTLESRKEEKEWIPVSSTGMTRESTGMTEENAGMTGYHAELQRRLDKHLPENIAGVLAD 354

Query: 353 LKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSG 412
           LKK+     P  ATR S   V+E++ + +PELIGGSADLTGSN TK   M+ I+ +++SG
Sbjct: 355 LKKQICELMPNEATRSSFGRVMELLTESMPELIGGSADLTGSNCTKYEHMQVINSNNYSG 414

Query: 413 RYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHD 472
            Y+HYGVREHAMAA MNG+ALH  + PY GTF+VFSDY RPAIRL++LM  +V++V+THD
Sbjct: 415 SYVHYGVREHAMAACMNGMALHGAILPYGGTFLVFSDYCRPAIRLSALMKQQVMYVMTHD 474

Query: 473 SIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQN 532
           SIG+GEDGPTHQP+EHLA+LRAIP+L V RPAD++ETLEC  +AL++K  P++ +LSRQN
Sbjct: 475 SIGVGEDGPTHQPIEHLASLRAIPNLYVFRPADAVETLECVSIALEKKESPALFALSRQN 534

Query: 533 LPFLRTQY----ESNNLCALGAYDYIS-TPNAQVTIFSSGSELKIAVEACEILSSRNIST 587
           + ++R  Y    +S NL   GAY     +   +VTIF++GSE++IAVEA E L  + I T
Sbjct: 535 VSYMRKFYSDIDQSANLSKFGAYILCECSKELKVTIFATGSEVEIAVEAREKLQEKGIGT 594

Query: 588 RVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASG 647
           R+VS+PC+ LF EQSD Y+A I+ +  IK+AIEAG   GW  +IGS+G FIGM+ FG S 
Sbjct: 595 RIVSMPCWRLFDEQSDEYKAAILNNDSIKVAIEAGSEMGWHKYIGSNGIFIGMKSFGESA 654

Query: 648 SCDLLYQHFGINAIAIVDMVERKL 671
               LY+HF I+A  +V  V  KL
Sbjct: 655 PYKTLYEHFNISADHVVKCVCEKL 678


>gi|126735630|ref|ZP_01751375.1| transketolase [Roseobacter sp. CCS2]
 gi|126714817|gb|EBA11683.1| transketolase [Roseobacter sp. CCS2]
          Length = 658

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/653 (51%), Positives = 450/653 (68%), Gaps = 8/653 (1%)

Query: 23  ADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHG 82
           A AIR L++DA+   NSGH G+PMGMADV T LF + + FDP+ P+WP+RDRF+LSAGHG
Sbjct: 3   ATAIRTLTLDAVAAANSGHSGMPMGMADVATVLFEKHLKFDPKAPHWPDRDRFILSAGHG 62

Query: 83  SMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGM 142
           SML YAL+YL GY+D+ +E IK+FR  G++TAGHPE+G   GIE TTGPLGQGIAN+VG 
Sbjct: 63  SMLLYALMYLTGYEDMPLEQIKDFRQWGARTAGHPEFGHARGIETTTGPLGQGIANSVGF 122

Query: 143 AIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISI 202
           AIAE   R  +G  +IDH+TYV+ GDGCLMEG+SQEAI+ AG   LS LIV WDNN I+I
Sbjct: 123 AIAEEIQRATWGKKIIDHHTYVMAGDGCLMEGVSQEAIALAGMQKLSNLIVFWDNNNITI 182

Query: 203 DGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGS 262
           DG + +AD TDQ  RF+ASGW+   ++GHD  AI + +  A+ + KP+MIAC+T I  G 
Sbjct: 183 DGTVDIADITDQKMRFKASGWHVQEIDGHDPDAIDAAITAAKKAGKPSMIACKTHIALGH 242

Query: 263 PNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQER 322
             +  T+K HG+    E++KA ++     +  F +  D  K+W   G R +  R +W  R
Sbjct: 243 AAQ-DTSKGHGALTDNEQLKAAKETYGAPMGDFEVSADARKQWSDIGARGAAARKEWDGR 301

Query: 323 LSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLP 382
            S++ +S + EF R ++   P         LKK+    +P  ATRKSSE+ LEV+N  + 
Sbjct: 302 FSTLSASKQAEFNRIYAGEAPKRLSATIRALKKQITEGQPKAATRKSSEMTLEVINPIMQ 361

Query: 383 ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSG 442
           E IGGSADLTGSN T TS M         GRY++YGVREH MAAAMNG+ALH G  PY G
Sbjct: 362 ETIGGSADLTGSNNTLTSDMGVFHPDTRKGRYIYYGVREHGMAAAMNGMALHGGTRPYGG 421

Query: 443 TFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLR 502
           TFM F+DY+R A+RL++LMGI   +V+THDSIGLGEDGPTHQP+EHLA LRA P++ V R
Sbjct: 422 TFMCFTDYARGAMRLSALMGIPTTYVMTHDSIGLGEDGPTHQPIEHLAMLRATPNMNVFR 481

Query: 503 PADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA-QV 561
           PAD++ET E W++AL  +  PSVL+L+RQ LP +RT++++ N+ A GAY         Q 
Sbjct: 482 PADTVETAEAWELALTSQKTPSVLALTRQGLPTVRTEHKNKNMVAQGAYVLADAEGKRQA 541

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
            + ++GSE+ IA+EA ++L +  I TRVVS+PC+E+F EQ +SYR +++   P+++AIEA
Sbjct: 542 ILLATGSEVSIAMEARDLLHADGIGTRVVSMPCWEIFEEQEESYRKRVLPGGPVRVAIEA 601

Query: 622 GLRQGWDAFI-GSDGS-----FIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           G+R GWD ++ G  G      FIGM GFGAS   + L++ FGI A    D V+
Sbjct: 602 GIRFGWDRWLFGERGKREKSGFIGMHGFGASAPAEQLFKEFGITAQDTADKVK 654


>gi|94496497|ref|ZP_01303074.1| transketolase [Sphingomonas sp. SKA58]
 gi|94424243|gb|EAT09267.1| transketolase [Sphingomonas sp. SKA58]
          Length = 655

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/660 (51%), Positives = 448/660 (67%), Gaps = 18/660 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K +A+AIR LSMDA++  NSGHPG+PMGMADV T LF+  + FDP  P W +RDRFVLSA
Sbjct: 6   KSLANAIRALSMDAVQAANSGHPGMPMGMADVATVLFSDHLKFDPGKPDWADRDRFVLSA 65

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY   TIEDI +FR + S  AGHPE    AG+EATTGPLG G+A A
Sbjct: 66  GHGSMLIYSLLHLTGYARPTIEDIASFRQLHSPCAGHPENFELAGVEATTGPLGSGLATA 125

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAER L  +FGD L+DH T+V+ GDGCLMEGI+ EAI  AGHL L +LIVLWD+N 
Sbjct: 126 VGMAIAERHLNAQFGDDLVDHRTWVIAGDGCLMEGINHEAIGLAGHLNLGRLIVLWDDNK 185

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           I+IDG + L+ S D  AR+ A+GW+ +S +GHD   +   L +A    +P+++AC T IG
Sbjct: 186 ITIDGAVDLSSSEDVLARYAATGWHVVSCDGHDVADVRRALAEAVADPRPSIVACATKIG 245

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
           +G+PN+AGT+ VHGSALG++E+ A R  L WD +PF IPDDI   W+  G +    R+ W
Sbjct: 246 YGAPNKAGTSGVHGSALGEDEVAAARAFLGWDAEPFVIPDDIAAAWKAIGAKGRDVRSAW 305

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCF------DNAFINLKKKFEHSKPMIATRKSSELV 373
           ++RL+        EF RR +  LP  F      D+   N +K        +ATRK+SEL 
Sbjct: 306 EQRLAGHAQG--DEFSRRMAGELPADFSLDPYIDSLIANPQK--------VATRKASELA 355

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           L  +N+ LPE +GGSADLTGSN TKT     +++ D++GRY++YG+RE  MA AMNG+AL
Sbjct: 356 LGAINELLPETLGGSADLTGSNNTKTKTTGPLTRDDYAGRYVYYGIREFGMACAMNGMAL 415

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H G+ PY GTF+VFSDY R  IRLA+L   RVIHVLTHDSIGLGEDGPTHQP+EH+ +LR
Sbjct: 416 HGGVIPYGGTFLVFSDYMRAGIRLAALQQQRVIHVLTHDSIGLGEDGPTHQPIEHVMSLR 475

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY 553
            IP+L V RPAD +ET ECW++ALK+   PSVL+L+RQNLP LRT  +S NL A G Y  
Sbjct: 476 MIPNLDVYRPADIVETAECWELALKDATGPSVLALTRQNLPQLRTD-KSENLSAKGGYRL 534

Query: 554 I-STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
           + +T   +V + ++GSE++IAV   + L  R I   V+S+P +  F  Q  +Y+  ++  
Sbjct: 535 VAATAERKVVLIATGSEVEIAVATAKALEERGIGADVISMPSWAHFEAQPQAYKDDLLPQ 594

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
             ++ +IEAG   GW+ + G  G   G+  FGAS     LY HFG+ A  I   +E  L+
Sbjct: 595 HVLRASIEAGTTFGWERYTGIAGLRFGIDSFGASAPAPALYDHFGLTAAKIAPQIEAALN 654


>gi|329849744|ref|ZP_08264590.1| transketolase [Asticcacaulis biprosthecum C19]
 gi|328841655|gb|EGF91225.1| transketolase [Asticcacaulis biprosthecum C19]
          Length = 648

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/643 (53%), Positives = 447/643 (69%), Gaps = 14/643 (2%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MADAIR LSM+A+    SGH G+PMGMADV T L+T+ + +DP+ P W +RDRFVLSAGH
Sbjct: 1   MADAIRVLSMEAVHRAKSGHQGMPMGMADVATVLWTKFLRYDPKKPDWADRDRFVLSAGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L G++ V+++DIKNFR  G+ T GHPEYG  AG+E TTGPLGQG+A AVG
Sbjct: 61  GSMLLYALLHLTGFKSVSMDDIKNFRQWGASTPGHPEYGHTAGVECTTGPLGQGLATAVG 120

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER L   FGD L++H T+V+ GDGCLMEG+S EAIS AG   L+ LIVL+D+N ++
Sbjct: 121 MAMAERHLNARFGDDLVNHKTWVIAGDGCLMEGVSHEAISLAGRFNLNNLIVLFDDNNVT 180

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG  +LA++ DQ  RF A+GW   SV+GHDH  + + +R A   DKP MIAC+T +  G
Sbjct: 181 IDGWATLAETGDQLKRFAAAGWAVKSVDGHDHAKLAAVMRWAVRQDKPVMIACKTKVSRG 240

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +    G    HG  L  ++IKA R+A+ W  +PF +P DI K W  AG + ++TR  W++
Sbjct: 241 AGALEGDKHGHGYNLFDDQIKAAREAMGWAHEPFTVPADIKKAWESAGRKGTRTRKAWED 300

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAF----INLKKKFEHSKPMIATRKSSELVLEVV 377
                 +    ++E   +    D  DNAF     ++K   E SKP  ATR  S   L  +
Sbjct: 301 -----AAKANPKYEELTAAMAGDFADNAFEALDAHIKASLE-SKPTDATRSCSGAALSHL 354

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
              +P LIGGSADLTGS  T    M     +D++GRY+HYGVRE  MAAAMNG+ALH G+
Sbjct: 355 VPAIPALIGGSADLTGSVNTLVKGMGTYDTADYTGRYVHYGVREFGMAAAMNGMALHGGI 414

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY+GTF VFSDYSRPAIRL +LMG +V+HV+THDSIG+GEDGPTHQPVEHLA+ RA+P 
Sbjct: 415 IPYAGTFFVFSDYSRPAIRLGALMGAKVVHVMTHDSIGVGEDGPTHQPVEHLASFRAMPG 474

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           L V RPAD +ET ECW+ AL     PS+L L+RQ +P +RT  E  NL   GAY+  +  
Sbjct: 475 LHVFRPADMVETAECWKAAL-HAGGPSMLVLTRQKIPAVRTSGE--NLAQKGAYEVSAAQ 531

Query: 558 -NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
             A V+IF+SGSE+ +AV A ++L +  I+TRVVS PC++LF  Q+ +Y+A +IG +P+K
Sbjct: 532 GEAVVSIFASGSEVSVAVAAQKLLEADGIATRVVSTPCWDLFDAQTPAYKASVIGDAPVK 591

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           +A+EA +  GW+ FIG+DG F+GM+GFGAS   D L++ FGI 
Sbjct: 592 VAVEAAVSLGWEKFIGNDGVFVGMKGFGASAPADRLFKEFGIT 634


>gi|84515569|ref|ZP_01002931.1| transketolase [Loktanella vestfoldensis SKA53]
 gi|84510852|gb|EAQ07307.1| transketolase [Loktanella vestfoldensis SKA53]
          Length = 672

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/658 (51%), Positives = 451/658 (68%), Gaps = 8/658 (1%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ K A AIR L++DA+   NSGH G+PMGMADV T LF   + FDP+ P WP+RDRF+L
Sbjct: 12  DHWKKATAIRTLTLDAVAAANSGHSGMPMGMADVATVLFQNHLKFDPKSPAWPDRDRFIL 71

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YAL+YL GY+D+T++ IK+FR  G+KTAGHPEYG   GIE TTGPLGQGIA
Sbjct: 72  SAGHGSMLLYALMYLTGYEDITLQQIKDFRQWGAKTAGHPEYGHARGIETTTGPLGQGIA 131

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           N+VG AIAE   R  +G  ++DH+TYV+ GDGCLMEG+SQEAI  AG   L  L+V WDN
Sbjct: 132 NSVGFAIAEEIQRAHWGAKIVDHHTYVIAGDGCLMEGVSQEAIGLAGMQKLGHLVVFWDN 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           N I+IDG + +AD TDQ ARF ASGW+   ++GHD  AI + +  A+   +P+MIAC+T 
Sbjct: 192 NNITIDGTVDIADITDQPARFAASGWHVQEIDGHDPVAIDAAIVAAKADPRPSMIACKTH 251

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           I  G   +  T+K HG+    +++ A + A    +  F + DD++  W+  G R + TRA
Sbjct: 252 IALGHAAQ-DTSKGHGALTNADQLAAAKTAYGAPMGAFEVADDVLDAWKAIGARGAATRA 310

Query: 318 DWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVV 377
            W  R +++ ++ + EF R ++   P         LKK+   S P +ATRKSSE+ LEV+
Sbjct: 311 AWDARFAALSAARQAEFTRAYAGDAPKKLSATIRALKKQISESAPSVATRKSSEMTLEVI 370

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
           N  +PE IGGSADLTGSN TKT  +         GRY++YG+REH MAAAMNG+ALH G 
Sbjct: 371 NPIMPETIGGSADLTGSNNTKTGDLGVFHPDTRKGRYIYYGIREHGMAAAMNGMALHGGA 430

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
             Y GTFM F+DY+R A+RL++LMG+ V +V+THDSIGLGEDGPTHQP+EHLA LRA P+
Sbjct: 431 RAYGGTFMCFTDYARGAMRLSALMGVPVTYVMTHDSIGLGEDGPTHQPIEHLAMLRATPN 490

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           + V RPAD+IET E W++AL  K  PSVL+LSRQNLP +R  + + NL A G Y      
Sbjct: 491 MHVFRPADTIETAEAWEIALTSKTTPSVLALSRQNLPTVRKTHTNKNLTAQGGYVLTDAD 550

Query: 558 NA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
              Q  I ++GSE++IA+ A ++L ++ I TRVVS+PC+ELF EQ  SYR +++ + P++
Sbjct: 551 GKRQAIIMATGSEVEIALAARDLLQAQGIGTRVVSMPCWELFEEQDASYRRRVLPAGPVR 610

Query: 617 IAIEAGLRQGWDAFIGSDG------SFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           +A+EAG+R GWD ++  +G       F+GM GFGAS   + LY  FGI A  + D V+
Sbjct: 611 VAVEAGIRFGWDRWLFGEGGKREKSGFVGMHGFGASAPAERLYAEFGITAQGVADKVK 668


>gi|114570980|ref|YP_757660.1| transketolase [Maricaulis maris MCS10]
 gi|114341442|gb|ABI66722.1| transketolase [Maricaulis maris MCS10]
          Length = 660

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/654 (51%), Positives = 450/654 (68%), Gaps = 9/654 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR LSMDA++  NSGHPG+PMGMADV   L+++ M FDP  P W +RDRFVLSAGH
Sbjct: 13  MANAIRALSMDAVQQANSGHPGMPMGMADVAAVLWSKHMKFDPAAPAWADRDRFVLSAGH 72

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y++L+L G++D++++++K FR + S TAGHPEYG   G+EATTGPLGQGI+ +VG
Sbjct: 73  GSMLLYSILHLAGFEDISMDELKKFRQLDSLTAGHPEYGHTPGVEATTGPLGQGISMSVG 132

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER +   +GD L+DH T+V+  DG L EGIS EAIS AGHLGL++  VLWD+N IS
Sbjct: 133 MALAERMMNARYGDDLVDHRTWVIASDGDLQEGISHEAISLAGHLGLNRFCVLWDDNEIS 192

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDGP  L++STD   RF A+GW+   ++GHDH AI + L+KA+ SDKP +IAC T IG+G
Sbjct: 193 IDGPTDLSESTDVLKRFEAAGWSVSRIDGHDHAAIDAALQKARSSDKPVLIACRTTIGYG 252

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +P +AGT   HG+ LG +EI   R+AL W   PF IP++I+  WR  G  S+     WQE
Sbjct: 253 APTKAGTAGSHGAPLGADEIAGAREALGWTAAPFEIPEEILDAWRATG--SADAHQAWQE 310

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           RL+    +   +F  + S    +    A    ++K    KP++A+R +S   L  +    
Sbjct: 311 RLAGADRA--DDFVAQISGEPGETEIAALDAWRQKVAAEKPVLASRAASGQTLAAIIGDW 368

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           P L GGSADL GSN TKT  +  +   D++G+Y+H+GVREH MAA  NG++LH G  P+ 
Sbjct: 369 PSLAGGSADLAGSNLTKTPDVGIVKAGDYAGQYIHFGVREHGMAACANGMSLHGGFRPHV 428

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
            TF+VF+DY RP++RL+SLM   V++V+THDSIGLGEDGPTHQPVE LA+LRAIP++ V 
Sbjct: 429 ATFLVFADYCRPSMRLSSLMHQPVVYVMTHDSIGLGEDGPTHQPVETLASLRAIPNMHVF 488

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY---DYISTPN 558
           RPAD++ET E W +AL+  + PSVL+LSRQ LPFLR+   S NL A GAY   D + +P+
Sbjct: 489 RPADALETAEAWDLALRRIDGPSVLALSRQKLPFLRSDDGSTNLSASGAYTLSDDVGSPD 548

Query: 559 AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIA 618
             + + ++GSE+ +AVEA   L ++    RVVS PC +L  EQ D+Y  ++  +    +A
Sbjct: 549 --IVLVATGSEVCLAVEAARTLRAQGRKVRVVSAPCLDLLLEQGDAYLDELFPAGIPVVA 606

Query: 619 IEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
            EA LR GWD  IG  G F+GM GFGAS   + LY HFGI + AIV+  E  L+
Sbjct: 607 CEAALRFGWDQVIGRKGGFVGMTGFGASAPAEDLYAHFGITSAAIVEQAEALLA 660


>gi|71083292|ref|YP_266011.1| transketolase [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062405|gb|AAZ21408.1| Transketolase [Candidatus Pelagibacter ubique HTCC1062]
          Length = 652

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/653 (50%), Positives = 448/653 (68%), Gaps = 11/653 (1%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +K +++AIRFLS+DA++  NSGHPG+PMGMADV T LF   + F+P+ P W NRDRFVLS
Sbjct: 5   HKDLSNAIRFLSIDAVQKANSGHPGMPMGMADVATVLFKNFLRFNPKNPNWINRDRFVLS 64

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML Y+LL+L GY+ +++ D+KNFR + S  AGHPEY    GIE TTGPLGQGIAN
Sbjct: 65  AGHGSMLLYSLLHLTGYKSISLNDVKNFRQLKSICAGHPEYHPGTGIETTTGPLGQGIAN 124

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           +VG AIAE  L+++ G  +I+H TYVL GDGCLMEGIS EA+S AGHL L  L++L+DNN
Sbjct: 125 SVGFAIAEEILKKKLGKEIINHKTYVLAGDGCLMEGISHEAMSLAGHLKLKNLVMLFDNN 184

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            ISIDGP SLA S +   RF + GW+ + +NGH+   I S L+K Q + +PT+I+C+T I
Sbjct: 185 SISIDGPTSLAVSDNFKKRFESYGWDYILINGHNEREIFSALKKVQNAKRPTVISCKTKI 244

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           G+GSPN++G    HGS +G +EIK  RK L+W   PF IP  I+ +WR  G + ++  + 
Sbjct: 245 GYGSPNKSGKASSHGSPIGLDEIKLVRKVLDWKHKPFEIPKSILNEWRKIGNKGAKLDSA 304

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W +     K+ + K F+  FS AL     N+              +A+RK+SEL L  + 
Sbjct: 305 WSKIYKRKKNLVDKVFKNNFSKALKSEKQNSL--------RENKSLASRKASELTLNALT 356

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
                LIGGSADL GSN TKT    AI+  +F+G Y+HYGVREHAMA  MNG+ALH    
Sbjct: 357 RENNTLIGGSADLAGSNNTKTKYHNAINSVNFNGDYIHYGVREHAMAGIMNGLALHSKFI 416

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF++FSDY +P+IRL++LM  RVI+V+THDSIGLGEDGPTHQP+E L+ LR+IP+L
Sbjct: 417 PYGGTFLIFSDYCKPSIRLSALMQQRVIYVMTHDSIGLGEDGPTHQPIEQLSGLRSIPNL 476

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN 558
            V RPAD +ET+ECW++ALK    PSVLSL+RQNL  +R +Y + N C+LGAY+ +S  N
Sbjct: 477 NVFRPADRMETIECWELALKNSKTPSVLSLTRQNLEPIRKKYSNMNKCSLGAYE-VSRTN 535

Query: 559 AQV--TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
            ++  TIF+SGSE+ +A+E    L+   I ++V+SVPC ++F  QS +Y+ +I+  +  K
Sbjct: 536 KKINLTIFASGSEVNLAIETSHKLAKDKIYSKVISVPCQDIFDLQSKAYKKKILNEAKFK 595

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
           I+IEA     W  +IG++G   G+  FG S     +Y++FG+    I    ++
Sbjct: 596 ISIEAASTDCWKKYIGTEGLAFGIDTFGKSAPYKEIYKYFGLTVQNISQKAKK 648


>gi|149186664|ref|ZP_01864975.1| transketolase [Erythrobacter sp. SD-21]
 gi|148829572|gb|EDL48012.1| transketolase [Erythrobacter sp. SD-21]
          Length = 659

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/654 (51%), Positives = 449/654 (68%), Gaps = 9/654 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR LSMDA++  NSGHPG+PMGMADV T L+T+ +  D   P W +RDRFVLSAGH
Sbjct: 11  MANAIRALSMDAVQAANSGHPGMPMGMADVATVLWTEYLKHDAAAPDWADRDRFVLSAGH 70

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+LL+L GY   T+EDI+NFR + S  AGHPE     G+E TTGPLGQG+A AVG
Sbjct: 71  GSMLIYSLLHLSGYAHPTMEDIRNFRQLESPCAGHPENFLLDGVECTTGPLGQGLAMAVG 130

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           +AIAERKL  +FGD ++DH T+V+ GDGCLMEGI+ EAI  AGHL L ++ VLWD+N I+
Sbjct: 131 LAIAERKLNADFGDAIVDHKTWVIAGDGCLMEGINHEAIGLAGHLKLGRMNVLWDDNQIT 190

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG   L+ S D  AR+ A+GW+  S +GHD   I   L +AQ  ++P++IAC TVIG G
Sbjct: 191 IDGSTDLSTSEDIKARYEATGWHVTSCDGHDFDDIRRALDEAQADERPSLIACRTVIGKG 250

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +PN+ GT+  HG+ LG EEI A R  L WD  PF IP+ ++  WR      ++  + W +
Sbjct: 251 APNKQGTSATHGAPLGDEEISAARDVLGWDYKPFEIPEQVLSDWRGTADAGAKAHSQWTD 310

Query: 322 RLSSMKSSIRKEFERRFSDALPDCF--DNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           RLS      + +FERR S  LP  F  DN   +L K        +ATRK+SE+ LE +N 
Sbjct: 311 RLSGHDQ--KADFERRMSGDLPAKFSLDNYIQSLMK----DPVKVATRKASEMALEQINA 364

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            LP+ +GGSADLTGSN TK   +   +  D+SGRY++YG+RE  MAAAMNG+ALH G+ P
Sbjct: 365 MLPDTLGGSADLTGSNNTKAGGIGPFTADDYSGRYIYYGIREFGMAAAMNGMALHGGVIP 424

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTF+VF+DY R AIRL++L   R I+V+THDSIGLGEDGPTHQPVEH+ +LR IP+LL
Sbjct: 425 YGGTFLVFTDYCRAAIRLSALQQTRAIYVMTHDSIGLGEDGPTHQPVEHVQSLRMIPNLL 484

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA 559
           V+RPAD++ET ECW +AL+ K+RP+VL+L+RQ LP +R   E  ++C  GAY      NA
Sbjct: 485 VMRPADAVETAECWDIALRSKDRPTVLALTRQGLPQVRNHPEEIDMCLKGAYRLKEAGNA 544

Query: 560 -QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIA 618
            +VT+ +SGSE+ +A+   E L  + +   VVS+ C +LF EQ ++YR  +I +S + ++
Sbjct: 545 HKVTLIASGSEVHLALACAEELEKQGVGASVVSMVCTQLFDEQDEAYRKDLIPASSLLVS 604

Query: 619 IEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           IEAG   GW+ + G +G  IG+  FGAS     L++ FG  A AIV  +  KL+
Sbjct: 605 IEAGTTFGWERYTGENGLNIGLDRFGASAPAPDLFKKFGFTADAIVPQIMNKLN 658


>gi|167648870|ref|YP_001686533.1| transketolase [Caulobacter sp. K31]
 gi|167351300|gb|ABZ74035.1| transketolase [Caulobacter sp. K31]
          Length = 653

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/644 (52%), Positives = 448/644 (69%), Gaps = 11/644 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           KMADAIR LSMDA+    SGH G+PMGMADV T L+ + + FD   P W +RDRFVLSAG
Sbjct: 7   KMADAIRVLSMDAVHKAKSGHQGMPMGMADVATVLWGKFLKFDASKPDWVDRDRFVLSAG 66

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y+LL+L G++ +T+++I+NFR  GS T GHPE     G+E TTGPLGQG+A +V
Sbjct: 67  HGSMLLYSLLHLTGFKAMTMKEIENFRQWGSLTPGHPEVHHTPGVECTTGPLGQGLAMSV 126

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AE  L   FG  ++DH T+V+ GDGCLMEG+S EAIS AG L L+KL VL+D+N  
Sbjct: 127 GMAMAEAHLASRFGKDVVDHRTWVIAGDGCLMEGVSHEAISLAGRLKLNKLTVLFDDNNT 186

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           +IDG  ++A++ DQ ARF+A+GW   +V+GHDH  I + LR A   D+PT+IAC+T+I  
Sbjct: 187 TIDGEATIAETGDQLARFKAAGWAVKAVDGHDHGKIAAALRWATKQDRPTLIACKTLISK 246

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+  + G    HG  L  ++I+  R A+ WD  PF +PDDI K W+  G R ++ R  W+
Sbjct: 247 GAGPKEGDPHSHGYTLFDDQIRDARLAMGWDAQPFTVPDDIAKAWKSVGRRGAKVRKAWE 306

Query: 321 ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEH---SKPMIATRKSSELVLEVV 377
             + +  S +  +F R     LP    NAF  +         +KP  ATR  S   L+ +
Sbjct: 307 ATVKA--SPLADDFTRAMKGQLP---ANAFAAVDAHIAEAAKTKPGNATRVHSGAALDHL 361

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
              + ++IGGSADLTGSN T    M+     D++GRY+HYGVRE  MAAAMNG+ALH G+
Sbjct: 362 IPTITDMIGGSADLTGSNNTFVKGMQPFDAPDYAGRYVHYGVREFGMAAAMNGMALHGGV 421

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PYSGTF+ F+DYSRPAIRL +LMG +VIHV+THDSIGLGEDGPTHQPVEH+A+LRAIP+
Sbjct: 422 IPYSGTFLAFADYSRPAIRLGALMGAKVIHVMTHDSIGLGEDGPTHQPVEHVASLRAIPN 481

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           LLV RPAD++ET ECW++AL++   PSV+ LSRQ +P +R    + N  A GAY+ ++  
Sbjct: 482 LLVFRPADAVETAECWKIALEQTATPSVMCLSRQKVPGVRGD-ATENRSAKGAYELLAAE 540

Query: 558 --NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
             +A VTIF+SG+E+ IAV A ++L ++   TRVVS PC+ELF  QS +Y+A +IG +P 
Sbjct: 541 GGDAAVTIFASGTEVSIAVAARDLLQAQGKPTRVVSTPCWELFELQSAAYKASVIGKAPT 600

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           +IA+EA +R GW+ FIG +G F+GM GFGAS   + LY+ FGI 
Sbjct: 601 RIAVEAAIRMGWERFIGENGKFVGMTGFGASAPFERLYKEFGIT 644


>gi|91762278|ref|ZP_01264243.1| Transketolase [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718080|gb|EAS84730.1| Transketolase [Candidatus Pelagibacter ubique HTCC1002]
          Length = 652

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/653 (50%), Positives = 448/653 (68%), Gaps = 11/653 (1%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +K +++AIRFLS+DA++  NSGHPG+PMGMADV T LF   + F+P+ P W NRDRFVLS
Sbjct: 5   HKDLSNAIRFLSIDAVQKANSGHPGMPMGMADVATVLFKNFLRFNPKNPNWINRDRFVLS 64

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML Y+LL+L GY+ +++ D+KNFR + S  AGHPEY    GIE TTGPLGQGIAN
Sbjct: 65  AGHGSMLLYSLLHLTGYKSISLNDVKNFRQLKSICAGHPEYHPGTGIETTTGPLGQGIAN 124

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           +VG AIAE  L+++ G  +I+H TYVL GDGCLMEGIS EA+S AGHL L  L++L+DNN
Sbjct: 125 SVGFAIAEEILKKKLGKEIINHKTYVLAGDGCLMEGISHEAMSLAGHLKLKNLVMLFDNN 184

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            ISIDGP SLA S +   RF + GW+ + +NGH+   I S L+K Q + +PT+I+C+T I
Sbjct: 185 SISIDGPTSLAVSDNFKKRFESYGWDYILINGHNEREIFSALKKVQNAKRPTVISCKTKI 244

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           G+GSPN++G    HGS +G +EIK  RK L+W   PF IP  I+ +W+  G + ++  + 
Sbjct: 245 GYGSPNKSGKASSHGSPIGLDEIKLVRKVLDWKHKPFEIPKSILNEWKKIGNKGAKLDSA 304

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W +     K+ + K F+  FS AL     N+              +A+RK+SEL L  + 
Sbjct: 305 WSKIYKRKKNLVDKVFKNNFSKALKSEKQNSL--------RENKSLASRKASELTLNALT 356

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
                LIGGSADL GSN TKT    AI+  +F+G Y+HYGVREHAMA  MNG+ALH    
Sbjct: 357 RENNTLIGGSADLAGSNNTKTKYHNAINSVNFNGDYIHYGVREHAMAGIMNGLALHSKFI 416

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF++FSDY +P+IRL++LM  RVI+V+THDSIGLGEDGPTHQP+E L+ LR+IP+L
Sbjct: 417 PYGGTFLIFSDYCKPSIRLSALMQQRVIYVMTHDSIGLGEDGPTHQPIEQLSGLRSIPNL 476

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN 558
            V RPAD +ET+ECW++ALK    PSVLSL+RQNL  +R +Y + N C+LGAY+ +S  N
Sbjct: 477 NVFRPADRMETIECWELALKNSKTPSVLSLTRQNLEPIRKKYSNMNKCSLGAYE-VSRTN 535

Query: 559 AQV--TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
            ++  TIF+SGSE+ +A+E    L+   I ++V+SVPC ++F  QS +Y+ +I+  +  K
Sbjct: 536 KKINLTIFASGSEVNLAIETSHKLAKDKIYSKVISVPCQDIFDLQSKAYKKKILNEAKFK 595

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
           I+IEA     W  +IG++G   G+  FG S     +Y++FG+    I    ++
Sbjct: 596 ISIEAASTDCWKKYIGTEGLAFGIDTFGKSAPYKEIYKYFGLTVQNISQKAKK 648


>gi|114767113|ref|ZP_01445994.1| transketolase [Pelagibaca bermudensis HTCC2601]
 gi|114540716|gb|EAU43783.1| transketolase [Roseovarius sp. HTCC2601]
          Length = 672

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/655 (50%), Positives = 444/655 (67%), Gaps = 9/655 (1%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+   A AIR L++DA+   NSGH G+P+GMADV T L+++ + FD + P W +RDRF+L
Sbjct: 12  DHWMRATAIRALTLDAVAAANSGHSGMPIGMADVATVLWSKHLKFDAKTPTWADRDRFIL 71

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML YALLYL G + +T+E +KNFR  GS+TAGHPE      IE TTGPLGQGIA
Sbjct: 72  SAGHGSMLLYALLYLSGDEQITLEQVKNFRQWGSRTAGHPENFHADAIEMTTGPLGQGIA 131

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           ++VG A+AE  LR  FG   ++H+TYV+ GDGCLMEG+SQEA+  AG   L +LIV+WDN
Sbjct: 132 HSVGFAMAEEILRARFGKAAMNHHTYVIAGDGCLMEGVSQEALGLAGRYELGRLIVMWDN 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQ-LSDKPTMIACET 256
           N I+IDG +SL+D TDQ ARF+ASGW+   ++GHD  AI + +  A+ ++DKP+MIAC+T
Sbjct: 192 NDITIDGKVSLSDRTDQVARFKASGWHVQEIDGHDPEAIDAAITAAKKVTDKPSMIACKT 251

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
            I  G   +  T+K HG+    E+    +    W   PF +P +I   W   G R +  R
Sbjct: 252 HIALGHAAQ-DTSKGHGALTNAEQNADAKAGWGWTTGPFEVPAEIKSWWEEIGTRGAAER 310

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
             W  R++SM    + EF R  +   P    +    LKK+   ++P +ATRK+SE+VLEV
Sbjct: 311 EAWGGRIASMSDRKQAEFARTMAGDAPKKLSSVIRALKKQSTETEPKVATRKASEMVLEV 370

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +N  +PE +GGSADLTGSN TKT  M      +  GRY+++G+REH M++AMNG+ LH G
Sbjct: 371 INPVMPETVGGSADLTGSNNTKTGDMGVFDTDNRGGRYVYWGIREHGMSSAMNGMGLHGG 430

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           + PY GTFM F+DY+RPA+RLA+L     + V+THDSIGLGEDGPTHQP+EHLA  RA P
Sbjct: 431 IRPYGGTFMAFTDYARPAMRLAALQQTPTVFVMTHDSIGLGEDGPTHQPIEHLAISRATP 490

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           + LV RPAD +ET E W++AL +K  PSVLSL+RQN+P +RTQ+++NNL   GAY     
Sbjct: 491 NTLVFRPADVVETAEAWEIALTQKTTPSVLSLTRQNVPTVRTQHKTNNLVEKGAYVLADA 550

Query: 557 PNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
               QV + ++GSE+ IA+EA ++L +  I TRVVS+PCFELF  Q ++YR +++   P+
Sbjct: 551 EGKRQVILMATGSEVAIALEARDLLQAEGIGTRVVSMPCFELFEAQDEAYRKRVLPGGPV 610

Query: 616 KIAIEAGLRQGWDAF-IGSDG-----SFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           ++A+EA  R GWD + +G  G      F+GM GFGAS   + LY+ FGI A  + 
Sbjct: 611 RVAVEAATRFGWDKWLLGERGREAKAGFVGMDGFGASAPAETLYEQFGITAEGVA 665


>gi|114798491|ref|YP_762127.1| transketolase [Hyphomonas neptunium ATCC 15444]
 gi|114738665|gb|ABI76790.1| transketolase [Hyphomonas neptunium ATCC 15444]
          Length = 657

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/656 (53%), Positives = 457/656 (69%), Gaps = 8/656 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MA+A+R LSMDA+E   SGH GLP+GMAD  T LF + + FDP+ P W +RDRFVLSA
Sbjct: 6   RDMANAVRALSMDAVEAAKSGHVGLPLGMADAATVLFRKFLKFDPKDPNWADRDRFVLSA 65

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY  V+ +DI+NFR +G+ T GHPE     G+E TTGPLGQGIA A
Sbjct: 66  GHGSMLIYSLLHLTGYASVSRDDIRNFRQMGASTPGHPENFVTTGVETTTGPLGQGIATA 125

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAER L   FG+ L+DH T+V+ GDGCLMEG+SQEAI+ AGH+ L+KLIVL+D+N 
Sbjct: 126 VGMAIAERHLNARFGNDLVDHRTWVVAGDGCLMEGLSQEAITLAGHMKLNKLIVLFDDNA 185

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ++IDG   L+DSTDQ ARF ASGW +  V+GHD   + + L+ A    KP  +A +T+IG
Sbjct: 186 VTIDGSTDLSDSTDQCARFEASGWISRRVDGHDEKDVEAALKWATKQKKPVFLAVKTIIG 245

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
           FG+P  AGT K HG   G EEI   RK+LNW   PF +P+ I K W  AG RS    A W
Sbjct: 246 FGAPKLAGTGKAHGGPYGAEEIDGIRKSLNWPHAPFEVPEAIEKAWAKAGERSVAEHAAW 305

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           ++RL++  S  + EF    +  LP     A I  KK         ATR  S   LEV+  
Sbjct: 306 KKRLAA--SPHKGEFNAAIAGRLPKNLGKAIIKHKKAVAEGGASKATRVWSGEALEVITG 363

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            +PE++GGSADL+GSN TKTS    ++   +SGRY+HYGVREHAMAAAMNG+ALH G+ P
Sbjct: 364 LVPEMVGGSADLSGSNNTKTSHTAPMTPKSWSGRYIHYGVREHAMAAAMNGMALHGGIIP 423

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           YSGTF+VF+DYSR AIRL +LMG +VIHV+THDSIGLGEDGPTHQPVEH+A+LRA+P+++
Sbjct: 424 YSGTFLVFADYSRAAIRLGALMGTQVIHVMTHDSIGLGEDGPTHQPVEHVASLRAMPNMV 483

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP-- 557
           V RPAD +ET ECW++AL   + P+ ++L+RQN+   R  +   NL A G   Y+ +P  
Sbjct: 484 VFRPADGVETAECWELALHRNDGPATMALTRQNVAPARKTHTDENLSAKGG--YVLSPAG 541

Query: 558 --NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
               +  + ++GSE++IA++A  +L+   I+ RVVS+P  ELF +Q  +YRA+ +G    
Sbjct: 542 KGKERGVLIATGSEVEIALKAQAMLAEEGIAVRVVSMPSMELFGQQDAAYRAETLGKELP 601

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           K+AIEAG+R GWD +IG+DG F+GM  FGAS     LYQHFGI A A V  ++ ++
Sbjct: 602 KVAIEAGVRFGWDRWIGADGGFVGMDSFGASAPYQKLYQHFGITAEAAVAAIKERV 657


>gi|294085853|ref|YP_003552613.1| transketolase (TK) [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665428|gb|ADE40529.1| Transketolase (TK) [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 662

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/653 (54%), Positives = 450/653 (68%), Gaps = 12/653 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MA+AIR LSMDA+E   SGHPG+PMGMAD  T LF + M FD   P+WP+RDRFVLSA
Sbjct: 8   QNMANAIRALSMDAVEAAKSGHPGMPMGMADAATVLFDEHMKFDAADPHWPDRDRFVLSA 67

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY+D+T+++++NFR +GS+TAGHPE+G   GIE TTGPLGQGIANA
Sbjct: 68  GHGSMLIYALLHLTGYKDMTMDEVRNFRQLGSRTAGHPEFGHATGIETTTGPLGQGIANA 127

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+AER L   +GD L+DH+TYV+ GDGCLMEGIS EA S AGH GL KLIVL+D+N 
Sbjct: 128 VGMAMAERHLAARYGDDLVDHHTYVIAGDGCLMEGISHEAASIAGHFGLGKLIVLFDDNS 187

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDKPTMIACETVI 258
           ISIDG   LA S D   RF A GW  LSV+GHD  A++S L  A+  + +PT+I C+T I
Sbjct: 188 ISIDGSTDLAVSDDISQRFEAYGWQVLSVDGHDMAAVSSALSAAKAHTSQPTIIRCKTTI 247

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           G+G+P +AGT  VHG+ LG +EI   R AL W  +PF +PDDI+  WR AG R S  R  
Sbjct: 248 GYGAPTKAGTAGVHGAPLGGDEIAGARDALGWAHEPFIVPDDILSDWRDAGRRGSAEREA 307

Query: 319 WQER--LSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           WQ R   S+  S+        FS  + D    A I LK  +      +ATR +S+  +E 
Sbjct: 308 WQSRHAASASASAFDAAMTGDFSSDIND----AVIALKNAYAAEPQKLATRVASQKAIEA 363

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISK---SDFSGRYLHYGVREHAMAAAMNGIAL 433
           +    P L GGSADLTGSN T+ +  +   +    +++G Y+HYGVREH MAAAMNGIAL
Sbjct: 364 IMPACPILFGGSADLTGSNNTRVAAHEIFDQGRNGNYAGNYIHYGVREHGMAAAMNGIAL 423

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H G  PY GTFMVF+DY RP+IRL++LM  RVI+V+THDSIGLGEDGPTHQPVEHL+ALR
Sbjct: 424 HGGTIPYGGTFMVFTDYCRPSIRLSALMKQRVIYVMTHDSIGLGEDGPTHQPVEHLSALR 483

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY 553
            IP+LLV RP D +E  E WQ AL     PS+L+LSRQ +   R    + N  ALGAY  
Sbjct: 484 VIPNLLVFRPGDVVEAAEAWQCALASTTAPSILALSRQGMAQFRHGDMAENKTALGAYVA 543

Query: 554 ISTP-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
           +    +  VT+ +SGSE+ IA++A   L++  I+  VVSVPC ELF+ Q+  YR  ++G+
Sbjct: 544 VEADGDRAVTLMASGSEVGIAIDAQSKLAAVGIAAAVVSVPCLELFWMQNADYRKAVLGN 603

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
           SP +I IEAG+RQ WD  +  +  FIGM  FGAS   + LY HFGI + A+V+
Sbjct: 604 SP-RIVIEAGMRQCWDRLLSENDGFIGMDSFGASAPINDLYTHFGITSEAVVE 655


>gi|126729719|ref|ZP_01745532.1| transketolase [Sagittula stellata E-37]
 gi|126709838|gb|EBA08891.1| transketolase [Sagittula stellata E-37]
          Length = 657

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/650 (50%), Positives = 447/650 (68%), Gaps = 8/650 (1%)

Query: 23  ADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHG 82
           A AIR L++D +   NSGH G+P+GMADV T LF   + FD   P WP+RDRF+LSAGHG
Sbjct: 3   ATAIRALALDGVAQANSGHSGMPIGMADVATVLFGNHLKFDAANPEWPDRDRFILSAGHG 62

Query: 83  SMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGM 142
           SML Y+LLYL G  +VT++ +KNFR  GSKTAGHPE      +E TTGPLGQGIAN+VG 
Sbjct: 63  SMLIYSLLYLCGDPEVTLDQLKNFRQWGSKTAGHPENFLLKAVETTTGPLGQGIANSVGF 122

Query: 143 AIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISI 202
           A+AE  LR  FG  L+DH TYV+ GDGCLMEG+SQEAI+ AG   LSKL+V WDNN I+I
Sbjct: 123 AMAEEMLRARFGKKLVDHNTYVIAGDGCLMEGVSQEAITLAGRYALSKLVVFWDNNDITI 182

Query: 203 DGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGS 262
           DG +SL+D TDQ ARF+++GW+   ++GHD  AI + +  A+ SD+P+MIAC+T I  G 
Sbjct: 183 DGKVSLSDRTDQVARFKSAGWHVQEIDGHDPAAIDAAITAAKASDQPSMIACKTHIALGH 242

Query: 263 PNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQER 322
             +  T+K HG+    ++  A ++A +W   PF +P ++   W   G R +  R +W+ R
Sbjct: 243 AAQ-DTSKGHGALTNADQNIAAKEAWDWHTGPFEVPAEVKSWWESTGSRGAADRTEWEAR 301

Query: 323 LSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLP 382
           L+    + +KEF R  +   P         LKK+   ++P +ATRK+SE+ LEV+N  +P
Sbjct: 302 LADASDARQKEFARVIAGDAPKKLSATIKALKKQISETQPKVATRKASEMALEVINPIMP 361

Query: 383 ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSG 442
           E +GGSADLTGSN T T  +      +  GRY+++G+REH M++AMNGI LH GL PY G
Sbjct: 362 ETVGGSADLTGSNNTLTGDLGTFDIDNRKGRYVYWGIREHGMSSAMNGIGLHGGLRPYGG 421

Query: 443 TFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLR 502
           TFM F+DY+RPA+RLA+LM    + V+THDSIGLGEDGPTHQPVEHLA  RA P+ LV R
Sbjct: 422 TFMAFTDYARPAMRLAALMKTPTVFVMTHDSIGLGEDGPTHQPVEHLAISRATPNTLVFR 481

Query: 503 PADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA-QV 561
           PAD++ET E W++AL +K  PSVLSL+RQNLP +RT++++ NL   GAY         QV
Sbjct: 482 PADAVETAEAWEIALSQKASPSVLSLTRQNLPTVRTEHKTANLSEKGAYVLADAEGKRQV 541

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
            + ++GSE++IA++A E L +  I TRVVS+PC+ELF  Q ++YR +++ + P+++A+EA
Sbjct: 542 ILMATGSEVEIALKAREALQAEGIGTRVVSMPCWELFEAQDEAYRRKVLPAGPVRVAVEA 601

Query: 622 GLRQGWDAFIGSD------GSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
            +  GWD ++ S+      G+F+GM  FGAS   + LY+ FGI A A+ +
Sbjct: 602 AVGFGWDKWLFSERGKRDKGAFVGMTSFGASAPYETLYEKFGITAEAVAE 651


>gi|83951551|ref|ZP_00960283.1| transketolase [Roseovarius nubinhibens ISM]
 gi|83836557|gb|EAP75854.1| transketolase [Roseovarius nubinhibens ISM]
          Length = 672

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/670 (50%), Positives = 456/670 (68%), Gaps = 9/670 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + D+ K A AIR L++DA+   NSGH G+PMGMADV T LF + + FD   P W
Sbjct: 4   AALRTANPDHWKKATAIRALTLDAVHAANSGHSGMPMGMADVATVLFEKHLKFDASAPNW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
           P+RDRF+LSAGHGSML Y+LL+L GY+ + I+ I+NFR  G+ TAGHPE      IE TT
Sbjct: 64  PDRDRFILSAGHGSMLLYSLLHLTGYKGMEIDQIRNFRQWGALTAGHPENFLHDAIETTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGIAN+VG A+AE  LR  +G  L++HYTYV+ GDGCLMEGISQEAI  AG   L 
Sbjct: 124 GPLGQGIANSVGFAMAEESLRARYGAKLMNHYTYVIAGDGCLMEGISQEAIGLAGRHELG 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           +LIV WDNN I+IDG + L+D TDQ  RF+ASGW+ + ++GHD  AI + + +A+ + KP
Sbjct: 184 RLIVFWDNNNITIDGTVELSDRTDQVKRFKASGWHVIEIDGHDPKAIDAAITEAKKTSKP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           +MIAC+T I  G   +  T+K HG+   + ++ A ++A  W   PF +P DI + W   G
Sbjct: 244 SMIACKTHIALGHAAQ-DTSKGHGALTDEAQMAAAKEAYGWTSAPFDVPADIKQAWEAIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R +  R  W+ RL+      + EFER F+   P         LKK+     P +ATRKS
Sbjct: 303 ARGASEREAWEARLAEASERRQAEFERIFALDTPKQLSARIKALKKQISAEAPKVATRKS 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE+VLEVVN  +PE +GGSADLTGSN TKT  +      +  GRY+++G+REH MAAAMN
Sbjct: 363 SEMVLEVVNPIMPETMGGSADLTGSNNTKTGDLGVFDVENRKGRYIYWGIREHGMAAAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G+ PY GTFM F+DY+RPA+RLA+LM +  + V+THDSIGLGEDGPTHQPVEHL
Sbjct: 423 GMALHGGIRPYGGTFMCFTDYARPAMRLAALMKVPSVFVMTHDSIGLGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  RA P+ +V RP D++ET E W++AL  K  PSVLSL+RQ LP LRT++++ NL A G
Sbjct: 483 AISRATPNTMVFRPCDTVETAEAWELALSSKETPSVLSLTRQGLPTLRTEHKNKNLTAQG 542

Query: 550 AYDYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           AY         Q  + ++GSE++IA++A ++L +  I TRVVS+PC+ELF +Q +SYR +
Sbjct: 543 AYVLADAEGKRQAILLATGSEVEIAMKARDLLQAEGIGTRVVSMPCWELFEQQEESYRKR 602

Query: 609 II-GSSPIKIAIEAGLRQGWDAFI-GSDG-----SFIGMQGFGASGSCDLLYQHFGINAI 661
           ++ G + +++A+EA  RQGWD ++ G  G      F+GM+GFGAS   + L++ FGI A 
Sbjct: 603 VLPGGAAVRVAVEAAARQGWDRWLCGERGREARSGFVGMEGFGASAPAETLFEKFGITAE 662

Query: 662 AIVDMVERKL 671
           A+ + V+  L
Sbjct: 663 AVAEKVKSLL 672


>gi|254487321|ref|ZP_05100526.1| transketolase [Roseobacter sp. GAI101]
 gi|214044190|gb|EEB84828.1| transketolase [Roseobacter sp. GAI101]
          Length = 671

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/661 (49%), Positives = 446/661 (67%), Gaps = 8/661 (1%)

Query: 12  LMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPN 71
           L K   ++   A AIR L++DA+   NSGH G+PMGMADV T LF + + FD   P WP+
Sbjct: 6   LAKAHPEHWSKATAIRALTLDAVAAANSGHSGMPMGMADVATVLFEKHLKFDAANPLWPD 65

Query: 72  RDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGP 131
           RDRF+LSAGHGSML Y+LL+L+G     +E+IKNFR +G++TAGHPE      IE TTGP
Sbjct: 66  RDRFILSAGHGSMLIYSLLHLVGDAQFPLEEIKNFRQMGARTAGHPENFLADAIETTTGP 125

Query: 132 LGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKL 191
           LGQGIAN+VG A+AE   R ++G  ++DH+TYV+ GDGCLMEG+SQEAI+ AG   L KL
Sbjct: 126 LGQGIANSVGFAMAEEIQRAQYGKKIVDHFTYVIAGDGCLMEGVSQEAIALAGRHKLGKL 185

Query: 192 IVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTM 251
           IV+WDNN I+IDGP+SL+D+ DQ ARF+A+ W+ + ++GH+   I + L +A+ SD P+M
Sbjct: 186 IVMWDNNNITIDGPVSLSDTVDQVARFKAADWHVIEIDGHNPDEIDAALTEARKSDLPSM 245

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLR 311
           IAC+T I  G   +  T+K HG+    +++ A + A  W   PF +P D+   W   G R
Sbjct: 246 IACKTHIALGHAAQ-DTSKGHGALTDADQMAAAKAAYGWTTGPFEVPADVKSAWEAIGSR 304

Query: 312 SSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
            +  R  W+ER  +M  + R+EF R  +   P          KK+   + P +ATR SSE
Sbjct: 305 GAADRKAWEERFDTMSRAKREEFNRALAGDAPKKLSATIKAFKKQMSEAAPKLATRASSE 364

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LEV+N    E +GGSADLTGSN TKT+ +      +  GRY+++G+REH MA+AMNG+
Sbjct: 365 KTLEVLNPLYVETVGGSADLTGSNNTKTADLGVFDIDNRGGRYVYWGIREHGMASAMNGM 424

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G+ PY GTFM F+DY+RPA+RLA+LM I  + V+THDSIGLGEDGPTHQPVEHLA 
Sbjct: 425 ALHGGIRPYGGTFMCFTDYARPAMRLAALMQIPTVFVMTHDSIGLGEDGPTHQPVEHLAI 484

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
            RA P+  V RPAD++ET E W++AL  KN PSVLSL+RQ LP +R ++++ NL   GAY
Sbjct: 485 SRATPNTYVFRPADTVETAEAWEIALTSKNTPSVLSLTRQGLPTVRLEHKNKNLTEQGAY 544

Query: 552 DYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
                    QV + ++GSE++IA++A +IL  + I TRVVS+PC ELF EQ ++YR +++
Sbjct: 545 VLADAEGKRQVILIATGSEVEIALKARDILQEQGIGTRVVSMPCMELFAEQDEAYRRRVL 604

Query: 611 GSSPIKIAIEAGLRQGWDAFIGSD------GSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
            + P+++ +EA +RQGWD ++  +        F+GM  FGAS   + L++ FGI A  + 
Sbjct: 605 PAGPVRVGVEAAVRQGWDRWLTGERGKWNKADFVGMDRFGASAPAEELFEKFGITAQNVA 664

Query: 665 D 665
           D
Sbjct: 665 D 665


>gi|12584161|gb|AAG59818.1| transketolase [Brucella abortus]
          Length = 652

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/651 (52%), Positives = 452/651 (69%), Gaps = 10/651 (1%)

Query: 31  MDAIENVNSGHPGLPMGMADVVT-ALFTQCMVFDPQCPYW-PNRDRF-VLSAGH--GSML 85
           MDA+E  NSGHPGL  G +     AL+   +    + P+    RDRF    AG    + L
Sbjct: 1   MDAVEKANSGHPGLADGRSRYSDDALYPFPLARARKNPHLGRTRDRFRAFPAGQRLDAAL 60

Query: 86  YYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMAIA 145
           +   ++  GY+D+TI++IK FR +GS              +       + +       I+
Sbjct: 61  FRCSIFA-GYEDITIDEIKKFRQLGSAPRATLNMAMPLASKRRPARSDRVLPMPSAWRIS 119

Query: 146 ERKLR--EEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISID 203
           ER L        +   HYTY LVGDGCLMEGISQEAI+ AGHL L+KLIVLWD+N ISID
Sbjct: 120 ERILEWPSSVTSLQSIHYTYALVGDGCLMEGISQEAIALAGHLKLNKLIVLWDDNNISID 179

Query: 204 GPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSP 263
           GPI+L+D+TDQ ARF ASGWNT++V+GHD  AI   +    +SD+PT+IAC+T IGFG+P
Sbjct: 180 GPITLSDNTDQPARFAASGWNTMAVDGHDQDAIAKAIVTGPVSDRPTLIACKTTIGFGAP 239

Query: 264 NRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG-LRSSQTRADWQER 322
           N+AGTNKVHGS LG EEI AT +AL    +PF +P + +  WR+AG   +++ R +W++R
Sbjct: 240 NKAGTNKVHGSTLGAEEIAATARALGLSSEPFVVPAEFLNAWRVAGGFNAAKKRLEWEKR 299

Query: 323 LSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLP 382
           LSS+++  R EFERR    LP  FD A +  KKK    KP +ATRKSSE+ LEV+N  +P
Sbjct: 300 LSSVEAETRAEFERRMRGELPSGFDAAIVEYKKKLSADKPKVATRKSSEMALEVINGVVP 359

Query: 383 ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSG 442
           E +GGSADLTGSN TKTSQ KA++  ++ GRY+HYG+RE  MAAAMNGI L     P   
Sbjct: 360 ETVGGSADLTGSNNTKTSQTKAVTPENYDGRYIHYGIRELGMAAAMNGITLEWRPDPLFR 419

Query: 443 TFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLR 502
             +VFSDY    +RL+SLMGIRV++V+THDSIGLGEDGPTHQPVEHLAALRAIP+  V R
Sbjct: 420 HLLVFSDYGVRPMRLSSLMGIRVVYVMTHDSIGLGEDGPTHQPVEHLAALRAIPNHNVFR 479

Query: 503 PADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY-ISTPNAQV 561
           PAD++ET ECWQ+AL  +  PS L+L+RQNLP +RT++   NLCA GAY+   ++ +A+V
Sbjct: 480 PADAVETAECWQLALHSRKTPSTLALTRQNLPTVRTEHREENLCAFGAYELAAASSDAKV 539

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
           TIF++GSE++IA++A ++L  + I+TRVVSVPCFELF +QSD+Y+   IG +P+K+AIEA
Sbjct: 540 TIFATGSEVEIALKARDLLEGKGIATRVVSVPCFELFEQQSDAYKEATIGDAPVKLAIEA 599

Query: 622 GLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
            +  GW+ FIG +G FIGM+GFGASG  + LY+HFGI A   V+  E+KL+
Sbjct: 600 AISLGWERFIGGNGIFIGMKGFGASGEINDLYKHFGITAEHAVEAAEKKLN 650


>gi|254454573|ref|ZP_05068010.1| transketolase [Octadecabacter antarcticus 238]
 gi|198268979|gb|EDY93249.1| transketolase [Octadecabacter antarcticus 238]
          Length = 689

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/670 (49%), Positives = 447/670 (66%), Gaps = 9/670 (1%)

Query: 11  VLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWP 70
            L K   ++   A AIR L++DA+   NSGH G+PMGMADV T LF + + FDP+ P+WP
Sbjct: 21  ALRKAHPEHWMRAAAIRTLTLDAVAAANSGHSGMPMGMADVATVLFEKHLRFDPKAPHWP 80

Query: 71  NRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTG 130
           +RDRF+LSAGHGSML YALL+L GY+  T++ +K+FR  G++TAGHPEYG   G+E TTG
Sbjct: 81  DRDRFILSAGHGSMLIYALLHLTGYEQATLQQLKDFRQWGARTAGHPEYGHMDGVETTTG 140

Query: 131 PLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSK 190
           PLGQGIAN+VG AIAE  LR  +G  +++H+TYV+ GDGCLMEGISQEAI  AG   L  
Sbjct: 141 PLGQGIANSVGFAIAEEILRARYGSSVVNHHTYVIAGDGCLMEGISQEAIGLAGMQELGH 200

Query: 191 LIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPT 250
           LI  +DNN I+IDGP++LAD T+Q ARF ASGW+ + ++GHD  AI + +  A+   +P+
Sbjct: 201 LICFFDNNNITIDGPVALADITNQSARFVASGWHVIDIDGHDPDAIDAAITAAKADPRPS 260

Query: 251 MIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGL 310
           MI C+T I  G   +  T+K HG+    ++++A +    W   PF +P D+  +W   G 
Sbjct: 261 MINCKTHIALGHAAQ-DTSKGHGALTDADQLQAAKDTYGWTYGPFEVPADVKSQWEAMGK 319

Query: 311 RSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSS 370
           R +   ADW  R + + S+ + EF R  +   P          KK+   +   +ATR SS
Sbjct: 320 RGAAAHADWHTRFAKLSSAKQDEFNRALALDAPKKLSATIKAFKKQVSDAGAKMATRSSS 379

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           E VLEV+N  + E +GGSADLTGSN TKTS +   S  + +GRY+HYG+REH MAAAMNG
Sbjct: 380 EKVLEVINPIMQETVGGSADLTGSNNTKTSDLGVFSPDNRAGRYIHYGIREHGMAAAMNG 439

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           + LH G+ PYSGTFM F+DY+R A+RL++LM I  ++V+THDSIGLGEDGPTHQPVEHLA
Sbjct: 440 MVLHGGIRPYSGTFMCFTDYARGAMRLSALMEIPTVYVMTHDSIGLGEDGPTHQPVEHLA 499

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
            LRA P+  V RPAD++E  E W++A   K  PSV+ LSRQ LP +RT++++ N+ A GA
Sbjct: 500 ILRATPNTHVFRPADTVEVAEAWELAFTSKTTPSVMCLSRQGLPLVRTEHKTKNMTAQGA 559

Query: 551 YDYISTPNA--QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           Y      N   Q  + ++GSE+ +A+ A +IL +  I TRVVS+PC+ELF  Q +S R +
Sbjct: 560 YVLADAENGKRQAILMATGSEVSVAMAARDILEAEGIGTRVVSMPCWELFEAQEESIRKR 619

Query: 609 IIGSSPIKIAIEAGLRQGWDAFI------GSDGSFIGMQGFGASGSCDLLYQHFGINAIA 662
           ++   P+++AIEAG+R GWD ++       S   F+GM  FGAS    +L++ FGI A A
Sbjct: 620 VLPGGPVRVAIEAGVRLGWDKWLLGERGRESKAGFVGMDSFGASAPAPILFEKFGITAEA 679

Query: 663 IVDMVERKLS 672
               V   L+
Sbjct: 680 TAQKVRDLLA 689


>gi|260428143|ref|ZP_05782122.1| transketolase [Citreicella sp. SE45]
 gi|260422635|gb|EEX15886.1| transketolase [Citreicella sp. SE45]
          Length = 672

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/662 (49%), Positives = 451/662 (68%), Gaps = 9/662 (1%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D+ + + AIR L++DA+   NSGH G+P+GMADV T L+++ + FD + P W +RDRF+L
Sbjct: 12  DHWQRSTAIRALTLDAVAAANSGHSGMPIGMADVATVLWSKHLKFDVKNPNWHDRDRFIL 71

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           SAGHGSML Y+LLYL G   +T++++KNFR  GS+TAGHPE      IE TTGPLGQGIA
Sbjct: 72  SAGHGSMLIYSLLYLTGDAQITLDEVKNFRQWGSRTAGHPENTHADAIEMTTGPLGQGIA 131

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           ++VG A+AE  LR   G  ++DH+TYV+ GDGCLMEG+SQEA+  AG  GL +L++ WDN
Sbjct: 132 HSVGFAMAEEILRARHGKQVVDHHTYVIAGDGCLMEGVSQEALGIAGRYGLGRLVLFWDN 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQ-LSDKPTMIACET 256
           N I+IDG +SL+D TDQ ARF+ASGW+   ++GHD  AI + +  A+ ++D+P+MIAC+T
Sbjct: 192 NDITIDGKVSLSDRTDQVARFKASGWHVQEIDGHDPEAIDAAIVAAKKVTDQPSMIACKT 251

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
            I  G   +  T+K HG+    ++    + A  W   PF IP +I   W  AG R +  R
Sbjct: 252 HIALGHAAQ-DTSKGHGALTNADQNADAKAAWGWTTGPFEIPAEIKSWWEEAGSRGAAER 310

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
             W+ RL+++    + EF R  S  +P    +    LKK+   + P +ATRK+SE+VLEV
Sbjct: 311 EAWETRLAALSERKQAEFNRVMSGDVPKKLSSVIRALKKQNSEAAPKVATRKASEMVLEV 370

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           VN  L E +GGSADLTGSN TKT  +      +  GRY+++G+REH MA+AMNG++LH G
Sbjct: 371 VNPVLTETVGGSADLTGSNNTKTGDLGVFDVDNRKGRYVYWGIREHGMASAMNGMSLHGG 430

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           + PY GTFM F+DY+RPA+RLA+L     + V+THDSIGLGEDGPTHQP+EHLA  RA P
Sbjct: 431 IRPYGGTFMAFTDYARPAMRLAALQKTPTVFVMTHDSIGLGEDGPTHQPIEHLAISRATP 490

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           + LV RPAD IET E W++A  +   PSVLSL+RQNLP +RTQ+++NNL A GAY     
Sbjct: 491 NTLVFRPADLIETAEAWEIAFSQTETPSVLSLTRQNLPTVRTQHKNNNLTAQGAYVLAEA 550

Query: 557 PNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
               Q  + ++GSE++IA+ A ++L +  I TRVVS+PC+ELF  Q ++YR +++ + P+
Sbjct: 551 EGKRQAILLATGSEVEIALAARDLLQAEGIGTRVVSMPCWELFEAQDEAYRKRVLPAGPV 610

Query: 616 KIAIEAGLRQGWDAFI-GSDG-----SFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
           ++A+EA  R GWD ++ G  G      F+GM+GFGAS   + LY+ FGI A  +   V+ 
Sbjct: 611 RVAVEAAARFGWDRWLFGERGREAKAGFVGMEGFGASAPAETLYEKFGITAEGVAAKVKS 670

Query: 670 KL 671
            L
Sbjct: 671 LL 672


>gi|260574361|ref|ZP_05842365.1| transketolase [Rhodobacter sp. SW2]
 gi|259023257|gb|EEW26549.1| transketolase [Rhodobacter sp. SW2]
          Length = 652

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/640 (54%), Positives = 446/640 (69%), Gaps = 6/640 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K MA+AIR L+MDA++  NSGHPG+PMGMADV T LF + M  DP    W NRDRF+LSA
Sbjct: 7   KTMANAIRALAMDAVQAANSGHPGMPMGMADVATVLFNRFMTVDPAADRWMNRDRFILSA 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YAL +L+GY D+ I+ IK FR +GS+TAGHPEYG   GIE TTGPLGQGIA +
Sbjct: 67  GHGSMLIYALNHLMGYSDMGIDQIKAFRQLGSRTAGHPEYGHAKGIEVTTGPLGQGIATS 126

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+AER     F D L+DH+TYV+ GDGCLMEGIS EAI  AGHLGL +LIV+WD+N 
Sbjct: 127 VGMALAERMGAARFPD-LVDHFTYVIAGDGCLMEGISHEAIDMAGHLGLGRLIVMWDDNK 185

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           I+IDG   L+ ST+Q ARF ASGW+  +V+GH+   I + +  A++  +P++IAC T+IG
Sbjct: 186 ITIDGDTELSTSTNQAARFAASGWHVQAVDGHNPEEIAAAITAARVDPRPSLIACRTIIG 245

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
           FG+PN+ G++ VHG+ LG  EI A R+ L W   PF IP D+   W     R +   A W
Sbjct: 246 FGAPNKQGSHDVHGAPLGDAEIAAAREFLGWPHAPFVIPQDVYDAWHKVSARGAAAHAAW 305

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           + RL++  S  R  F    +   P     A    K +    KP +ATRK+SE+ L VVN 
Sbjct: 306 EARLAT--SPNRDAFAVALA-CDPAPLTPAMAAYKAQLLVDKPKVATRKASEMALGVVNG 362

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            LP +IGGSADLTGSN T+T   K+++K+D+SG Y+HYG+REH MAAAMNGIALH     
Sbjct: 363 TLPFVIGGSADLTGSNLTRTKGQKSVTKADYSGSYIHYGIREHGMAAAMNGIALHGLFKT 422

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTFM F+DY RP+IRLA+LMG+ V +V+THDSIGLGEDGPTHQPVEHLA+LRAIP+L 
Sbjct: 423 YGGTFMAFADYCRPSIRLAALMGVPVTYVMTHDSIGLGEDGPTHQPVEHLASLRAIPNLN 482

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA 559
           V+RP D +ET E W++A+     P++L LSRQNLP +RT     NL A GAY      N 
Sbjct: 483 VIRPCDVMETAEAWEMAMASTCTPTLLVLSRQNLPLVRTA-AGENLTAKGAYVLRDVANR 541

Query: 560 QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAI 619
           QVT+ S+GSE++IA+ A + L++  I   VVS PCFE F  Q  +Y+AQ++G +P ++ +
Sbjct: 542 QVTLISNGSEIEIALAAADALAADGIRAAVVSAPCFETFAAQPAAYQAQVLGDAP-RVGV 600

Query: 620 EAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           EA +RQGWD  +     FIGM GFGAS     LY+HFGI 
Sbjct: 601 EAAIRQGWDNLLRHTDGFIGMTGFGASAPAPQLYKHFGIT 640


>gi|126726348|ref|ZP_01742189.1| transketolase [Rhodobacterales bacterium HTCC2150]
 gi|126704211|gb|EBA03303.1| transketolase [Rhodobacterales bacterium HTCC2150]
          Length = 684

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/668 (51%), Positives = 437/668 (65%), Gaps = 8/668 (1%)

Query: 12  LMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPN 71
           L +   ++  MA AIR L++DA+   NSGH G+PMGMADV T LF   + FD   P W +
Sbjct: 18  LREKHPEHWNMACAIRTLTLDAVAAANSGHSGMPMGMADVATVLFKNHLKFDASAPKWAD 77

Query: 72  RDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGP 131
           RDRF+LSAGHGSML Y+LL+L G  D+T++ +KNFR  G+ TAGHPEYG   G+E TTGP
Sbjct: 78  RDRFILSAGHGSMLIYSLLHLTGSADMTLDQVKNFRQWGAITAGHPEYGHVDGVETTTGP 137

Query: 132 LGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKL 191
           LGQGIANAVG A+AE   R  FG  L+DH TYV+ GDGCLMEGISQEAI  AG   LSKL
Sbjct: 138 LGQGIANAVGFALAEEVQRATFGRKLVDHMTYVIAGDGCLMEGISQEAIGIAGKHQLSKL 197

Query: 192 IVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTM 251
           +VLWD+NGI+IDG + L+D TDQ ARF+ASGW  L  +GHD   I   L  A+   KPTM
Sbjct: 198 VVLWDDNGITIDGKVELSDVTDQKARFKASGWQVLECDGHDPEDIDRALTAAKKGKKPTM 257

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLR 311
           IAC+T I  GS  +  T+K HG+      I  TR    W+   F IP  +   W   G +
Sbjct: 258 IACKTHIALGSSAQ-DTSKGHGALTDATLIADTRAVYGWENGAFDIPKGVKDAWESVGSK 316

Query: 312 SSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
            +   A+WQ RL +M    RKEF R  S        N    +KK    + P +ATRK+SE
Sbjct: 317 GAAAHAEWQTRLEAMGEGRRKEFLRIQSGEPHRRLPNLIRQIKKDASENAPKMATRKASE 376

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
            VL+ +N  + E  GGSADLTGSN T T  M   S  +  GRY++YG+REH MAAAMNG+
Sbjct: 377 AVLKAINPVMKETFGGSADLTGSNNTLTDDMGVHSPENRKGRYMYYGIREHGMAAAMNGM 436

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G   Y GTFM F+DY+R A+RL++LMG+ V +V+THDSIGLGEDGPTHQPVEHL+ 
Sbjct: 437 ALHGGTRAYGGTFMCFTDYARGAMRLSALMGVPVTYVMTHDSIGLGEDGPTHQPVEHLSM 496

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LRA P+  V RPAD +ET E W+ A+     P VL+LSRQNLP +R+++   N+ + GAY
Sbjct: 497 LRATPNTHVFRPADLVETAEAWECAMSSTKTPHVLALSRQNLPLVRSKHIPKNMSSFGAY 556

Query: 552 DYI-STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
               S    Q  + ++GSE+ IA+EA E+L +  I TRVVS+PC+ELF EQ ++YR +++
Sbjct: 557 VLAESEGKRQAILMATGSEVSIAMEARELLQAEGIGTRVVSMPCWELFAEQDEAYRKRVL 616

Query: 611 GSSPIKIAIEAGLRQGWDAF-IGSDG-----SFIGMQGFGASGSCDLLYQHFGINAIAIV 664
                ++AIEAG+R GWD + +G  G      FIGM GFGAS   + LY+ FGI A A V
Sbjct: 617 PGGSARVAIEAGVRHGWDQWLLGERGREARSGFIGMPGFGASAPAETLYEKFGITAEATV 676

Query: 665 DMVERKLS 672
             V+  L+
Sbjct: 677 AKVKALLA 684


>gi|148260223|ref|YP_001234350.1| transketolase [Acidiphilium cryptum JF-5]
 gi|326403409|ref|YP_004283490.1| transketolase [Acidiphilium multivorum AIU301]
 gi|146401904|gb|ABQ30431.1| transketolase [Acidiphilium cryptum JF-5]
 gi|325050270|dbj|BAJ80608.1| transketolase [Acidiphilium multivorum AIU301]
          Length = 677

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/655 (50%), Positives = 442/655 (67%), Gaps = 8/655 (1%)

Query: 8   RNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCP 67
           +  VL +   + +++A+A+R L++D +E   SGHPG+PMGMADV T L+T+ M FD   P
Sbjct: 16  QKAVLARPMTETRRLANAVRALAIDGVEAAKSGHPGMPMGMADVATVLWTKFMKFDAADP 75

Query: 68  YWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEA 127
           +WP+RDRF+LSAGHGSML YALL+L GY+ ++I+D++ FR +G++ AGHPE      IE 
Sbjct: 76  HWPDRDRFILSAGHGSMLLYALLHLTGYEGMSIDDLRQFRQLGARAAGHPERIEHPAIEM 135

Query: 128 TTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLG 187
           TTGPLGQGI+ A G A+AER L   FG  L+DH T+V+  DG +MEG+S EA + AGHLG
Sbjct: 136 TTGPLGQGISTATGFALAERMLAARFGKGLVDHRTWVIASDGDMMEGVSHEACAIAGHLG 195

Query: 188 LSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSD 247
           L KL V +D+N ISIDG   +A + D   RF   GW T  ++GHD   I S +R A  S 
Sbjct: 196 LDKLTVFYDDNSISIDGGTDIAMTDDVLKRFAGYGWATRRIDGHDPEQIESAIRFALRSR 255

Query: 248 KPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRL 307
           KPT+IAC T+IGFG+P +AGT   HGS LG +E  A +  L W   PF +PDDI+  WR 
Sbjct: 256 KPTLIACRTIIGFGAPKKAGTPATHGSPLGADEAAAAKALLGWTAPPFTVPDDILAPWRA 315

Query: 308 AGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATR 367
           AG RS+     W +R ++  S+ R  F+   +  LP  +  A   L++K    KP +ATR
Sbjct: 316 AGSRSAGAHRAWTKRHAA--SNQRAAFDAALAGDLPADYTAAMAALREKIAAEKPNVATR 373

Query: 368 KSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAA 427
           ++S++ L+ V   +PE++GGSADLT SN T    M   +  D +GRY+H+GVREH M   
Sbjct: 374 QASQMALDAVVPVVPEMVGGSADLTPSNNTFVKSMGVFTAKDHAGRYIHFGVREHGMGTT 433

Query: 428 MNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVE 487
           +NG+ALH GL PY GTF +FSDY RPAIRLA+LM IR I VLTHDSIGLGEDGPTHQPVE
Sbjct: 434 LNGLALHGGLIPYGGTFFIFSDYCRPAIRLAALMRIRSIFVLTHDSIGLGEDGPTHQPVE 493

Query: 488 HLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCA 547
           HLA+ RA+P++LVLRP D++ET ECW +ALK K+ P +L LSRQ +P L   + + NL A
Sbjct: 494 HLASFRAMPNVLVLRPGDAMETAECWDIALKHKDGPVLLVLSRQAMPTLPRDHGAENLSA 553

Query: 548 LGAYDYISTPNA---QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDS 604
            G   Y+  P A   + TI ++GSE+ +A++A E+L++  I+  V SVP FEL   Q   
Sbjct: 554 RGG--YVVAPAAGPRRATILATGSEVALALKAREMLAAEGITVAVASVPSFELLERQDPG 611

Query: 605 YRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           YR +++G +P ++ +EA +  GW+  +G DG+FIGM GFGAS     L+QHFGI 
Sbjct: 612 YRTEVLGEAP-RVGVEAAVGFGWERLLGPDGTFIGMHGFGASAPYQKLFQHFGIT 665


>gi|89071316|ref|ZP_01158473.1| transketolase [Oceanicola granulosus HTCC2516]
 gi|89043168|gb|EAR49405.1| transketolase [Oceanicola granulosus HTCC2516]
          Length = 672

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/667 (51%), Positives = 454/667 (68%), Gaps = 9/667 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L K   D+ KMA AIR L++DA+   NSGH G+P+GMAD+ T L+   + FDP+ P W
Sbjct: 4   AALRKAHPDHWKMAAAIRALALDAVAAANSGHTGMPLGMADIATVLYRNHLRFDPKSPDW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
            +RDRF+LS GHGSML YALL+L GY+++T+E+IKNFR  GS TAGHPE     GIE TT
Sbjct: 64  ADRDRFILSNGHGSMLLYALLHLTGYEEMTLEEIKNFRQWGSITAGHPENVLAKGIETTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQG AN+VG AIAE  LR  FG  L+DH T+V  GDGCLMEG+SQEA+S AGHL LS
Sbjct: 124 GPLGQGFANSVGFAIAEESLRARFGAKLVDHRTWVFAGDGCLMEGVSQEALSLAGHLKLS 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           +L+V +D+N I+IDGP  LADSTDQ  RF ASGW+   V+GHD  AI + +  A+  D+P
Sbjct: 184 RLVVFFDHNSITIDGPTDLADSTDQTERFAASGWHVQRVDGHDPEAIDAAIEAAKADDRP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           ++IACET I  G   +  T+K HG+    E+++A ++A  W   PF +P DI   W   G
Sbjct: 244 SLIACETHIALGHAAQ-DTSKGHGALTDPEQLQAAKEAYGWTGGPFEVPADIKAMWEQTG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R    RA+WQ RL ++    R++FE   S  +P+   +    LKK+   S P +ATR +
Sbjct: 303 ERGGAARAEWQSRLDALPQGKRQKFEAAMSGEIPNKLVSTVRALKKQMSESAPKMATRAA 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE  LEV+N  + E +GGSADLTGSN T TS +   +  D  GRY++YG+REH MAAAMN
Sbjct: 363 SEKALEVINPVVRETLGGSADLTGSNNTLTSDLGIFTADDRKGRYVYYGIREHGMAAAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G+ PY GTFM FSDY+R A+RL+ L    V++V+THDSIGLGEDGPTHQP+EHL
Sbjct: 423 GMALHGGIRPYGGTFMTFSDYARGAMRLSGLSHAPVVYVMTHDSIGLGEDGPTHQPIEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A LRA P+ +VLRPAD++ET E W+VAL  K+ P+VL+LSRQ LP +R  ++S NL A G
Sbjct: 483 AMLRATPNYVVLRPADAVETAEAWEVALLRKDGPTVLALSRQGLPTVRKDHKSKNLTAQG 542

Query: 550 AYDYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
            Y         Q  + +SGSE+ +A+ A ++L +  I TRVVS+P  ELF  Q +SYR +
Sbjct: 543 GYVLADAEGKRQALLMASGSEVAVALAARDLLQAEGIGTRVVSMPSMELFAAQEESYRKR 602

Query: 609 II-GSSPIKIAIEAGLRQGWDAFI-GSDG-----SFIGMQGFGASGSCDLLYQHFGINAI 661
           ++ G + +++AIEA  RQ WD ++ G  G     +FIGM+GFGAS   D+LY+ FGI A 
Sbjct: 603 VLPGGAAVRVAIEAASRQPWDRWLCGERGREAKAAFIGMEGFGASAPQDVLYKQFGITAE 662

Query: 662 AIVDMVE 668
           A  + V+
Sbjct: 663 ATAEKVK 669


>gi|296283930|ref|ZP_06861928.1| transketolase [Citromicrobium bathyomarinum JL354]
          Length = 656

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/655 (52%), Positives = 453/655 (69%), Gaps = 9/655 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR LSMDA++   SGHPG+PMGMADV T L++  + +D   P+W +RDRFVLSAGH
Sbjct: 4   MANAIRALSMDAVQKAQSGHPGMPMGMADVATVLWSNYLKYDSAAPHWADRDRFVLSAGH 63

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+LL+L GY   T+E+I+NFR +GS TAGHPE     G+E TTGPLGQG+A AVG
Sbjct: 64  GSMLIYSLLHLSGYAHPTMEEIENFRQLGSPTAGHPENFLLPGVECTTGPLGQGLAMAVG 123

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER L  EFGD L+DH T+V+ GDGCLMEGI+ EAI  AGHL LS+L+V WD+N I+
Sbjct: 124 MAMAERHLNAEFGDELVDHRTWVIAGDGCLMEGINHEAIGLAGHLNLSRLVVFWDDNQIT 183

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG   L+ S +  ARF A+GW   S +GHD+  I   + +A  + +P +IAC T+IG G
Sbjct: 184 IDGSTDLSTSENVRARFEATGWFVNSCDGHDYADIARAIDEAMEAGRPALIACRTMIGRG 243

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +PN+ GT   HG+ LG EE+ A R+ LNW   PF IPD + ++WR AG R  + R++W  
Sbjct: 244 APNKQGTAATHGAPLGAEEVAAAREELNWQAAPFEIPDQVRQEWRSAGSRGHEIRSEWGT 303

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           RL +  S  + EF+RR +  LP+ FD +        E +K  +ATRK+SE  L V+N  L
Sbjct: 304 RLDN--SERKAEFQRRMAGDLPEGFDLSEFITGLIREPAK--VATRKASENALAVINSKL 359

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           PE IGGSADLTGSN TKT   +  S  D SGRY++YG+RE  M+AAMNG+ALH G+ PY 
Sbjct: 360 PETIGGSADLTGSNNTKTPGQEIFSADDRSGRYVYYGIREFGMSAAMNGMALHGGVIPYG 419

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           GTF+VFSDY RPAIRL++L   RVI+V+THDSIGLGEDGPTHQPVEHL +LR IP+LLV+
Sbjct: 420 GTFLVFSDYCRPAIRLSALQEARVIYVMTHDSIGLGEDGPTHQPVEHLQSLRVIPNLLVM 479

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-STPNAQ 560
           RP D++ET ECW++AL++K RP+VL+LSRQ L   R +    N  A GAY    +  + +
Sbjct: 480 RPGDAVETAECWEIALQQKKRPTVLALSRQGLAQFRNEEAEENRSARGAYRVKDAEADRR 539

Query: 561 VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI---IGSSPI-K 616
           V + ++GSE+ +A+E  + L +R I   VVS+PC ELF EQS +YR  I   +G   I +
Sbjct: 540 VILIATGSEVGLAMECAKDLEARGIGADVVSMPCAELFDEQSPAYRDNILPNVGPEEILR 599

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           ++IEAG   GW+ +  ++G  IG+  FG S   +  ++ FG  + AI+  V  KL
Sbjct: 600 VSIEAGTTFGWERYTMANGLRIGIDSFGTSAPAEDAFEKFGFTSEAIIRKVVAKL 654


>gi|163742762|ref|ZP_02150147.1| transketolase [Phaeobacter gallaeciensis 2.10]
 gi|161384017|gb|EDQ08401.1| transketolase [Phaeobacter gallaeciensis 2.10]
          Length = 673

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/657 (49%), Positives = 437/657 (66%), Gaps = 9/657 (1%)

Query: 23  ADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHG 82
           A AIR L++DA+   NSGH G+P+GMADV T LF + M FD   P WP+RDRF+LSAGHG
Sbjct: 17  AAAIRALTLDAVAAANSGHSGMPIGMADVATVLFEKHMKFDVANPQWPDRDRFILSAGHG 76

Query: 83  SMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGM 142
           SML Y+LLYL+G   VT++ +KNFR +G+ TAGHPE      +E TTGPLGQGIANAVG 
Sbjct: 77  SMLIYSLLYLMGDAQVTLDQVKNFRQMGALTAGHPENFLIDAVETTTGPLGQGIANAVGF 136

Query: 143 AIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISI 202
           A+AE   R  +G  L+DH+TYV+ GDGCLMEGISQEAI  AG   L KLIV WDNN I+I
Sbjct: 137 AMAEEMQRAHYGRKLVDHHTYVIAGDGCLMEGISQEAIGLAGRHSLGKLIVFWDNNNITI 196

Query: 203 DGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGS 262
           DG + L+D T+Q  RF+ASGW  L ++GHD  AI   +  A+ S KP+MIAC+T I  G 
Sbjct: 197 DGTVELSDRTNQVQRFKASGWQVLEIDGHDPKAIDEAIEAAKKSKKPSMIACKTHIALGH 256

Query: 263 PNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQER 322
             +  T+K HG+    ++++  + A  W   PF +P D+  +W   G R +  R  W+ R
Sbjct: 257 AAQ-DTSKGHGALTDADQMRDAKAAYGWTTGPFEVPADVKSQWEAIGQRGAAEREAWESR 315

Query: 323 LSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLP 382
            +      +  F R ++   P         LKK+   ++P +ATRKSSE+ LEV+N  +P
Sbjct: 316 FAEASQQKQDRFNRAYALDAPKKLSATIKALKKQVSETQPKVATRKSSEMALEVINPIMP 375

Query: 383 ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSG 442
           E +GGSADLTGSN TKT  +      D  GRY+++G+REH MA+AMNG+ALH G+ PY G
Sbjct: 376 ETVGGSADLTGSNNTKTGDLGVFDTDDRKGRYVYWGIREHGMASAMNGMALHGGMRPYGG 435

Query: 443 TFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLR 502
           TF  F+DY+RPA+RLA+LM I  + V+THDSIG+GEDGPTHQPVEHLA  RA P+  V R
Sbjct: 436 TFFCFTDYARPAMRLAALMKIPTVFVMTHDSIGVGEDGPTHQPVEHLAICRATPNTYVFR 495

Query: 503 PADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA-QV 561
           PAD++ET E W++AL  K+ PSV++L+RQNLP +RT+++ +NL A G Y         QV
Sbjct: 496 PADTVETAEAWEIALTSKDTPSVMTLTRQNLPTVRTEHKLSNLTAKGGYVLAEAEGKRQV 555

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
            + ++GSE+ +A++A   L +  I TRVVS+PC ELF EQ ++YR +++ + P+++ IEA
Sbjct: 556 ILIATGSEVSVAMDAKAKLEADGIGTRVVSMPCMELFAEQDEAYRRKVLPAGPVRVGIEA 615

Query: 622 GLRQ-GWDAFI-GSDG-----SFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +R  GWD  + G  G     +F+GM  FGAS     L++ FGI A   V  V++ L
Sbjct: 616 AMRAGGWDRLLMGERGQEKKAAFVGMDRFGASAPAGELFEKFGITADHTVAKVKKLL 672


>gi|56696741|ref|YP_167102.1| transketolase [Ruegeria pomeroyi DSS-3]
 gi|56678478|gb|AAV95144.1| transketolase [Ruegeria pomeroyi DSS-3]
          Length = 673

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/667 (52%), Positives = 455/667 (68%), Gaps = 9/667 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + D+   A AIR L++DAI   NSGH G+PMGMADV T LF + + FD   P W
Sbjct: 4   TALRTANPDHWTKATAIRALTLDAIAAANSGHSGMPMGMADVATVLFEKHLKFDAANPTW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
           P+RDRF+LSAGHGSML Y+LLYL G  ++T++++KNFR +G+KTAGHPE     GIE TT
Sbjct: 64  PDRDRFILSAGHGSMLLYSLLYLTGNPEITLDEVKNFRQMGAKTAGHPENFLAKGIETTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGI+NAVG AIAE   R ++G  ++DHYTYV+ GDGCLMEG+SQEAI  AG L LS
Sbjct: 124 GPLGQGISNAVGFAIAEEIQRAQYGKKVVDHYTYVIAGDGCLMEGVSQEAIGLAGRLELS 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           KL+VLWDNN I+IDG + +AD TDQ  RF ASGW+ + ++GHD  AI + L +A+ S KP
Sbjct: 184 KLVVLWDNNNITIDGTVDIADRTDQVRRFAASGWHVIEIDGHDPAAIDAALTQAKGSKKP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           TMIAC+T I  G   +  T+K HG+   Q ++ A ++   W   PF +P D+   W   G
Sbjct: 244 TMIACKTHIALGHAAQ-DTSKGHGALTDQGQLLAAKEGYGWAHGPFEVPSDVKSAWEAIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R +  RA W+ R + +    + EF R ++   P     A   LKK+    +P  ATRKS
Sbjct: 303 SRGAAERAAWEARFAELSERKQAEFTRAYAFEAPKKLAGAIRALKKQVSEDQPKWATRKS 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE VL+VVN  + E +GGSADLTGSN TKT+ +      +  GRY+H+G+REH MAAAMN
Sbjct: 363 SEEVLKVVNPIMTETVGGSADLTGSNNTKTADLGIFLPENRKGRYIHWGIREHGMAAAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G+ PY GTFM F+DY+RPA+RLA+LM I  + V+THDSIGLGEDGPTHQPVEHL
Sbjct: 423 GMALHGGIRPYGGTFMCFTDYARPAMRLAALMKIPSVFVMTHDSIGLGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  RA P+  V RPAD++ET E W++AL  +N PSVLSL+RQNLP LRT+++  NL A G
Sbjct: 483 AISRATPNTYVFRPADTVETAEAWELALTFQNSPSVLSLTRQNLPTLRTEHKVKNLTAQG 542

Query: 550 AYDYI-STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
            Y    +T   QV + ++GSE++IA++A   L +  I TRVVS+PC ELF EQ ++YR +
Sbjct: 543 GYVLAEATGKRQVILIATGSEVEIAMQARATLEAEGIGTRVVSMPCMELFAEQDEAYRKR 602

Query: 609 IIGSSPIKIAIEAGLRQ-GWDAF-IGSDG-----SFIGMQGFGASGSCDLLYQHFGINAI 661
           ++ + P+++ IEA +R  GWD + +G  G      F+GM GFGAS   + LY+ FGI A 
Sbjct: 603 VLPAGPVRVGIEAAMRAGGWDRWLLGERGREAKAGFVGMTGFGASAPAEELYEKFGITAA 662

Query: 662 AIVDMVE 668
           A V  V+
Sbjct: 663 ATVAKVK 669


>gi|114768955|ref|ZP_01446581.1| transketolase [alpha proteobacterium HTCC2255]
 gi|114549872|gb|EAU52753.1| transketolase [alpha proteobacterium HTCC2255]
          Length = 672

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/649 (50%), Positives = 438/649 (67%), Gaps = 7/649 (1%)

Query: 23  ADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHG 82
           + AIR L+ DA+    SGH G+P+GMADV T LF   + FD + P W +RDRF+LSAGHG
Sbjct: 17  SSAIRILAADAVHAAASGHQGMPIGMADVATVLFQNHLKFDAKNPDWADRDRFILSAGHG 76

Query: 83  SMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGM 142
           SML Y+LL+L GY+D+T+E+IKNFR  G+KTAGHPEYG   GIE TTGPLGQGI+NAVG 
Sbjct: 77  SMLIYSLLHLTGYEDMTMEEIKNFRQWGAKTAGHPEYGHAKGIETTTGPLGQGISNAVGF 136

Query: 143 AIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISI 202
           A+AE+ L+  +G  ++DHYTYV+ GDGCLMEG+SQEAI+ AG   L+KLIV+WD+N ISI
Sbjct: 137 AMAEQSLQSRYGKKIVDHYTYVIAGDGCLMEGVSQEAITLAGKQKLNKLIVMWDDNNISI 196

Query: 203 DGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGS 262
           DG I+++D TDQ  RF ++GW+  ++NGHD H I   L  A+ S KP+MIAC+T I  G 
Sbjct: 197 DGEINISDITDQQKRFESAGWSVFAINGHDPHEIDIALTNAKKSTKPSMIACKTTIAVGV 256

Query: 263 PNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQER 322
                T   HG  +   ++   RK   W    + IP+D+   W   G + S  R +W ER
Sbjct: 257 EGVENTAGGHGYNIKDPQLAQMRKLYEWPYPKYEIPNDVKDAWLEIGSKGSIARNEWNER 316

Query: 323 LSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLP 382
             ++  S + +F R  +   P     A   LKK+   + P +ATRKSS+  LEV+N  + 
Sbjct: 317 FLNLSKSKQADFNRVMNLETPKKLSAAIKRLKKEISENMPKMATRKSSQTALEVINPIMQ 376

Query: 383 ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSG 442
           E IGGSADLTGSN T T  MK     +  GR++ YG+REH MAAAMNG+ LH G+ PY G
Sbjct: 377 ETIGGSADLTGSNNTITKGMKCFDADNRDGRHVAYGIREHGMAAAMNGMVLHGGVRPYGG 436

Query: 443 TFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLR 502
           TFM F+DY+RP++RLA+LM I V++V THDSIGLGEDGPTHQPVEHLA  RA P+  V R
Sbjct: 437 TFMCFTDYARPSMRLAALMKIPVVYVYTHDSIGLGEDGPTHQPVEHLAISRATPNTWVFR 496

Query: 503 PADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-STPNAQV 561
           PAD++ET E W++A+  K  PSVLSL+RQ L  +RT + + N+ ++GAY    +    +V
Sbjct: 497 PADTVETAEAWELAVTTKTTPSVLSLTRQGLRTVRTNHTNKNMVSMGAYVLADAVAKRKV 556

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
            + +SGSE++IA++A   L S  I TRVVS+PC ELF EQ ++YR +++ + P+++ IEA
Sbjct: 557 ILIASGSEVEIALDAKTQLESEGIGTRVVSMPCMELFAEQDETYRRRVLPAGPVRVGIEA 616

Query: 622 GLRQGWDAFIGSD------GSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
            ++QGWD ++  +       +FIGM  FGAS   + LY  FGI A  ++
Sbjct: 617 AVQQGWDKWLTGERGKHNKSAFIGMDSFGASAPAEELYLKFGITAEGVI 665


>gi|254440258|ref|ZP_05053752.1| transketolase [Octadecabacter antarcticus 307]
 gi|198255704|gb|EDY80018.1| transketolase [Octadecabacter antarcticus 307]
          Length = 659

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/658 (50%), Positives = 443/658 (67%), Gaps = 9/658 (1%)

Query: 23  ADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHG 82
           A AIR L++DA+   NSGH G+PMGMADV T LF + + FDP+ P+WP+RDRF+LSAGHG
Sbjct: 3   AAAIRTLTLDAVAAANSGHSGMPMGMADVATVLFDKHLRFDPKAPHWPDRDRFILSAGHG 62

Query: 83  SMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGM 142
           SML YALL+L GY+  T++ +K+FR  GS+TAGHPEYG   GIE TTGPLGQGIAN+VG 
Sbjct: 63  SMLIYALLHLTGYEQATLQQLKDFRQWGSRTAGHPEYGHMDGIETTTGPLGQGIANSVGF 122

Query: 143 AIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISI 202
           AIAE  LR   GD +++H+TYV+ GDGCLMEGISQEAI  AG   L  LI  +DNN I+I
Sbjct: 123 AIAEEILRARHGDSIVNHHTYVIAGDGCLMEGISQEAIGLAGMQKLGHLICFFDNNNITI 182

Query: 203 DGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGS 262
           DG + +AD T+Q ARF ASGW+ + ++GHD  AI + +  A+   +P+MI C+T I  G 
Sbjct: 183 DGTVDMADITNQSARFVASGWHVIDIDGHDPDAIDAAITAAKADPRPSMINCKTHIALGH 242

Query: 263 PNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQER 322
             +  T+K HG+     +++A + A  W   PF +P ++  +W   G R +Q  ADW  R
Sbjct: 243 AAQ-DTSKGHGALTDAGQLQAAKDAYGWTYGPFEVPANVKSQWEAMGERGAQAHADWHTR 301

Query: 323 LSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLP 382
              +  + + EF R  +   P+         KK+   +   +ATR SSE VLEV+N  + 
Sbjct: 302 FEKLSKAKQDEFNRALALDAPNKLPATIKAFKKQASDAGAKMATRSSSEKVLEVINPIMQ 361

Query: 383 ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSG 442
           E +GGSADLTGSN TKTS +   S  + +GRY+H+GVREH MAAAMNG+ LH G+ PYSG
Sbjct: 362 ETVGGSADLTGSNNTKTSDLGVFSPDNRAGRYIHFGVREHGMAAAMNGMVLHGGIRPYSG 421

Query: 443 TFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLR 502
           TFM F+DY+R A+RL++LM I  ++V+THDSIGLGEDGPTHQP+EHLA LRA P+  V R
Sbjct: 422 TFMCFTDYARGAMRLSALMEIPTVYVMTHDSIGLGEDGPTHQPIEHLALLRATPNTNVFR 481

Query: 503 PADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA--Q 560
           PAD++E  E W++A   K  PSVL LSRQ LP +RT++++ N+ A GAY      N   Q
Sbjct: 482 PADTVEVAEAWELAFTSKKTPSVLCLSRQGLPLVRTEHKTKNMTAQGAYVLADAVNGKRQ 541

Query: 561 VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIE 620
             + ++GSE+ +A++A  IL +  I TRVVS+PC+ELF EQ +S R +++   P+++AIE
Sbjct: 542 AILMATGSEVSVAMDARAILEAEGIGTRVVSMPCWELFEEQDESIRKRVLPGGPVRVAIE 601

Query: 621 AGLRQGWDAFI-GSDGS-----FIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           AG+R GWD ++ G  G      F+GM GFGAS    +L++ FGI   A    V   L+
Sbjct: 602 AGIRFGWDRWLFGERGKRDKSGFVGMHGFGASAPAPVLFEKFGITPEATAQKVRDLLA 659


>gi|163736593|ref|ZP_02144012.1| transketolase [Phaeobacter gallaeciensis BS107]
 gi|161390463|gb|EDQ14813.1| transketolase 1 [Phaeobacter gallaeciensis BS107]
          Length = 673

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/670 (48%), Positives = 440/670 (65%), Gaps = 9/670 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + ++   A AIR L++DA+   NSGH G+P+GMADV T LF + M FD   P W
Sbjct: 4   TALRNANPEHWTKAAAIRALTLDAVAAANSGHSGMPIGMADVATVLFEKHMKFDVANPQW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
           P+RDRF+LSAGHGSML Y+LLYL+G   VT++ +KNFR +G+ TAGHPE      +E TT
Sbjct: 64  PDRDRFILSAGHGSMLIYSLLYLMGDAQVTLDQVKNFRQMGALTAGHPENFLIDAVETTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGIANAVG A+AE   R  +G  L+DH+TYV+ GDGCLMEGISQEAI  AG   L 
Sbjct: 124 GPLGQGIANAVGFAMAEEMQRAHYGRKLVDHHTYVIAGDGCLMEGISQEAIGLAGRHSLG 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           KLIV WDNN I+IDG + L+D T+Q  RF+ASGW  + ++GHD  AI   +  A+ S KP
Sbjct: 184 KLIVFWDNNNITIDGTVELSDRTNQVQRFKASGWQVIEIDGHDPKAIDEAIEAAKKSKKP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           +MIAC+T I  G   +  T+K HG+    ++++  + A  W   PF +P D+  +W   G
Sbjct: 244 SMIACKTHIALGHAAQ-DTSKGHGALTDADQMRDAKAAYGWTTGPFEVPADVKSQWEAIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R +  R  W+ R +      +  F R ++   P         LKK+   ++P +ATRKS
Sbjct: 303 QRGAAEREAWESRFAEASQQKQDRFNRAYALDAPKKLSATIKALKKQVSETQPKVATRKS 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE+ LEV+N  +PE +GGSADLTGSN TKT  +      +  GRY+++G+REH MA+AMN
Sbjct: 363 SEMALEVINPIMPETVGGSADLTGSNNTKTGDLGVFDTDNRKGRYVYWGIREHGMASAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G+ PY GTF  F+DY+RPA+RLA+LM I  + V+THDSIG+GEDGPTHQPVEHL
Sbjct: 423 GMALHGGMRPYGGTFFCFTDYARPAMRLAALMKIPTVFVMTHDSIGVGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  RA P+  V RPAD++ET E W++AL  K+ PSV++L+RQNLP +RT+++ +NL A G
Sbjct: 483 AICRATPNTYVFRPADTVETAEAWEIALTSKDTPSVMTLTRQNLPTVRTEHKLSNLTAKG 542

Query: 550 AYDYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
            Y         QV + ++GSE+ +A++A   L +  I TRVVS+PC ELF EQ ++YR +
Sbjct: 543 GYVLAEAEGKRQVILIATGSEVSVAMDAKAKLEADGIGTRVVSMPCMELFAEQDEAYRRK 602

Query: 609 IIGSSPIKIAIEAGLRQ-GWDAFI-GSDG-----SFIGMQGFGASGSCDLLYQHFGINAI 661
           ++ + P+++ IEA +R  GWD  + G  G     +F+GM  FGAS     L++ FGI A 
Sbjct: 603 VLPAGPVRVGIEAAMRAGGWDRLLMGERGQEKKAAFVGMDSFGASAPAGELFEKFGITAD 662

Query: 662 AIVDMVERKL 671
             V  V+  L
Sbjct: 663 HTVAKVKELL 672


>gi|326387801|ref|ZP_08209407.1| transketolase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207847|gb|EGD58658.1| transketolase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 655

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/657 (51%), Positives = 445/657 (67%), Gaps = 18/657 (2%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA AIR L+MDA++  NSGHPG+PMGMADV T L++Q + FDP  P W +RDRFVLSAGH
Sbjct: 11  MAGAIRALAMDAVQAANSGHPGMPMGMADVATVLWSQFLKFDPAAPRWADRDRFVLSAGH 70

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L GY   T++DI+NFR +GS  AGHPE     G+E TTGPLGQG+A AVG
Sbjct: 71  GSMLIYALLHLSGYASPTMDDIRNFRQLGSVCAGHPENFLIPGVECTTGPLGQGLAMAVG 130

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER L   FGD L+DH T+V+ GDGCLMEGI+ EA+  AG LGL +L VLWD+N I+
Sbjct: 131 MAMAERHLNAVFGDDLVDHRTWVIAGDGCLMEGINHEAVGLAGTLGLGRLNVLWDDNRIT 190

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG  SL+ + D  AR+ ASGW+  S +GHD   I   L +A    +P+++AC TVIG G
Sbjct: 191 IDGDTSLSTTEDVAARYAASGWHVASCDGHDFADIARALAEAAADPRPSLVACRTVIGKG 250

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +PN+ G + VHG+ LG +E+ ATR  + W   PF +P +++  WR  G R     A+WQ 
Sbjct: 251 APNKEGGHSVHGAPLGADEVAATRANIGWTAAPFEVPAEVLAAWRATGERGRAAHAEWQA 310

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFD-----NAFINLKKKFEHSKPMIATRKSSELVLEV 376
           R +   + +R EF+RR +  LP   +      A+++  +K       +ATRK+SEL LEV
Sbjct: 311 RTAG--NPLRGEFDRRMAGELPPMGEVEASFAAWLSEPRK-------VATRKASELALEV 361

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +   +PEL GGSADLTGSN TKT          + GR++HYG+RE  MAAAMNG +LH G
Sbjct: 362 LTPAVPELFGGSADLTGSNLTKTKATTPFGAQAYGGRHVHYGIREFGMAAAMNGASLHGG 421

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           + PY GTF+VFSDY R AIR+++L  +R ++VLTHDSIGLGEDGPTHQPVEH+ ++R IP
Sbjct: 422 VIPYGGTFLVFSDYCRNAIRMSALQHVRAVYVLTHDSIGLGEDGPTHQPVEHVMSMRLIP 481

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI-S 555
           +L V RPAD IET ECWQ+AL     PSVL+LSRQNLP LR+  E  NL A G Y  + +
Sbjct: 482 NLQVFRPADIIETAECWQLALATPATPSVLALSRQNLPELRS--EGGNLSAKGGYRLVAA 539

Query: 556 TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPI 615
           T   QV + ++GSE+++AV   + L  + I   V+S+P +ELF  Q  +YRA I+ +  +
Sbjct: 540 TAPRQVVLLATGSEVELAVTCAKALEEKGIGADVISMPSWELFDAQDAAYRADILPAGVL 599

Query: 616 KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           K++IEAG+  GW  ++  DG   G+  FGAS   D+LY HFG+ A  IV  +  +++
Sbjct: 600 KVSIEAGVTTGWQKYV-CDGLMFGIDTFGASAPADVLYDHFGLTAEKIVPQILARIA 655


>gi|87199985|ref|YP_497242.1| transketolase [Novosphingobium aromaticivorans DSM 12444]
 gi|87135666|gb|ABD26408.1| transketolase [Novosphingobium aromaticivorans DSM 12444]
          Length = 655

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/652 (50%), Positives = 446/652 (68%), Gaps = 8/652 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR L+MDA++  NSGHPG+PMGMADV T L+TQ +  DP  P W +RDRF+LSAGH
Sbjct: 11  MANAIRALAMDAVQAANSGHPGMPMGMADVATVLWTQFLKHDPAAPKWSDRDRFILSAGH 70

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L GY+  T++DI+ FR + S  AGHPE     G+E TTGPLGQG+A AVG
Sbjct: 71  GSMLIYALLHLSGYESPTMDDIRKFRQLDSVCAGHPENFLIPGVECTTGPLGQGLAMAVG 130

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
            A+AER L  +FG  L+DH T+V+ GDGCLMEGI+ EA+  AG L L +L VLWD+N I+
Sbjct: 131 FAMAERHLNAQFGSDLVDHKTWVIAGDGCLMEGINHEAVGLAGTLKLGRLNVLWDDNKIT 190

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDG  SL+ S D   R+ ASGW+  S +GHD   I   L +AQ   +P+++AC TVIG G
Sbjct: 191 IDGDTSLSTSEDILGRYAASGWHVTSCDGHDFADIARALAEAQADPRPSLVACRTVIGKG 250

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           +PN+ G + VHG+ LG +EI A R+ L W   PF +P DI+  WR +       RA+W++
Sbjct: 251 APNKQGGHNVHGAPLGADEIAAAREYLGWTAAPFEVPADILANWRSSAEAGKTARAEWEK 310

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
           R ++  ++   E  RR +  LP      F    +    S P +ATRKSSE+ LE     +
Sbjct: 311 RAAANPNA--AELARRMAGELP--AQTGFDAYIQSLIASPPKVATRKSSEMALEAFTANV 366

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
           PE++GGSADLTGSN TKT      +   + GRY++YG+RE  MAAAMNG+ALH G+ PY 
Sbjct: 367 PEMVGGSADLTGSNNTKTKSTAPFTPESYDGRYVYYGIREFGMAAAMNGMALHGGIIPYG 426

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           GTF+VFSDY R A+R+++L  +R I+V THDSIGLGEDGPTHQPVEH+ +LR IP+LLV 
Sbjct: 427 GTFLVFSDYCRNAVRMSALQHVRAIYVFTHDSIGLGEDGPTHQPVEHVMSLRMIPNLLVF 486

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST-PNAQ 560
           RPAD+IET E W +AL  K+RPSVL+L+RQNLP +R  +++    A GAY  ++   + +
Sbjct: 487 RPADAIETAEAWAIALANKDRPSVLALTRQNLPPVR--FDAEMKSAKGAYRLVAAQADRK 544

Query: 561 VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIE 620
           V + ++GSE+++A++    L ++ +   VVSVPC+ELF EQ  +Y+A ++ +  +K+++E
Sbjct: 545 VVLLATGSEVEVAIKVAAELEAKGLGADVVSVPCWELFDEQDAAYKADLLPADALKVSVE 604

Query: 621 AGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           AG+  GW  +IG DG  IG+  FGAS   ++L+ HFG+ A  IV  +  ++S
Sbjct: 605 AGVTLGWQKYIG-DGLAIGIDTFGASAPAEVLFDHFGLTAEKIVPQILARVS 655


>gi|88658548|ref|YP_507282.1| transketolase [Ehrlichia chaffeensis str. Arkansas]
 gi|88600005|gb|ABD45474.1| transketolase [Ehrlichia chaffeensis str. Arkansas]
          Length = 663

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/660 (51%), Positives = 452/660 (68%), Gaps = 8/660 (1%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           +D   MA+AIR LS+DAI+   SGHPG+P+GMADV T LF + + F+P+ P W +RDRFV
Sbjct: 6   NDMVNMANAIRVLSVDAIQKAASGHPGMPLGMADVATVLFAKFLKFNPKDPNWFDRDRFV 65

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GHGSML Y++LY LG  D  IE+IK FR I S T GHPEYG   G++ATTGPLGQG+
Sbjct: 66  LSNGHGSMLLYSILYFLGCLD--IEEIKRFRQIHSLTPGHPEYGYTPGVDATTGPLGQGL 123

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           A AVGMAIAE+ L E+FG  +++H TYV+VGDGCLMEGIS EA S AGHL L+KLIVL+D
Sbjct: 124 ACAVGMAIAEKILSEKFGSEIVNHTTYVMVGDGCLMEGISHEAASLAGHLQLNKLIVLFD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +N ISIDGPISL+ S D  ARF +  W+   ++GHD   I S+++ AQ S+KP++I C+T
Sbjct: 184 DNNISIDGPISLSVSDDVKARFLSYQWDVFEIDGHDFGQIESSIKNAQKSEKPSLICCKT 243

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIG    ++  T   H     +EE+   ++ LNW  +PF IP++I++ W+    RS    
Sbjct: 244 VIGKHLSSKENTCAAHSWPFSEEEVMLMKEKLNWQCNPFNIPEEILQLWKNVSSRSEDEY 303

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
             W +R S+  S    +F     + +PD         KK+        ATR++S  VLEV
Sbjct: 304 NMWLDR-SAKYSKTFDDFVDMMKEGVPDSVFLGLKEFKKELYALNLSEATRRTSGRVLEV 362

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +     +LIGGSADLT SN TK   +  I++S+F+G YLHYG+REHAMA  MNG+ALH G
Sbjct: 363 IAKHTSKLIGGSADLTNSNNTKPQLISIINRSNFNGSYLHYGIREHAMAGCMNGMALHGG 422

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           + PY GTF+VFSDY RPAIRL++LM  +VI+V+THDSIG+GEDGPTHQP+EHL++LR+IP
Sbjct: 423 MIPYGGTFLVFSDYCRPAIRLSALMKKQVIYVMTHDSIGVGEDGPTHQPIEHLSSLRSIP 482

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY---DY 553
           +L V RPAD+IE LECW++ALK  + PSV  LSRQN+  +R+     NL   GAY   +Y
Sbjct: 483 NLYVFRPADAIEVLECWEIALKLTSSPSVFILSRQNVGSVRSVSVDENLSNKGAYVIREY 542

Query: 554 ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSS 613
               +  VTIF++GSE++IA++A +IL S+ + TRVVS+PC+ELF +Q   Y   ++ + 
Sbjct: 543 --EKDLDVTIFATGSEVEIALKASDILKSKGLGTRVVSIPCWELFVQQDKKYIFNLLNNK 600

Query: 614 PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
            IK A+EA    GW  +IG +G F+G++ FG S     LY+HFGI A  +V+ +  KL +
Sbjct: 601 SIKAAVEAASSFGWHRYIGENGIFVGLEDFGISAPYKDLYKHFGITAEGLVNKILDKLKI 660


>gi|83943220|ref|ZP_00955680.1| transketolase [Sulfitobacter sp. EE-36]
 gi|83846228|gb|EAP84105.1| transketolase [Sulfitobacter sp. EE-36]
          Length = 709

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/650 (49%), Positives = 438/650 (67%), Gaps = 8/650 (1%)

Query: 23  ADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHG 82
           A AIR L++DA+   NSGH G+PMGMADV T LF + + FD   P WP+RDRF+LSAGHG
Sbjct: 55  ATAIRALTLDAVAAANSGHSGMPMGMADVATVLFEKHLKFDASNPLWPDRDRFILSAGHG 114

Query: 83  SMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGM 142
           SML Y+LL+L GY+   +E+IKNFR +G++TAGHPE      IE TTGPLGQGIAN+VG 
Sbjct: 115 SMLIYSLLHLTGYEQFPLEEIKNFRQMGARTAGHPENFLADAIETTTGPLGQGIANSVGF 174

Query: 143 AIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISI 202
           A+AE   R ++G  ++DH+TYV+ GDGCLMEGIS EAI+ AG   LSKLIV+WDNN I+I
Sbjct: 175 AMAEEIQRAQYGKKIVDHFTYVIAGDGCLMEGISHEAIALAGRHKLSKLIVMWDNNDITI 234

Query: 203 DGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGS 262
           DGP+SL+D  DQ ARF+A+ W+ + ++GH+   I + L +A+ SD PTMIAC+T I  G 
Sbjct: 235 DGPVSLSDKVDQVARFKAADWHVIEIDGHNPDEIDAALTEARKSDLPTMIACKTHIALGH 294

Query: 263 PNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQER 322
             +  T+K HG+    +++ A + A  W   PF +P D+   W   G R +  R  W+ER
Sbjct: 295 AAQ-DTSKGHGALTDADQMAAAKAAYGWTTGPFEVPADVKSAWEEIGKRGADDRRAWEER 353

Query: 323 LSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLP 382
             +M  + R+EF R  +   P          KK+   + P +ATR SSE  LEV+N    
Sbjct: 354 FDAMSRTKREEFNRALAGDAPKKLSATIKAFKKQTSENAPKLATRASSEKTLEVLNPLYT 413

Query: 383 ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSG 442
           E +GGSADLTGSN TKT+ +      +  GRY+++G+REH MAAAMNG+ALH G+ PY G
Sbjct: 414 ETVGGSADLTGSNNTKTADLGVFDVDNRGGRYVYWGIREHGMAAAMNGMALHGGIRPYGG 473

Query: 443 TFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLR 502
           TFM F+DY+RPA+RLA+LM +  + V+THDSIGLGEDGPTHQPVEHLA  RA P+  V R
Sbjct: 474 TFMCFTDYARPAMRLAALMQVPSVFVMTHDSIGLGEDGPTHQPVEHLAISRATPNTYVFR 533

Query: 503 PADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA-QV 561
           PAD++ET E W++AL  K  PSVLSL+RQ LP +R ++++ NL   GAY         QV
Sbjct: 534 PADTVETAEAWEIALSSKKTPSVLSLTRQGLPTVRLEHKNKNLTEQGAYVLADAEGKRQV 593

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
            + ++GSE++IA++A ++L +  I TRVVS+PC ELF  Q ++YR +++ + P+++ +EA
Sbjct: 594 ILIATGSEVEIALKARDLLQAEGIGTRVVSMPCMELFAAQDEAYRRRVLPAGPVRVGVEA 653

Query: 622 GLRQGWDAFIGSD------GSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
            +RQGWD ++  +        F+GM  FGAS   + L++ F I    + D
Sbjct: 654 AVRQGWDRWLTGERGKWNKADFVGMDRFGASAPAEELFEKFDITPQNVAD 703


>gi|99080954|ref|YP_613108.1| transketolase [Ruegeria sp. TM1040]
 gi|99037234|gb|ABF63846.1| transketolase [Ruegeria sp. TM1040]
          Length = 673

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/670 (48%), Positives = 442/670 (65%), Gaps = 9/670 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + D+   A AIR L++DA+   NSGH G+P+GMADV T LF + M FD   P W
Sbjct: 4   TALRSENPDHWNKAAAIRALTLDAVAGANSGHSGMPIGMADVATVLFEKHMKFDVSAPKW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
            +RDRF+LSAGHGSML Y+LLYL+G   VT+E IKNFR  G+ TAGHPE      +E TT
Sbjct: 64  ADRDRFILSAGHGSMLIYSLLYLMGDAQVTLEQIKNFRQSGALTAGHPENFLLDAVEVTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGI+NAVG A+AE  LR ++G  ++DHYTYV+ GDGCLMEG+SQEAI  AG   L 
Sbjct: 124 GPLGQGISNAVGFAMAEESLRAQYGKKVVDHYTYVIAGDGCLMEGVSQEAIGLAGRHQLG 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           KL+V WDNN I+IDG + L+D T+Q  RF+ASGW+   ++GH+   I + +  A+ + KP
Sbjct: 184 KLVVFWDNNNITIDGTVDLSDRTNQVQRFKASGWHVQEIDGHNPAEIDAAIEAAKKTKKP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           +MIAC+T I  G   +  T+K HG+    +++KA ++A  W    + +P +I  +W   G
Sbjct: 244 SMIACKTHIALGHAAQ-DTSKGHGALTDADQLKAAKEAYGWTGGAYEVPAEIKSQWEAIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R +  RA+W+ R + +    +  F R F+   P         LKK+   +KP +ATRK+
Sbjct: 303 QRGATARAEWEARFAEISKQKQDRFNRAFALEAPKKLSATVKALKKQISETKPKVATRKA 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE+ LEV+N  +PE IGGSADLTGSN TKT  +      +  GRY+++G+REH MAAAMN
Sbjct: 363 SEMALEVINPIMPETIGGSADLTGSNNTKTGDLGVFDTDNRKGRYVYWGIREHGMAAAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G+ PY GTF  F+DY+RPA+RLA+L  I  + V+THDSIG+GEDGPTHQPVEHL
Sbjct: 423 GMALHGGIRPYGGTFFCFTDYARPAMRLAALSKIPTVFVMTHDSIGVGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  RA P+    RPAD++ET E W++AL  K  PSV++L+RQ LP +RT+++  NL   G
Sbjct: 483 AICRATPNTYTFRPADAVETAEAWEIALTAKETPSVIALTRQGLPTVRTEHKLANLTEKG 542

Query: 550 AYDYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           AY      +  QV + +SGSE+ +A+ A +IL  + I TRVVSVPC ELF  Q ++YR +
Sbjct: 543 AYVLAEAESKRQVILMASGSEVSVAMAAKDILEGQGIGTRVVSVPCMELFHAQDEAYRRK 602

Query: 609 IIGSSPIKIAIEAGLRQ-GWDA-FIGSDGS-----FIGMQGFGASGSCDLLYQHFGINAI 661
           ++ + P+++AIEA +R  GWD   +G  G      F+GMQGFGAS     L++ FGI A 
Sbjct: 603 VLPAGPVRVAIEAAVRDGGWDRLLLGERGQEKKAGFVGMQGFGASAPAGELFEKFGITAE 662

Query: 662 AIVDMVERKL 671
             V  V+  L
Sbjct: 663 GTVAKVKELL 672


>gi|85708458|ref|ZP_01039524.1| transketolase [Erythrobacter sp. NAP1]
 gi|85689992|gb|EAQ29995.1| transketolase [Erythrobacter sp. NAP1]
          Length = 665

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/659 (49%), Positives = 445/659 (67%), Gaps = 9/659 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MA+AIR LSMDA++  NSGHPG+PMGMADV T LF + + FDP  P W +RDRFVLSA
Sbjct: 9   QPMANAIRALSMDAVQAANSGHPGMPMGMADVATVLFDRHLKFDPSRPDWADRDRFVLSA 68

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY   T+++I NFR +GS  AGHPE     G+E TTGPLGQG+A A
Sbjct: 69  GHGSMLIYSLLHLSGYARPTMDEIANFRQLGSPCAGHPENFLLEGVECTTGPLGQGLAMA 128

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+AER L  +FGD L+DH T+V+ GDGCLMEGI+ EAI  AGHL L +LIVLWD+N 
Sbjct: 129 VGMAMAERHLNAQFGDELVDHRTWVVAGDGCLMEGINHEAIGLAGHLNLGRLIVLWDDNA 188

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           I+IDG   L+ S +  AR+ A+GW+ +S +GHD   I   + +A+   +P+++AC+T+IG
Sbjct: 189 ITIDGATDLSTSENVKARYEATGWHVVSCDGHDFDDIERAIEEAKADPRPSLVACKTIIG 248

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
            G+PN+ GT+  HG+ LG +E+ A R+ L W+ +PF +P DI+ +WR    R      +W
Sbjct: 249 KGAPNKQGTSATHGAPLGPDEVAAAREVLGWEAEPFNVPQDILVEWRKTAERGRHDHGEW 308

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           + RL+  +S     FE++ +  + +  D A     +         ATRK+SE+ L  + +
Sbjct: 309 ERRLN--ESPHSDAFEKQLA-GVAEGADTAIQQHIRTLAAEPQKAATRKASEMALGPLTE 365

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            LP+LIGGSADLTGSN TKT     +S  D+SGRY++YG+RE  MAAAMNG+ALH G+ P
Sbjct: 366 NLPQLIGGSADLTGSNNTKTPSTLPMSADDYSGRYIYYGIREFGMAAAMNGMALHGGVVP 425

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
           Y GTF++FSDY R AIRL++L   + I+V+THDSIGLGEDGPTHQPVE + +LR IP+L 
Sbjct: 426 YGGTFLIFSDYCRNAIRLSALQKTQAIYVMTHDSIGLGEDGPTHQPVEQVMSLRLIPNLY 485

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYE-----SNNLCALGAYDYI 554
             RP D+IET ECW +ALK +  PSVL+L+RQ LP LR + +      +N CA G Y   
Sbjct: 486 TFRPCDTIETAECWALALKAEETPSVLALTRQGLPQLRGEGDEAWTGESNRCAKGGYRLR 545

Query: 555 S-TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSS 613
           S + + +V I +SGSE+ +A+E  + L    +   VVS+PC ELF  Q D+Y+A ++   
Sbjct: 546 SASADRRVVIVASGSEVALAMECADQLEEAGVGADVVSMPCTELFDAQDDAYKADLLPHD 605

Query: 614 PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
            + ++IEAG   GW+ + G  G  IGM+ FGAS     L+ HFG  A AIV  ++ KL+
Sbjct: 606 TLIVSIEAGSTLGWERYTGRGGLNIGMESFGASAPASDLFAHFGFTADAIVPQIQNKLN 664


>gi|259419181|ref|ZP_05743098.1| transketolase [Silicibacter sp. TrichCH4B]
 gi|259345403|gb|EEW57257.1| transketolase [Silicibacter sp. TrichCH4B]
          Length = 673

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/670 (49%), Positives = 441/670 (65%), Gaps = 9/670 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + D+   A AIR L++DA+   NSGH G+P+GMADV T LF + M FD   P W
Sbjct: 4   TALRSENPDHWNKAAAIRALTLDAVAGANSGHSGMPIGMADVATVLFEKHMKFDITAPKW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
            +RDRF+LSAGHGSML Y+LLYL+G   VT++ IKNFR  G+ TAGHPE      +E TT
Sbjct: 64  ADRDRFILSAGHGSMLIYSLLYLMGDAQVTLDQIKNFRQSGALTAGHPENFLLDAVEVTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGI+NAVG A+AE  LR  +G  ++DHYTYV+ GDGCLMEGISQEAI  AG   L 
Sbjct: 124 GPLGQGISNAVGFAMAEESLRAHYGKKVVDHYTYVIAGDGCLMEGISQEAIGLAGRHQLG 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           KL+V WDNN I+IDG + L+D T+Q  RF+ASGW+   ++GHD   I + +  A+ + KP
Sbjct: 184 KLVVFWDNNNITIDGTVDLSDRTNQVQRFKASGWHVQEIDGHDPAEIDAAIEAAKKTKKP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           +MIAC+T I  G   +  T+K HG+    +++KA + A  W    + +P +I  +W   G
Sbjct: 244 SMIACKTHIALGHAAQ-DTSKGHGALTDADQLKAAKDAYGWTGGAYDVPAEIKSQWEEIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R +  RA+W+ R + + S  +  F R F+   P         LKK+   S+P +ATRK+
Sbjct: 303 KRGAAARAEWEGRFAELSSQKQDRFNRAFALEAPKKLSATIKALKKQISESQPKVATRKA 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE+ LEV+N  +PE IGGSADLTGSN TKT  +      +  GRY+++G+REH MAAAMN
Sbjct: 363 SEMALEVINPIMPETIGGSADLTGSNNTKTGDLGVFDTDNRKGRYVYWGIREHGMAAAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G+ PY GTF  F+DY+RPA+RLA+L  I  + V+THDSIG+GEDGPTHQPVEHL
Sbjct: 423 GMALHGGIRPYGGTFFCFTDYARPAMRLAALSKIPTVFVMTHDSIGVGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  RA P+    RPAD++ET E W++AL  K  PSV++L+RQ LP +RT+++ +NL   G
Sbjct: 483 AICRATPNTYTFRPADAVETAEAWEIALTSKETPSVIALTRQGLPTVRTEHKLSNLTEKG 542

Query: 550 AYDYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           AY      +  QV + +SGSE+  A+ A +IL  + I TRVVSVPC ELF  Q ++YR +
Sbjct: 543 AYVLAEAESKRQVILMASGSEVSTAMAAKDILEGQGIGTRVVSVPCMELFHAQDEAYRRK 602

Query: 609 IIGSSPIKIAIEAGLRQ-GWDA-FIGSDGS-----FIGMQGFGASGSCDLLYQHFGINAI 661
           ++ + P+++AIEA +R  GWD   +G  G      FIGMQGFGAS     L++ FGI A 
Sbjct: 603 VLPAGPVRVAIEAAVRDGGWDRLLLGERGQEKKAGFIGMQGFGASAPAGELFEKFGITAE 662

Query: 662 AIVDMVERKL 671
             V  V+  L
Sbjct: 663 GTVAKVKELL 672


>gi|255261336|ref|ZP_05340678.1| transketolase [Thalassiobium sp. R2A62]
 gi|255103671|gb|EET46345.1| transketolase [Thalassiobium sp. R2A62]
          Length = 672

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/654 (51%), Positives = 445/654 (68%), Gaps = 8/654 (1%)

Query: 12  LMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPN 71
           L K   D+   A AIR L++DA+   NSGH G+P+GMADV T L+   + FDP+ P WP+
Sbjct: 6   LRKAHPDHWMRAAAIRTLTLDAVAAANSGHSGMPIGMADVATVLYQNHLNFDPKNPLWPD 65

Query: 72  RDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGP 131
           RDRF+LSAGHGSML Y+LLYL GY+D+T+E +K+FR  G+ TAGHPEYG   GIE TTGP
Sbjct: 66  RDRFILSAGHGSMLLYSLLYLTGYEDMTLEQVKDFRQWGAITAGHPEYGHATGIETTTGP 125

Query: 132 LGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKL 191
           LGQGIAN+VG AIAE  LR  FG  +I+H+TYV+ GDGCLMEG+SQEAI  AG   L  L
Sbjct: 126 LGQGIANSVGFAIAEEILRARFGKKVINHHTYVMAGDGCLMEGVSQEAIGLAGMHELGNL 185

Query: 192 IVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTM 251
           IV +D+N I+IDG + +AD TDQ ARF+ASGW+   ++GHD   I   +  A+ S KP+M
Sbjct: 186 IVFFDDNNITIDGTVDIADKTDQVARFKASGWHVQEIDGHDPVQIDEAVIAAKKSSKPSM 245

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLR 311
           IAC+T I  G+  +  T+K HG+    + I   R+   W   PF IP DI   W     R
Sbjct: 246 IACKTHIALGTSAQ-DTSKGHGALTDPKLIADAREIYGWPHGPFEIPADIKSAWEGFADR 304

Query: 312 SSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
               R DW+ R +++ ++ + EF R F+   P          KK+   + P +A+R SSE
Sbjct: 305 GIAARKDWEARFATISNNKQAEFNRAFALEAPKKLSATIKAFKKQMSETAPKMASRSSSE 364

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
            VL+ VN  + E +GGSADLTGSN TK+S M     ++  GRY+HYGVREH MA+AMNG+
Sbjct: 365 KVLDAVNPIMQETVGGSADLTGSNNTKSSDMGVFHPTNREGRYIHYGVREHGMASAMNGM 424

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
            LH G+ PY GTFM F+DY+R A+RL++LM +  ++V+THDSIGLGEDGPTHQPVEHLA 
Sbjct: 425 VLHGGIRPYGGTFMCFTDYARGAMRLSALMQVPTVYVMTHDSIGLGEDGPTHQPVEHLAL 484

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LRA P+  V RPAD++ET E W+VAL  K  PSVL+LSRQ LP +RT++++ NL A G Y
Sbjct: 485 LRATPNTNVFRPADTVETAEAWEVALTAKTTPSVLALSRQGLPTVRTEHKTKNLTAQGGY 544

Query: 552 DYI-STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
               +T   QV + +SGSE+++A+ A ++L +  I TRVVS+PC ELF +Q ++YR +++
Sbjct: 545 VLADATSKRQVILIASGSEVEVAMAARDLLEAEGIGTRVVSMPCMELFAQQDEAYRKRVL 604

Query: 611 GSSPIKIAIEAGLRQGWDAF-IGSDG-----SFIGMQGFGASGSCDLLYQHFGI 658
              P+++AIEAG+RQGWD + +G  G     +F+GM  FGAS     L++ FGI
Sbjct: 605 PGGPVRVAIEAGVRQGWDQWLLGERGREAKAAFVGMDSFGASAPAGTLFEKFGI 658


>gi|83954355|ref|ZP_00963075.1| transketolase [Sulfitobacter sp. NAS-14.1]
 gi|83841392|gb|EAP80562.1| transketolase [Sulfitobacter sp. NAS-14.1]
          Length = 694

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/650 (49%), Positives = 437/650 (67%), Gaps = 8/650 (1%)

Query: 23  ADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHG 82
           A AIR L++DA+   NSGH G+PMGMADV T LF + + FD   P WP+RDRF+LSAGHG
Sbjct: 40  ATAIRALTLDAVAAANSGHSGMPMGMADVATVLFEKHLKFDASNPLWPDRDRFILSAGHG 99

Query: 83  SMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGM 142
           SML Y+LL+L GY+   +E+IKNFR +G++TAGHPE      IE TTGPLGQGIAN+VG 
Sbjct: 100 SMLIYSLLHLTGYEQFPLEEIKNFRQMGARTAGHPENFLADAIETTTGPLGQGIANSVGF 159

Query: 143 AIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISI 202
           A+AE   R ++G  ++DH+TYV+ GDGCLMEGIS EAI+ AG   LSKLIV+WDNN I+I
Sbjct: 160 AMAEEIQRAQYGKKIVDHFTYVIAGDGCLMEGISHEAIALAGRHKLSKLIVMWDNNDITI 219

Query: 203 DGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGS 262
           DGP+SL+D  DQ ARF+A+ W+ + ++GH+   I + L +A+ S  PTMIAC+T I  G 
Sbjct: 220 DGPVSLSDKVDQVARFKAADWHVIEIDGHNPDEIDAALTEARKSHLPTMIACKTHIALGH 279

Query: 263 PNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQER 322
             +  T+K HG+    +++ A + A  W   PF +P D+   W   G R +  R  W+ER
Sbjct: 280 AAQ-DTSKGHGALTDADQMAAAKAAYGWTTGPFEVPADVKSAWEEIGKRGADDRRAWEER 338

Query: 323 LSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLP 382
             +M  + R+EF R  +   P          KK+   + P +ATR SSE  LEV+N    
Sbjct: 339 FDAMSRTKREEFNRALAGDAPKKLSATIKAFKKQTSENAPKLATRASSEKTLEVLNPLYS 398

Query: 383 ELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSG 442
           E +GGSADLTGSN TKT+ +      +  GRY+++G+REH MAAAMNG+ALH G+ PY G
Sbjct: 399 ETVGGSADLTGSNNTKTADLGVFDVDNRGGRYVYWGIREHGMAAAMNGMALHGGIRPYGG 458

Query: 443 TFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLR 502
           TFM F+DY+RPA+RLA+LM +  + V+THDSIGLGEDGPTHQPVEHLA  RA P+  V R
Sbjct: 459 TFMCFTDYARPAMRLAALMQVPSVFVMTHDSIGLGEDGPTHQPVEHLAISRATPNTYVFR 518

Query: 503 PADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA-QV 561
           PAD++ET E W++AL  K  PSVLSL+RQ LP +R ++++ NL   GAY         QV
Sbjct: 519 PADTVETAEAWEIALSSKKTPSVLSLTRQGLPTVRLEHKNKNLTEQGAYVLADAEGKRQV 578

Query: 562 TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEA 621
            + ++GSE++IA++A ++L +  I TRVVS+PC ELF  Q ++YR +++ + P+++ +EA
Sbjct: 579 ILIATGSEVEIALKARDLLQAEGIGTRVVSMPCMELFAAQDEAYRRRVLPAGPVRVGVEA 638

Query: 622 GLRQGWDAFIGSD------GSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
            +RQGWD ++  +        F+GM  FGAS   + L++ F I    + D
Sbjct: 639 AVRQGWDRWLTGERGKWNKADFVGMDRFGASAPAEELFEKFDITPQNVAD 688


>gi|56551072|ref|YP_161911.1| transketolase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|260753269|ref|YP_003226162.1| transketolase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|56542646|gb|AAV88800.1| transketolase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258552632|gb|ACV75578.1| transketolase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 663

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/654 (50%), Positives = 441/654 (67%), Gaps = 10/654 (1%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           Y+ +A+AIR LSMDAI+  NSGHPGLPMGMADV T LF + + F+P+ P WP+RDRFVLS
Sbjct: 5   YRHLANAIRALSMDAIQAANSGHPGLPMGMADVATILFGRYLKFNPKDPTWPDRDRFVLS 64

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
            GHG ML Y+LLYL GY + ++EDIKNFR +GS+ AGHPE    +G+EATTGPLGQGI  
Sbjct: 65  GGHGCMLLYSLLYLTGYDEPSLEDIKNFRQLGSRCAGHPENTLLSGVEATTGPLGQGIGM 124

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           A GMA+AER L+ +FG+ +++H  + + GDGCLMEGI+ E +  A  LGL  L VLWD+N
Sbjct: 125 AAGMALAERHLKAQFGEDIVNHRVWTIAGDGCLMEGINHEVVGIAARLGLGNLNVLWDDN 184

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
           GI+IDG ++++   D  AR RA GW+ ++ +GH+  +I   + +A    +P++IAC T I
Sbjct: 185 GITIDGDVTISRKEDVMARHRACGWHVVACDGHNTESIIKAMDEAIADPRPSLIACRTTI 244

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           G+GSP + GT   HG+ LG+EEI  TR+AL W    F +P  I+KKW+  G R       
Sbjct: 245 GYGSPGKQGTAAAHGTPLGEEEILLTREALEWTSPDFTVPHHILKKWKELGTRHLDEYHA 304

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W+ERL + K   + EF R     LP  FD    + K     S   +ATRK+SE+ L V+ 
Sbjct: 305 WKERLEANKD--KDEFLRITKGQLPQDFD--LTDHKNNIISSAMPMATRKASEMALSVLI 360

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             LPEL+GGSADLT SN TK   M  +S +D+ GRY+HYG+RE  MA  MNG+ALH G+ 
Sbjct: 361 RQLPELVGGSADLTPSNNTKPKGMTTLSSADYGGRYIHYGIREFGMATVMNGLALHGGVI 420

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+ FSDYSRPAIRL++L   RV++V+THDSIG+GEDGPTHQP+E + +LR IP+L
Sbjct: 421 PYGGTFLAFSDYSRPAIRLSALQKTRVVYVMTHDSIGVGEDGPTHQPIEQVMSLRLIPNL 480

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIS-TP 557
            V RPADS+ET ECW++ALK  + PS++ LSRQNLP LR +    NL A GAY   S   
Sbjct: 481 RVFRPADSVETAECWELALKNIDGPSLIVLSRQNLPLLR-ESADENLSARGAYRLRSAVA 539

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSP--- 614
             +V + ++GSE+ +AVE  ++L +      VVS+P + LF +Q +SYR  ++   P   
Sbjct: 540 KRRVILMATGSEVSLAVEVADLLETAGFGADVVSMPSWTLFDQQPESYRNDVLPDQPQST 599

Query: 615 -IKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
            ++++IEAG   GW+ + G +G   G+  FGAS   + LY HFG+ A+ I + V
Sbjct: 600 ILRVSIEAGTTIGWERYTGINGLRYGIDVFGASAPANDLYAHFGLTAVGITNKV 653


>gi|103486806|ref|YP_616367.1| transketolase [Sphingopyxis alaskensis RB2256]
 gi|98976883|gb|ABF53034.1| transketolase [Sphingopyxis alaskensis RB2256]
          Length = 660

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/655 (50%), Positives = 445/655 (67%), Gaps = 8/655 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIR L+MDA++  NSGHPG+PMGMADV T L++  + FDP  P W +RDRFVLSA
Sbjct: 11  RQLANAIRALAMDAVQAANSGHPGMPMGMADVATVLYSDYLKFDPTDPKWADRDRFVLSA 70

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YA L+L GY   TIEDI+NFR + S  AGHPE     G+E TTGPLGQG+A A
Sbjct: 71  GHGSMLAYATLHLAGYARPTIEDIRNFRQLHSPCAGHPENFELEGVETTTGPLGQGLATA 130

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAER L   +GD L+DH T+V+ GDGCLMEGI+ EAI  AGHLGL +L VLWD+N 
Sbjct: 131 VGMAIAERHLNALYGDGLVDHRTWVIAGDGCLMEGINHEAIGLAGHLGLGRLTVLWDDNK 190

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           I+IDG   L+ S D  AR+ A+GW+  S +GHD   I   +  A    +P++IAC T+IG
Sbjct: 191 ITIDGSTDLSTSEDVAARYAATGWHVESCDGHDPADIRRAIDAALADPRPSLIACRTIIG 250

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
           FG+PN+ GT+  HG+ LG +EI A R+ L W  +PF IP DI   W   G +  +   +W
Sbjct: 251 FGAPNKQGTSATHGAPLGADEIAAARRELGWTAEPFVIPADIAAAWASFGEKGKKLHNEW 310

Query: 320 QERLSSMKSSIRKEFERRFSDAL-PDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
             RL++  S  + +FE R +  + P     A+++         P +ATRK+SE  L  + 
Sbjct: 311 NSRLAT--SEKKNDFEARLNGKVAPGAAFKAYLD---GLAAEPPKVATRKASENTLSALT 365

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             +  L+GGSADLTGSN TKTS  K ++++D+SGRY++YG+RE  MAAAMNG+ALH G+ 
Sbjct: 366 VDIAALVGGSADLTGSNNTKTSSTKPLTRNDYSGRYIYYGIREFGMAAAMNGMALHGGVV 425

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+VF+DY R AIRL++L   RV++V+THDSIGLGEDGPTHQP+EHL +LRA+P+L
Sbjct: 426 PYGGTFLVFADYCRAAIRLSALQKQRVVYVMTHDSIGLGEDGPTHQPIEHLQSLRAMPNL 485

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN 558
           LV+RPAD++ET ECW +AL ++ RPS+L+L+RQNLP LR    + N CA G Y       
Sbjct: 486 LVMRPADAVETAECWALALAQEGRPSLLALTRQNLPPLRHDV-TENRCAKGGYRLRGASA 544

Query: 559 A-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
           A +V + ++GSE+ +A++  + L +      VVS+   ELF EQ  +Y+A ++    + +
Sbjct: 545 ARKVVLVATGSEVSLAMDVADKLEAAGHGADVVSMVSTELFDEQDAAYQADVLPDDALIV 604

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           +IEAG   GW+ + G DG   G+  FGAS   + L++HFG+ A AI   +  +LS
Sbjct: 605 SIEAGTTFGWERYTGRDGLRFGIDSFGASAPIEDLFRHFGLTADAITPQILARLS 659


>gi|241761355|ref|ZP_04759443.1| transketolase [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241374262|gb|EER63759.1| transketolase [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 663

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/654 (49%), Positives = 441/654 (67%), Gaps = 10/654 (1%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           Y+ +A+AIR LSMDAI+  NSGHPGLPMGMADV T LF + + F+P+ P WP+RDRFVLS
Sbjct: 5   YRHLANAIRALSMDAIQAANSGHPGLPMGMADVATILFGRYLKFNPKDPTWPDRDRFVLS 64

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
            GHG ML Y+LLYL GY + ++EDI+NFR +GS+ AGHPE    +G+EATTGPLGQGI  
Sbjct: 65  GGHGCMLLYSLLYLTGYDEPSLEDIQNFRQLGSRCAGHPENTLLSGVEATTGPLGQGIGM 124

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           A GMA+AER L+ +FG+ +++H  + + GDGCLMEGI+ E +  A  LGL  L VLWD+N
Sbjct: 125 AAGMALAERHLKAQFGEDIVNHRVWTIAGDGCLMEGINHEVVGIAARLGLGNLNVLWDDN 184

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
           GI+IDG ++++   D  AR RA GW+ ++ +GH+  +I   + +A    +P++IAC T I
Sbjct: 185 GITIDGDVTISRKEDVMARHRACGWHVVACDGHNTESIIKAMDEAIADPRPSLIACRTTI 244

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           G+GSP + GT   HG+ LG+EEI  TR+AL W    F +P  I+KKW+  G R       
Sbjct: 245 GYGSPGKQGTAAAHGTPLGEEEILLTREALEWTSPDFTVPHHILKKWKELGTRHLDEYHA 304

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           W+ERL + K   + EF R     LP  FD    + K     S   +ATRK+SE+ L V+ 
Sbjct: 305 WKERLEANKD--KDEFLRITKGQLPQDFD--LTDHKNNIISSAMPMATRKASEMALSVLI 360

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             LPEL+GGSADLT SN TK   M  +S +D+ GRY+HYG+RE  MA  MNG+ALH G+ 
Sbjct: 361 RQLPELVGGSADLTPSNNTKPKGMTTLSSADYGGRYIHYGIREFGMATVMNGLALHGGVI 420

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+ FSDYSRPAIRL++L   RV++V+THDSIG+GEDGPTHQP+E + +LR IP+L
Sbjct: 421 PYGGTFLAFSDYSRPAIRLSALQKTRVVYVMTHDSIGVGEDGPTHQPIEQVMSLRLIPNL 480

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIS-TP 557
            V RPADS+ET ECW++ALK  + PS++ LSRQNLP LR +    NL A GAY   S   
Sbjct: 481 RVFRPADSVETAECWELALKNIDGPSLIVLSRQNLPLLR-ESADENLSARGAYRLRSAVA 539

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSP--- 614
             +V + ++GSE+ +AVE  ++L +      VVS+P + LF +Q +SYR  ++   P   
Sbjct: 540 KRRVILMATGSEVSLAVEVADLLETAGFGADVVSMPSWTLFDQQPESYRNDVLPDQPQST 599

Query: 615 -IKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
            ++++IEAG   GW+ + G +G   G+  FGAS   + LY HFG+ A+ I + V
Sbjct: 600 ILRVSIEAGTTIGWERYTGINGLRYGIDVFGASAPANDLYAHFGLTAVGITNKV 653


>gi|254477462|ref|ZP_05090848.1| transketolase [Ruegeria sp. R11]
 gi|214031705|gb|EEB72540.1| transketolase [Ruegeria sp. R11]
          Length = 673

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/670 (48%), Positives = 444/670 (66%), Gaps = 9/670 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + ++   A AIR L++DA+   NSGH G+P+GMADV T LF + M FD   P W
Sbjct: 4   TALRNANPEHWTKAAAIRALALDAVAAANSGHTGMPIGMADVATVLFEKHMKFDVANPKW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
           P+RDRF+LSAGHGSML Y+LLYL+G   VT+E IKNFR +G+ TAGHPE      +E TT
Sbjct: 64  PDRDRFILSAGHGSMLIYSLLYLMGDAQVTLEQIKNFRQMGALTAGHPENFLIDAVETTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGIANAVG A+AE   R ++G  L+DH+TYV+ GDGCLMEG+SQEAI  AG   L 
Sbjct: 124 GPLGQGIANAVGFAMAEEMQRAQYGRKLVDHHTYVIAGDGCLMEGVSQEAIGLAGRHSLG 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           KLIVLWDNN I+IDG + L+D T+Q  RF+ASGW+   ++GHD  AI + +  A+ + KP
Sbjct: 184 KLIVLWDNNNITIDGTVELSDRTNQVQRFKASGWHVQEIDGHDPKAIDAAIEAAKKTKKP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           +MIAC+T I  G   +  T+K HG+    E++KA + A  W    F +P DI  +W   G
Sbjct: 244 SMIACKTHIALGHAAQ-DTSKGHGALTDAEQLKAAKDAYGWTGGAFEVPADIKAQWEAIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R +  R  W+ R +      +  F R ++   P     A   LKK+    +P +ATRK+
Sbjct: 303 QRGAAEREAWEARFAEASQQKQDRFNRAYALDAPKKLSAAVKALKKQVSEDQPKVATRKA 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE+ L V+N  +PE +GGSADLTGSN TKT  +      +  GRY+++G+REH MA+AMN
Sbjct: 363 SEMALAVINPLMPETVGGSADLTGSNNTKTGDLGIFDIDNRKGRYVYWGIREHGMASAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G+ PY GTF  F+DY+RPA+RLA+LM I  + V+THDSIG+GEDGPTHQPVEHL
Sbjct: 423 GMALHGGIRPYGGTFFCFTDYARPAMRLAALMKIPSVFVMTHDSIGVGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  RA P+  V RPAD++ET E W++AL EK  PSV++L+RQNLP +RT+++ NNL + G
Sbjct: 483 AICRATPNTYVFRPADAVETAEAWEIALTEKETPSVMTLTRQNLPTVRTEHKLNNLTSKG 542

Query: 550 AYDYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           AY         QV + ++GSE+ +A++A   L +  I TRVVS+PC ELF +Q ++YR +
Sbjct: 543 AYVLAEAEGKRQVILIATGSEVSVAMDAKAKLEAEGIGTRVVSMPCMELFAQQDEAYRRK 602

Query: 609 IIGSSPIKIAIEAGLRQ-GWDAF-IGSDG-----SFIGMQGFGASGSCDLLYQHFGINAI 661
           ++ + P+++ IEA +R  GWD + +G  G     +F+GM  FGAS     L++ FGI A 
Sbjct: 603 VLPAGPVRVGIEAAMRAGGWDRWLLGERGQEKKAAFVGMDRFGASAPAGELFEKFGITAD 662

Query: 662 AIVDMVERKL 671
             V  V+  L
Sbjct: 663 NTVAKVKELL 672


>gi|58617305|ref|YP_196504.1| transketolase [Ehrlichia ruminantium str. Gardel]
 gi|58416917|emb|CAI28030.1| Transketolase [Ehrlichia ruminantium str. Gardel]
          Length = 671

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/657 (51%), Positives = 450/657 (68%), Gaps = 12/657 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+A+R LS+DAI+   SGHPG+P+GMADV T LF + + F+P+ P W +RDRFVLS GH
Sbjct: 11  MANAVRVLSIDAIQKAASGHPGMPLGMADVGTMLFAKFLKFNPKDPNWFDRDRFVLSNGH 70

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y++LY LG  D  IE+IK FR I S T GHPEYG   G++ATTGPLGQG+A+AVG
Sbjct: 71  GSMLLYSILYFLGCLD--IEEIKKFRQIHSLTPGHPEYGCTPGVDATTGPLGQGLASAVG 128

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MAIAE+ L E+FG  ++ H TYV+VGDGCLMEGIS EA S AGHL L KLIVL+D+N +S
Sbjct: 129 MAIAEKILSEKFGADIVSHNTYVMVGDGCLMEGISHEAASLAGHLQLDKLIVLFDDNNVS 188

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDGPISL+ S +   RF + GW+   ++GHD   I S+++ A+ S KP++I C+T+IG  
Sbjct: 189 IDGPISLSVSDNVKGRFLSYGWDVDEIDGHDFSQIESSIKNAKNSKKPSLICCKTIIGKT 248

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
            P++  T  +H   + +E+I   +K L W   PF  P++I++ W+     S +    W E
Sbjct: 249 IPSKENTCDIHSWPVTEEDIIVMKKRLGWAYKPFEFPEEILQLWQDIACNSEEEYKLWVE 308

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDN-AFINLKKKFEHSKPMI---ATRKSSELVLEVV 377
           R+S    +      + F D + D   N  F+NLK   E    +    ATRKSS  VL+V+
Sbjct: 309 RVSEYGKT-----SQDFMDVMADGVSNKVFLNLKSLKEELCSLNLNEATRKSSGRVLDVI 363

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
                +LIGGSADL+ SN TK      I+K +FSG YLHYGVREHAMAA MNG+ALHKG+
Sbjct: 364 MGSTGKLIGGSADLSNSNNTKPKFTSVINKDNFSGSYLHYGVREHAMAACMNGMALHKGV 423

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTF++FSDY RPAIRL++LM  +VI+++THDSIG+GEDGPTHQPVEHL +LR IP+
Sbjct: 424 IPYGGTFLIFSDYCRPAIRLSALMKRQVIYIMTHDSIGVGEDGPTHQPVEHLPSLRLIPN 483

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           L V RPAD+IE LECW++ALK  + PSVL LSRQN+  +R+ Y + N+ + GAY      
Sbjct: 484 LYVFRPADAIEVLECWEIALKLIDAPSVLILSRQNVKCVRSTYVAENMSSKGAYIIREYK 543

Query: 558 N-AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
           N   VTIF++GSE++IA++A +IL  + +  RVVSVPC+ELF++Q   Y   ++ +  IK
Sbjct: 544 NDLDVTIFATGSEVEIALKASDILIGKGLGVRVVSVPCWELFYKQDKKYIISLLNNKSIK 603

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
            A+EA    GW  +IG DG F+G++ FG S     LY++FGI    +VD +  KL +
Sbjct: 604 AAVEAASSFGWCKYIGEDGIFVGLEDFGISAPFKDLYKYFGITPENLVDKILSKLRI 660


>gi|218515304|ref|ZP_03512144.1| transketolase [Rhizobium etli 8C-3]
          Length = 505

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/493 (62%), Positives = 385/493 (78%), Gaps = 2/493 (0%)

Query: 167 GDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTL 226
           GDGCLMEGIS EAI+ AGHL L+KLI+ WDNN I+IDG +SL+DSTDQ ARF+A  WNT+
Sbjct: 3   GDGCLMEGISHEAIALAGHLKLNKLILFWDNNSITIDGAVSLSDSTDQIARFKAVHWNTI 62

Query: 227 SVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRK 286
            ++GHD  AI   +  A  SD+PT IAC+TVIGFG+PN+AG++KVHGS LG +EI ATRK
Sbjct: 63  EIDGHDQAAIADAIEAAHKSDRPTFIACKTVIGFGAPNKAGSHKVHGSPLGADEIAATRK 122

Query: 287 ALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCF 346
           ALNWD +PF +P D+++ WR AG RS      W+E LS  KS  R EF RR +  LP+ F
Sbjct: 123 ALNWDYEPFVVPSDVLEAWRAAGTRSDNIVKAWEETLS--KSPARAEFSRRMAGELPEGF 180

Query: 347 DNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAIS 406
           D A  + KKK   +KP IATRK+SE  LE++N  LPE +GGSADLT SN TKTSQM +I+
Sbjct: 181 DAAITDYKKKLAETKPTIATRKASEDALEIINGFLPETLGGSADLTPSNNTKTSQMVSIT 240

Query: 407 KSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVI 466
            +DF GRY+H+G+REH MA+AMNGI+LH GL PY G FM+FSDY RP IRL++LMGIRVI
Sbjct: 241 PTDFKGRYMHWGIREHGMASAMNGISLHGGLIPYGGGFMIFSDYCRPPIRLSALMGIRVI 300

Query: 467 HVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVL 526
           HVLTHDSIG+GEDGPTHQPVE +A LRA+P+L V RPAD++ET ECWQ+A+K K+RPS L
Sbjct: 301 HVLTHDSIGVGEDGPTHQPVEQIAGLRAVPNLQVFRPADAVETAECWQIAIKSKSRPSAL 360

Query: 527 SLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNIS 586
           +L+RQNL  +RT+Y   NLC LGAY      +A+VTIF+SGSE++IAV A   L ++ +S
Sbjct: 361 ALTRQNLTTVRTEYNEKNLCELGAYTLAGNADAKVTIFASGSEVEIAVAARATLEAKGVS 420

Query: 587 TRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGAS 646
            RVVSVPC ELFFEQ D+YR  ++G+SP+KIA+EA +R+GWDAFIG +GSFIGM+GFGAS
Sbjct: 421 VRVVSVPCTELFFEQPDAYRKDVLGNSPVKIAVEAAVREGWDAFIGPEGSFIGMKGFGAS 480

Query: 647 GSCDLLYQHFGIN 659
           G    +Y+HFGI 
Sbjct: 481 GPVKDVYKHFGIT 493


>gi|269958636|ref|YP_003328423.1| transketolase [Anaplasma centrale str. Israel]
 gi|269848465|gb|ACZ49109.1| transketolase [Anaplasma centrale str. Israel]
          Length = 657

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/660 (51%), Positives = 444/660 (67%), Gaps = 12/660 (1%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           D Y+ MA+A+R LS+DAI+N  SGHPG+P+GMADV T LF++ + F   CP W +RDR V
Sbjct: 4   DSYQVMANAVRLLSVDAIQNAASGHPGMPLGMADVATVLFSKFLRFSASCPSWFDRDRLV 63

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GHGSML Y++++L+GY  + I+DIK FR + S T GHPEYG  AG+E TTGPLGQG+
Sbjct: 64  LSNGHGSMLMYSIMHLVGY--IGIDDIKRFRQLHSVTPGHPEYGCTAGVEVTTGPLGQGL 121

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
             AVG AIAER   + FG  LI+H+TY +VGDGCLMEGIS EA S AGHLGL  LIVL+D
Sbjct: 122 GCAVGFAIAERMFSQRFGADLINHHTYAVVGDGCLMEGISHEAASLAGHLGLGNLIVLFD 181

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLS-DKPTMIACE 255
           +NGISIDG  SLA S D  ARF A GW+   VNGHD   I   +R A+ S  +P++I C+
Sbjct: 182 DNGISIDGSTSLATSDDVRARFAAYGWDVWEVNGHDFGEIERAIRAARGSGSRPSIICCK 241

Query: 256 TVIG-FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           TVIG F SP +AGT   H      E+ +  R A+ W  + F IP++    W     R+  
Sbjct: 242 TVIGKFMSP-KAGTAAAHSWPFSPEDAQEFRDAIGWKGERFEIPEEARTLWDAVRARAEL 300

Query: 315 TRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
               W ++ +  +    +      SD +P    +   +LK  F  +    ATRKS   VL
Sbjct: 301 ECELWMKKFAGCEG--YRALNEMLSDGVPSGVIDELDSLKNTFCETCSAEATRKSFGRVL 358

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           E +     +L+GGS+DLT SN TK S M+ ++  +F   Y+HYGVREHAMAA MNG+ALH
Sbjct: 359 EFLATRTHKLVGGSSDLTSSNSTKASSMRVVNSENFDASYVHYGVREHAMAACMNGMALH 418

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            G+ PY GTF+VFSDY RPAIRL++LMG++VI+V+THDSIG+GEDGPTHQPVEHLA+LRA
Sbjct: 419 GGIIPYGGTFLVFSDYCRPAIRLSALMGVQVIYVMTHDSIGVGEDGPTHQPVEHLASLRA 478

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY--- 551
           IP+L V RPAD++E LECW++ALK    PS+ +LSRQN+ F R +Y  +NL + GAY   
Sbjct: 479 IPNLYVFRPADAVEVLECWEIALKLTKSPSLFALSRQNVGFNRARYSRDNLASRGAYVMR 538

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
           +Y    + +VTIF++GSE+ +A+ A EIL    I TRVVS+PC+ +F EQ+  Y A ++G
Sbjct: 539 EY--EGDFKVTIFATGSEVDVALGAREILQDHGIGTRVVSMPCWRIFDEQNAEYIADLLG 596

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +  +K+A+EA    GW  ++G  G FIG+  FGASG C  LY+HFGI    + D +  +L
Sbjct: 597 NGSLKVAVEAACSLGWHKYLGEGGVFIGLDRFGASGKCGDLYRHFGITKENVADTILARL 656


>gi|57239287|ref|YP_180423.1| transketolase [Ehrlichia ruminantium str. Welgevonden]
 gi|58579251|ref|YP_197463.1| transketolase [Ehrlichia ruminantium str. Welgevonden]
 gi|57161366|emb|CAH58289.1| transketolase [Ehrlichia ruminantium str. Welgevonden]
 gi|58417877|emb|CAI27081.1| Transketolase [Ehrlichia ruminantium str. Welgevonden]
          Length = 671

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/657 (51%), Positives = 449/657 (68%), Gaps = 12/657 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+A+R LS+DAI+   SGHPG+P+GMADV T LF + + F+P+ P W +RDRFVLS GH
Sbjct: 11  MANAVRVLSIDAIQKAASGHPGMPLGMADVGTMLFAKFLKFNPKDPNWFDRDRFVLSNGH 70

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y++LY LG  D  IE+IK FR I S T GHPEYG   G++ATTGPLGQG+A+AVG
Sbjct: 71  GSMLLYSILYFLGCLD--IEEIKKFRQIHSLTPGHPEYGCTPGVDATTGPLGQGLASAVG 128

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MAIAE+ L E+FG  ++ H TYV+VGDGCLMEGIS EA S AGHL L KLIVL+D+N +S
Sbjct: 129 MAIAEKILSEKFGADIVSHNTYVMVGDGCLMEGISHEAASLAGHLQLDKLIVLFDDNNVS 188

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDGPISL+ S +   RF + GW+   ++GHD   I S+++ A+ S KP++I C+T+IG  
Sbjct: 189 IDGPISLSVSDNVKGRFLSYGWDVDEIDGHDFSQIESSIKNAKNSKKPSLICCKTIIGKT 248

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
            P++  T  +H   + +E+I   +K L W   PF  P++I++ W+     S +    W E
Sbjct: 249 IPSKENTCDIHSWPVTEEDIIVMKKRLGWAYKPFEFPEEILQLWQDIACNSEEEYKLWVE 308

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDN-AFINLKKKFEHSKPMI---ATRKSSELVLEVV 377
           R+S    +      + F D + D   N  F+NLK   E    +    ATRKSS  VL+V+
Sbjct: 309 RVSEYGKT-----SQDFMDVMADGVSNEVFLNLKSLKEELCSLNLNEATRKSSGRVLDVI 363

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
                +LIGGSADL+ SN TK      I+K +FSG YLHYGVREHAMAA MNG+ALHKG+
Sbjct: 364 MGSTGKLIGGSADLSNSNNTKPKFTSVINKDNFSGSYLHYGVREHAMAACMNGMALHKGV 423

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
            PY GTF++FSDY RPAIRL++LM  +VI+++THDSIG+GEDGPTHQPVEHL +LR IP+
Sbjct: 424 IPYGGTFLIFSDYCRPAIRLSALMKRQVIYIMTHDSIGVGEDGPTHQPVEHLPSLRLIPN 483

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           L V RPAD+IE LECW++ALK  + PSVL LSRQN+  +R+ Y + N+   GAY      
Sbjct: 484 LYVFRPADAIEVLECWEIALKLIDAPSVLILSRQNVKCVRSTYVAENMSNKGAYIIREYK 543

Query: 558 N-AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
           N   VTIF++GSE++IA++A +IL  + +  RVVSVPC+ELF++Q   Y   ++ +  IK
Sbjct: 544 NDLDVTIFATGSEVEIALKASDILIGKGLGVRVVSVPCWELFYKQDKKYIISLLNNKSIK 603

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
            A+EA    GW  +IG DG F+G++ FG S     LY++FGI    +VD +  KL +
Sbjct: 604 AAVEAANSFGWCKYIGEDGIFVGLEDFGISAPFKDLYKYFGITPENLVDKILSKLRI 660


>gi|73667178|ref|YP_303194.1| transketolase [Ehrlichia canis str. Jake]
 gi|72394319|gb|AAZ68596.1| transketolase [Ehrlichia canis str. Jake]
          Length = 661

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/664 (50%), Positives = 447/664 (67%), Gaps = 18/664 (2%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           +D   MA+AIR LS+DAI+N  SGHPG+P+GMADV T LF + + F P+   W NRDRFV
Sbjct: 6   NDMVNMANAIRVLSVDAIQNAASGHPGMPLGMADVATVLFAKFLKFTPKDTSWFNRDRFV 65

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GHGSML Y++LY LG  D  IE+IK FR I S T GHPEYG   G++ATTGPLGQG+
Sbjct: 66  LSNGHGSMLLYSILYFLGCLD--IEEIKRFRQIHSLTPGHPEYGCTPGVDATTGPLGQGL 123

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           A AVGMAIAER L E+FG  L+DH TYV+VGDGCLMEGIS EA S AGHL +SKLIVL+D
Sbjct: 124 ACAVGMAIAERVLSEKFGSELVDHMTYVMVGDGCLMEGISHEAASLAGHLQISKLIVLFD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +NGISIDG  SLA S D  ARF + GW+   ++GHD   I S++  A+ S KP++I C+T
Sbjct: 184 DNGISIDGDTSLAVSDDIKARFLSYGWDVFEIDGHDFDEIESSIENARRSSKPSLICCKT 243

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           +IG G  ++  T+  H     +EE+   ++ L W   PF +P++I++ W+    +S    
Sbjct: 244 IIGKGLVSKENTSAAHSWPFSEEEVILMKEKLGWCDKPFDVPEEILQLWKSIASKSENEY 303

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMI----ATRKSSEL 372
             W  +     S       + F D + +   ++     KK +     +    ATRKSS  
Sbjct: 304 KAWLNKCDDKAS-------QSFVDVIKEGVSDSVFLSLKKLKKELCNLNLNEATRKSSGR 356

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
           +LEVV +   +LIGGSADLTGSN TK      I+K +FSG YLHYG+REHAMAA MNG+A
Sbjct: 357 ILEVVMENTSKLIGGSADLTGSNNTKPQFASIINKDNFSGSYLHYGIREHAMAACMNGMA 416

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ PY GTF+VF+DY RPAIRL++LM   VI+V+THDSIG+GEDGPTHQPVEH+++L
Sbjct: 417 LHGGVIPYGGTFLVFADYCRPAIRLSALMKRHVIYVMTHDSIGVGEDGPTHQPVEHVSSL 476

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY- 551
           RAIP+L V RPAD++E LECW++AL+  + PS   LSRQN+  +R+ Y   NL + GAY 
Sbjct: 477 RAIPNLYVFRPADAVEVLECWEIALRLTSSPSAFILSRQNVGNVRSLYVEENLSSKGAYI 536

Query: 552 --DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
             +Y    +  VTIF++GSE+++A++A +IL  + +  R+VSVPC+ELF +Q   Y   +
Sbjct: 537 IREY--EKDLDVTIFATGSEVEVALKAADILKGKGLDARIVSVPCWELFAQQDKKYIFSL 594

Query: 610 IGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
           + +  IK AIEA    GW  +IG DG F+G+  FG S  C  LY+HFGI A  +V+ +  
Sbjct: 595 LNNKSIKAAIEAASSFGWHKYIGEDGVFVGLDDFGLSAPCKDLYKHFGITAENLVNKILD 654

Query: 670 KLSV 673
           KL +
Sbjct: 655 KLKI 658


>gi|254465095|ref|ZP_05078506.1| transketolase [Rhodobacterales bacterium Y4I]
 gi|206686003|gb|EDZ46485.1| transketolase [Rhodobacterales bacterium Y4I]
          Length = 673

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/670 (48%), Positives = 441/670 (65%), Gaps = 9/670 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + ++   A AIR L++DA+   NSGH G+P+GMADV T LF + + FD   P W
Sbjct: 4   TALRTANPEHWNKAAAIRALALDAVAAANSGHTGMPIGMADVATVLFEKHLKFDASNPSW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
           P+RDRF+LSAGHGSML Y+LLYL+G   VT++ IKNFR +G+ TAGHPE      +E TT
Sbjct: 64  PDRDRFILSAGHGSMLIYSLLYLVGDSQVTLDQIKNFRQMGAITAGHPENFLVDAVEVTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGI+NAVG A+AE   R  +G  ++DHYTYV+ GDGCLMEGISQEAI  AG   L 
Sbjct: 124 GPLGQGISNAVGFAMAEEMQRAHYGKKVVDHYTYVIAGDGCLMEGISQEAIGLAGRHQLG 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           KLIV WDNN I+IDG + L+D T+Q  RF+ASGW  L ++GHD  AI   +  A+ S KP
Sbjct: 184 KLIVFWDNNNITIDGTVDLSDRTNQVQRFKASGWQVLEIDGHDPKAIDEAIEAAKKSKKP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           +MIAC+T I  G   +  T+K HG+   +++++A + A  W    F +P +I  +W   G
Sbjct: 244 SMIACKTHIALGHAAQ-DTSKGHGALTDKDQLQAAKDAYGWTGGAFEVPAEIKSQWEEIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R    R  W+ R + +    +  F R ++   P         LKK+   ++P +ATRKS
Sbjct: 303 ARGKSEREAWEARFAELSQQKQDRFNRAYALDAPKKLSATIKALKKQVSETQPSVATRKS 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE+VLEV+N  +PE +GGSADLTGSN TKT  +      +  GRY+++G+REH MAAAMN
Sbjct: 363 SEMVLEVINPIMPETVGGSADLTGSNNTKTGDLGVFDTDNRKGRYVYWGIREHGMAAAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G+ PY GTF  F+DY+RPA+RLA+L  I  + V+THDSIG+GEDGPTHQPVEHL
Sbjct: 423 GMALHGGMRPYGGTFFCFTDYARPAMRLAALSKIPTVFVMTHDSIGVGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  RA P+  V RPAD++ET E W++AL  K  PSVL+L+RQNLP +RT+++ +N+   G
Sbjct: 483 AICRATPNTYVFRPADTVETAEAWEIALTAKETPSVLALTRQNLPTVRTEHKLSNMVEKG 542

Query: 550 AYDYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           AY      N  QV + ++GSE+ +A+EA   L +  I TRVVS+PC ELF +Q ++YR +
Sbjct: 543 AYVLAEAENKRQVILIATGSEVSVAMEAKAKLEAEGIGTRVVSMPCMELFAQQDEAYRRK 602

Query: 609 IIGSSPIKIAIEAGLRQ-GWDAF-IGSDGS-----FIGMQGFGASGSCDLLYQHFGINAI 661
           ++ + P+++ IEA +R  GWD + +G  G      F+GM  FGAS     L++ FGI A 
Sbjct: 603 VLPAGPVRVGIEAAVRAGGWDRWLLGERGQEKKAGFVGMDRFGASAPAGELFEKFGITAE 662

Query: 662 AIVDMVERKL 671
             V  V+  L
Sbjct: 663 GTVAKVKELL 672


>gi|262277501|ref|ZP_06055294.1| transketolase [alpha proteobacterium HIMB114]
 gi|262224604|gb|EEY75063.1| transketolase [alpha proteobacterium HIMB114]
          Length = 647

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/648 (52%), Positives = 448/648 (69%), Gaps = 14/648 (2%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +  +A+AIRFLS+DA++  NSGHPG+PMGMADV T LF   + F+P+ P W NRDRF+LS
Sbjct: 6   HNDLANAIRFLSVDAVQKANSGHPGMPMGMADVCTVLFRDFLKFNPENPNWENRDRFILS 65

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
           AGHGSML Y+LLYL GY+ +TIEDIKNFR + S  AGHPEY    GIE TTGPLGQGI N
Sbjct: 66  AGHGSMLLYSLLYLTGYKSITIEDIKNFRQLNSICAGHPEYEHGTGIETTTGPLGQGIGN 125

Query: 139 AVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           AVG A+AE+ L+ +FG  + +H TYVL GDGCLMEGIS EA+S AGHL L  LI+L+DNN
Sbjct: 126 AVGFALAEQILQAKFGKKIFNHKTYVLAGDGCLMEGISHEAMSLAGHLKLKNLIMLFDNN 185

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
            ISIDGP +LA S     RF +  W+ + +NGH    I   L+KAQ + KPT+I+C+T I
Sbjct: 186 SISIDGPTNLAVSDKYKKRFESYNWDFIEINGHKEKEIFKALKKAQKAKKPTVISCKTKI 245

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSPN+AG +  HGS +G +EIK  RK L W  DPF +P+ I+K WR  G +       
Sbjct: 246 GFGSPNKAGKSSAHGSPMGDDEIKLIRKKLKWSYDPFEVPEHILKAWREIGKKGKAEEK- 304

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
                     SI+  F+            N       K    KP+ ATRKSSE +L+ + 
Sbjct: 305 ---------KSIKLSFKEETIKKKIKSIINHSKETAAK--ELKPL-ATRKSSENILKNIT 352

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             LP LIGGSADLTGSN TKT   K IS   F G Y+HYGVREHAMA+ MNG+ALH  L 
Sbjct: 353 KDLPLLIGGSADLTGSNNTKTEYQKIISPGKFKGNYIHYGVREHAMASVMNGLALHSHLI 412

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           PY GTF+VFSDY +P+IRL++LM  RVI+V++HDSIGLGEDGPTHQP+EHL++LR+IP+L
Sbjct: 413 PYGGTFLVFSDYCKPSIRLSALMKQRVIYVMSHDSIGLGEDGPTHQPIEHLSSLRSIPNL 472

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD-YISTP 557
            VLRP D+ ET+ECW +AL  K++P+V+SL+RQNL   R Q ++ NLC LGAY+ + S+ 
Sbjct: 473 NVLRPCDTTETIECWDIALNSKDKPTVISLTRQNLSQPRDQMKNENLCELGAYEIFRSSD 532

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
           N  +T+ +SGSE+ IA+ A + L+ +N++++V+S P  ELF  QS+ Y++QI+  + +KI
Sbjct: 533 NIDLTLMASGSEVAIAISASKKLAQKNLNSKVISFPSMELFDAQSEQYKSQILEETKLKI 592

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
           +IEA     W  ++G+DG  +G++ FG S     +Y++F +    IV+
Sbjct: 593 SIEASHPMSWKKYVGNDGVTLGIEDFGRSAPYKDIYKYFKLTDDDIVN 640


>gi|222475316|ref|YP_002563733.1| transketolase (TktA) [Anaplasma marginale str. Florida]
 gi|222419454|gb|ACM49477.1| transketolase (TktA) [Anaplasma marginale str. Florida]
          Length = 661

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/657 (50%), Positives = 442/657 (67%), Gaps = 6/657 (0%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + Y+ MA A+R LS+DAI+N  SGHPG+P+GMADV T LF++ + F    P W +RDR V
Sbjct: 5   ESYQIMAKAVRLLSVDAIQNAASGHPGMPLGMADVATVLFSKFLRFSVNHPSWFDRDRLV 64

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GHGSML Y++++L+GY  + I+DIK FR + S T GHPEYG   G+E TTGPLGQG+
Sbjct: 65  LSNGHGSMLMYSIMHLVGY--IGIDDIKRFRQLHSITPGHPEYGCTTGVEVTTGPLGQGL 122

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
             AVG+AIAER   ++FGD LI+H+TY +VGDGCLMEGIS EA S AGHLGL  LIVL+D
Sbjct: 123 GCAVGLAIAERMFSQKFGDDLINHHTYAIVGDGCLMEGISHEAASLAGHLGLDHLIVLFD 182

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLS-DKPTMIACE 255
           +NGISIDG  SLA S D  ARF A GW+ L V+GHD   I   +  A+ S  KP++I C+
Sbjct: 183 DNGISIDGSTSLATSDDVRARFSAYGWDVLEVDGHDFGEIEQAIGAARESRGKPSIICCK 242

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIG   P +AGT+  H      E+ +  R A+ W+ + F IP++    WR    R+   
Sbjct: 243 TVIGKFMPPKAGTSAAHSWPFSPEDAQEFRNAIGWEGEKFEIPEEAKALWRKVRARAELE 302

Query: 316 RADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLE 375
              W ++ +    +  +      SD +P+   +    LK     ++P  ATRKS   VLE
Sbjct: 303 CELWMKKFAGCAKA--EVLNAILSDGVPNSVIDELDTLKNTLCETRPAEATRKSFGRVLE 360

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
            +   + +L+GGS+DLT SN TK   M  +S  +F   Y+HYGVREHAMAA MNG+ALH 
Sbjct: 361 FLAMRVNKLVGGSSDLTSSNNTKVPCMGVVSSKNFDASYVHYGVREHAMAACMNGMALHG 420

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
           G+ PY GTF+VFSDY RPAIRL++LM ++VI+V+THDSIG+GEDGPTHQPVEHLA+LR+I
Sbjct: 421 GIIPYGGTFLVFSDYCRPAIRLSALMRVQVIYVMTHDSIGVGEDGPTHQPVEHLASLRSI 480

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIS 555
           P+L V RPAD++E LECW++ALK    PS+ +LSRQ++ F R  Y  NNL + GAY    
Sbjct: 481 PNLYVFRPADAVEVLECWEMALKLTKSPSLFALSRQSVGFSRACYSHNNLASRGAYIIRE 540

Query: 556 TP-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSP 614
              + +VTIFS+GSE+ +A+ A EIL  + I TRVVS+PC+ +F EQ + Y A ++G+  
Sbjct: 541 HEGDFRVTIFSTGSEVGVALGAREILQDQGIGTRVVSMPCWRIFDEQDEEYIASLLGNGS 600

Query: 615 IKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +K+A+EA    GW  +IG  G F+G+  FGASG C+ LY+HFGI    +   +  KL
Sbjct: 601 LKVAVEAACSLGWHKYIGEKGVFMGLDRFGASGKCEDLYRHFGITKENVAGTILAKL 657


>gi|255004424|ref|ZP_05279225.1| transketolase (TktA) [Anaplasma marginale str. Virginia]
          Length = 660

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/657 (50%), Positives = 442/657 (67%), Gaps = 6/657 (0%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + Y+ MA A+R LS+DAI+N  SGHPG+P+GMADV T LF++ + F    P W +RDR V
Sbjct: 4   ESYQIMAKAVRLLSVDAIQNAASGHPGMPLGMADVATVLFSKFLRFSVNHPSWFDRDRLV 63

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GHGSML Y++++L+GY  + I+DIK FR + S T GHPEYG   G+E TTGPLGQG+
Sbjct: 64  LSNGHGSMLMYSIMHLVGY--IGIDDIKRFRQLHSITPGHPEYGCTTGVEVTTGPLGQGL 121

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
             AVG+AIAER   ++FGD LI+H+TY +VGDGCLMEGIS EA S AGHLGL  LIVL+D
Sbjct: 122 GCAVGLAIAERMFSQKFGDDLINHHTYAIVGDGCLMEGISHEAASLAGHLGLDHLIVLFD 181

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLS-DKPTMIACE 255
           +NGISIDG  SLA S D  ARF A GW+ L V+GHD   I   +  A+ S  KP++I C+
Sbjct: 182 DNGISIDGSTSLATSDDVRARFSAYGWDVLEVDGHDFGEIEQAIGAARESRGKPSIICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIG   P +AGT+  H      E+ +  R A+ W+ + F IP++    WR    R+   
Sbjct: 242 TVIGKFMPPKAGTSAAHSWPFSPEDAQEFRNAIGWEGEKFEIPEEAKALWRKVRARAELE 301

Query: 316 RADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLE 375
              W ++ +    +  +      SD +P+   +    LK     ++P  ATRKS   VLE
Sbjct: 302 CELWMKKFAGCAKA--EVLNAILSDGVPNSVIDELDTLKNTLCETRPAEATRKSFGRVLE 359

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
            +   + +L+GGS+DLT SN TK   M  +S  +F   Y+HYGVREHAMAA MNG+ALH 
Sbjct: 360 FLAMRVNKLVGGSSDLTSSNNTKVPCMGVVSSKNFDASYVHYGVREHAMAACMNGMALHG 419

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
           G+ PY GTF+VFSDY RPAIRL++LM ++VI+V+THDSIG+GEDGPTHQPVEHLA+LR+I
Sbjct: 420 GIIPYGGTFLVFSDYCRPAIRLSALMRVQVIYVMTHDSIGVGEDGPTHQPVEHLASLRSI 479

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIS 555
           P+L V RPAD++E LECW++ALK    PS+ +LSRQ++ F R  Y  NNL + GAY    
Sbjct: 480 PNLYVFRPADAVEVLECWEMALKLTKSPSLFALSRQSVGFSRACYSHNNLASRGAYIIRE 539

Query: 556 TP-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSP 614
              + +VTIFS+GSE+ +A+ A EIL  + I TRVVS+PC+ +F EQ + Y A ++G+  
Sbjct: 540 HEGDFRVTIFSTGSEVGVALGAREILQDQGIGTRVVSMPCWRIFDEQDEEYIASLLGNGS 599

Query: 615 IKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +K+A+EA    GW  +IG  G F+G+  FGASG C+ LY+HFGI    +   +  KL
Sbjct: 600 LKVAVEAACSLGWHKYIGEKGVFMGLDRFGASGKCEDLYRHFGITKENVAGTILAKL 656


>gi|254455405|ref|ZP_05068834.1| transketolase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082407|gb|EDZ59833.1| transketolase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 654

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/653 (50%), Positives = 438/653 (67%), Gaps = 9/653 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           +A+ IRFLS+DA++  NSGHPG+PMGMADV T LF   + F+P+ P W NRDRFVLSAGH
Sbjct: 8   LANCIRFLSIDAVQKANSGHPGMPMGMADVATVLFKNFLRFNPKNPNWLNRDRFVLSAGH 67

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+LLYL GY+ VT+  IK FR + S  AGHPEY    GIE TTGPLGQGIANAVG
Sbjct: 68  GSMLLYSLLYLTGYKSVTLNSIKKFRKLNSICAGHPEYHPNTGIETTTGPLGQGIANAVG 127

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
            +IAE  L+ + G  +IDH TYVL GDGCLMEGIS EA+S AGHL L  L++L+DNN IS
Sbjct: 128 FSIAEEILKRKLGKEIIDHKTYVLAGDGCLMEGISHEAMSLAGHLKLKNLVMLFDNNSIS 187

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
           IDGP SLA S +   RF + GW+ + ++GH+   I   L+K Q + KPT+I+C+T IG+G
Sbjct: 188 IDGPTSLAVSDNFKKRFESYGWDYILIDGHNEKQIFKALKKVQKAKKPTIISCKTKIGYG 247

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
           SPN++G +  HGS LG +EIK  R ALNW+  PF IP+ ++ +W+  G +  +   +W +
Sbjct: 248 SPNKSGKSSSHGSPLGLDEIKLVRNALNWNYKPFEIPNKVLNEWKKIGKKGQKLENNWNK 307

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCL 381
                K  I K  +  FS+ L     +A   L          +ATRKSSEL L  +    
Sbjct: 308 IYKKKKVLINKLLKNNFSNILKSEKLSAINELSS--------LATRKSSELTLNKLTSVK 359

Query: 382 PELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYS 441
             LIGGSADL GSN TKT   K I   DF+  Y+HYGVREHAM   MNG+ALH    PY 
Sbjct: 360 NNLIGGSADLAGSNNTKTKYHKIIKPGDFNSDYIHYGVREHAMCGIMNGLALHSNFIPYG 419

Query: 442 GTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVL 501
           GTF++FSDY +P+IRL++LM  RVI+V+THDSIGLGEDGPTHQP+E L+ LR+IP+L V 
Sbjct: 420 GTFLIFSDYCKPSIRLSALMEQRVIYVMTHDSIGLGEDGPTHQPIEQLSGLRSIPNLNVF 479

Query: 502 RPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST-PNAQ 560
           RPAD +ET+ECW+ AL     PS+LSL+RQNL  +R +Y   N C+ GAY+ + T     
Sbjct: 480 RPADRMETIECWEHALNTPKTPSILSLTRQNLDPIRKKYSKTNKCSFGAYEVLRTNKKIH 539

Query: 561 VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIE 620
           +TI +SGSE+ +A+E    L+   I ++V+S+PC +LF  QS+SY+ +II  + +KI+IE
Sbjct: 540 LTILASGSEVNLAIETSHKLAKEKIYSKVISMPCQDLFDLQSNSYKQKIINETKMKISIE 599

Query: 621 AGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
           A     W  +IG++G   G+  FG S     +Y+HFG+ A  I +  ++ L +
Sbjct: 600 AASTDSWKKYIGNNGLAFGIDTFGKSAPYKEIYKHFGLTATNIANKSKKILRI 652


>gi|114762331|ref|ZP_01441789.1| transketolase [Pelagibaca bermudensis HTCC2601]
 gi|114544949|gb|EAU47953.1| transketolase [Roseovarius sp. HTCC2601]
          Length = 668

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/653 (51%), Positives = 449/653 (68%), Gaps = 7/653 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           +A+ +R L++DA+   NSGHPG PMGMAD  T LF   + FD   P WP+RDRFVLS GH
Sbjct: 20  LANCLRALAIDAVNAANSGHPGAPMGMADAATVLFRNHLKFDASAPDWPDRDRFVLSNGH 79

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
            SML Y LL+L GY D+T+E I+NFR  G+ TAGHPE+G   GIE TTGPLGQGIA AVG
Sbjct: 80  ASMLLYGLLHLTGYADMTLEQIRNFRQWGAITAGHPEWGHAKGIETTTGPLGQGIATAVG 139

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MA+AER++ +EF   L+DH T+V++GDGCL EGI QEAIS AGHLGL KL VL+D+N I+
Sbjct: 140 MALAERRMADEFPG-LVDHRTWVMLGDGCLQEGIGQEAISLAGHLGLGKLNVLYDDNDIT 198

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDKPTMIACETVIGF 260
           IDGP S++ S D   R  A GW+ +  +GHD  A+ + + +A+  + +P++IA +TVIGF
Sbjct: 199 IDGPTSVSFSEDVPKRLEACGWHVIRCDGHDADALDAAMGQAKAETTRPSLIAMKTVIGF 258

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
           G+PNRAGT K HG+ LG +E    ++AL WD  PF IP D+ K+WR  G R S  RA W+
Sbjct: 259 GAPNRAGTAKAHGAPLGADEGALAKQALGWDAAPFEIPADLAKEWRAIGARGSDARAAWE 318

Query: 321 ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
           + L++  S     F +R +  LP  +D+A    +         IATRK+S++ LE + + 
Sbjct: 319 DALAA--SDQAPAFRQRIAGDLPKGYDSAVAQARAALFAEPQAIATRKASQVALESLTEA 376

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
           +P +IGGSADLTGSN T+   + ++   + SGRY+ YGVRE  MAAAMNG+ALH G  PY
Sbjct: 377 VPAMIGGSADLTGSNLTRVPAVDSLFSPESSGRYIGYGVREFGMAAAMNGLALHGGFKPY 436

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
            GTF+VFSDY+R AIRL++LMG+ V +V+THDSIGLGEDGPTHQPVEHLA+LRAIP+L V
Sbjct: 437 GGTFLVFSDYARNAIRLSALMGLGVTYVMTHDSIGLGEDGPTHQPVEHLASLRAIPNLNV 496

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQ 560
            RPAD++ETLE W +AL+    PS+L+LSRQ +P LR +    NL A G Y        +
Sbjct: 497 FRPADAVETLEAWDIALRSPATPSLLALSRQGVPQLR-EAGDENLTARGGYVIRQFGEGR 555

Query: 561 -VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAI 619
            VT+ ++G+E+ +AVEA E L +   +  VVS+PC+ELF  Q ++YR +++G +P +IA+
Sbjct: 556 DVTLLATGTEVALAVEAAEALHAEGHAVAVVSMPCWELFDAQPEAYRDEVLGLAP-RIAV 614

Query: 620 EAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           EA L  GW  ++  +   +GM GFGAS   + LY  FGI   AIV   +  L+
Sbjct: 615 EAALPFGWTRYVAREADVVGMPGFGASAPAERLYAEFGITCDAIVARAKAHLA 667


>gi|254460823|ref|ZP_05074239.1| transketolase [Rhodobacterales bacterium HTCC2083]
 gi|206677412|gb|EDZ41899.1| transketolase [Rhodobacteraceae bacterium HTCC2083]
          Length = 674

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/671 (49%), Positives = 438/671 (65%), Gaps = 8/671 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + D+   + AIR L++DAI   NSGH G+PMGMADV T LF + M FD   P W
Sbjct: 4   AALRSANPDHWSKSAAIRALTLDAIHAANSGHSGMPMGMADVATVLFEKHMKFDASAPLW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
            +RDRF+LSAGHGSML Y+LLYL+G   +T++ +KNFR  G+ TAGHPE      IE TT
Sbjct: 64  ADRDRFILSAGHGSMLLYSLLYLVGDAQITLDQVKNFRQKGALTAGHPENFLADAIETTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGIAN+VG A+AE   R  FG  ++DH TYV+ GDGCLMEG+SQEAI  AG   L 
Sbjct: 124 GPLGQGIANSVGFAMAEEIQRARFGKKVVDHNTYVIAGDGCLMEGVSQEAIGIAGRHELG 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           KLIVLWDNN I+IDG + L+D TDQ  RF ASGW+   ++GH+   I + +  A+ S KP
Sbjct: 184 KLIVLWDNNNITIDGTVELSDRTDQVMRFNASGWHVQEIDGHNPEEIDAAITAAKKSKKP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           +MIAC+T I  G   +  T+K HG+     ++   +    W   PF +P+DI   W   G
Sbjct: 244 SMIACKTHIALGHAAQ-DTSKGHGALTDDTQMADAKALYGWTSGPFEVPNDIKSAWEAIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R +   A W+ER +S+ ++ + EF R +    P          KK+   S P +ATRKS
Sbjct: 303 ARGTSEHAAWKERFASIPNNKQAEFTRAYDLEAPKKLAATIKAFKKQITESAPKVATRKS 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE+ L+V+N  + E +GGSADLTGSN TKT  M      +  GRY+++G+REH M++AMN
Sbjct: 363 SEMTLQVINPIMQETVGGSADLTGSNNTKTGDMGVFDTDNREGRYVYWGIREHGMSSAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G+ PY GTFM F+DY+RPA+RLA+L  I  + V+THDSIGLGEDGPTHQPVEHL
Sbjct: 423 GMALHGGIRPYGGTFMCFTDYARPAMRLAALSKIPTVFVMTHDSIGLGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  R+ P+  V RPAD++ET E W+VAL  K  PSVL+LSRQNLP +R ++++ NL A G
Sbjct: 483 AISRSTPNTYVFRPADTVETAESWEVALTSKTTPSVLALSRQNLPTVRLEHKTKNLSAQG 542

Query: 550 AYDYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
            Y      +  Q  I +SGSE++IA+ A ++L +  I TRVVS+PC ELF EQ  SYR +
Sbjct: 543 GYVLADADDKRQAIIMASGSEVEIALAARDLLQADGIGTRVVSMPCMELFAEQDASYRKR 602

Query: 609 IIGSSPIKIAIEAGLRQGWDAF-IGSDG-----SFIGMQGFGASGSCDLLYQHFGINAIA 662
           ++   P+++A+EAG+R GWD + +G  G      F+GM  FGAS     LY+HF I A+A
Sbjct: 603 VLPGGPVRVAVEAGVRMGWDQWLLGERGREAKADFVGMDSFGASAPAGELYEHFDITAVA 662

Query: 663 IVDMVERKLSV 673
               V+  L +
Sbjct: 663 TAAKVKSLLGL 673


>gi|255003299|ref|ZP_05278263.1| transketolase (TktA) [Anaplasma marginale str. Puerto Rico]
          Length = 652

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/652 (50%), Positives = 439/652 (67%), Gaps = 6/652 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA A+R LS+DAI+N  SGHPG+P+GMADV T LF++ + F    P W +RDR VLS GH
Sbjct: 1   MAKAVRLLSVDAIQNAASGHPGMPLGMADVATVLFSKFLRFSVNHPSWFDRDRLVLSNGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y++++L+GY  + I+DIK FR + S T GHPEYG   G+E TTGPLGQG+  AVG
Sbjct: 61  GSMLMYSIMHLVGY--IGIDDIKRFRQLHSITPGHPEYGCTTGVEVTTGPLGQGLGCAVG 118

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           +AIAER   ++FGD LI+H+TY +VGDGCLMEGIS EA S AGHLGL  LIVL+D+NGIS
Sbjct: 119 LAIAERMFSQKFGDDLINHHTYAIVGDGCLMEGISHEAASLAGHLGLDHLIVLFDDNGIS 178

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLS-DKPTMIACETVIGF 260
           IDG  SLA S D  ARF A GW+ L V+GHD   I   +  A+ S  KP++I C+TVIG 
Sbjct: 179 IDGSTSLATSDDVRARFSAYGWDVLEVDGHDFGEIEQAIGAARESRGKPSIICCKTVIGK 238

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQ 320
             P +AGT+  H      E+ +  R A+ W+ + F IP++    WR    R+      W 
Sbjct: 239 FMPPKAGTSAAHSWPFSPEDAQEFRNAIGWEGEKFEIPEEAKALWRKVRARAELECELWM 298

Query: 321 ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDC 380
           ++ +    +  +      SD +P+   +    LK     ++P  ATRKS   VLE +   
Sbjct: 299 KKFAGCAKA--EVLNAILSDGVPNSVIDELDTLKNTLCETRPAEATRKSFGRVLEFLAMR 356

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
           + +L+GGS+DLT SN TK   M  +S  +F   Y+HYGVREHAMAA MNG+ALH G+ PY
Sbjct: 357 VNKLVGGSSDLTSSNNTKVPCMGVVSSKNFDASYVHYGVREHAMAACMNGMALHGGIIPY 416

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
            GTF+VFSDY RPAIRL++LM ++VI+V+THDSIG+GEDGPTHQPVEHLA+LR+IP+L V
Sbjct: 417 GGTFLVFSDYCRPAIRLSALMRVQVIYVMTHDSIGVGEDGPTHQPVEHLASLRSIPNLYV 476

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP-NA 559
            RPAD++E LECW++ALK    PS+ +LSRQ++ F R  Y  NNL + GAY       + 
Sbjct: 477 FRPADAVEVLECWEMALKLTKSPSLFALSRQSVGFSRACYSHNNLASRGAYIIREHEGDF 536

Query: 560 QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAI 619
           +VTIFS+GSE+ +A+ A EIL  + I TRVVS+PC+ +F EQ + Y A ++G+  +K+A+
Sbjct: 537 RVTIFSTGSEVGVALGAREILQDQGIGTRVVSMPCWRIFDEQDEEYIASLLGNGSLKVAV 596

Query: 620 EAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           EA    GW  +IG  G F+G+  FGASG C+ LY+HFGI    +   +  KL
Sbjct: 597 EAACSLGWHKYIGEKGVFMGLDRFGASGKCEDLYRHFGITKENVAGTILAKL 648


>gi|56416950|ref|YP_154024.1| transketolase [Anaplasma marginale str. St. Maries]
 gi|56388182|gb|AAV86769.1| transketolase [Anaplasma marginale str. St. Maries]
          Length = 661

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/657 (50%), Positives = 440/657 (66%), Gaps = 6/657 (0%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + Y+ MA A+R LS+DAI+N  SGHPG+P+GMADV T LF++ + F    P W +RDR V
Sbjct: 5   ESYQIMAKAVRLLSVDAIQNAASGHPGMPLGMADVATVLFSKFLRFSVNHPSWFDRDRLV 64

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GHGSML Y++++L+GY  + I+DIK FR + S T GHPEYG   G+E TTGPLGQG+
Sbjct: 65  LSNGHGSMLMYSIMHLVGY--IGIDDIKRFRQLHSITPGHPEYGCTTGVEVTTGPLGQGL 122

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
             AVG+AIAER   ++FGD LI+H+TY +VGDGCLMEGIS EA S AGHLGL  LIVL+D
Sbjct: 123 GCAVGLAIAERMFSQKFGDDLINHHTYAIVGDGCLMEGISHEAASLAGHLGLDHLIVLFD 182

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLS-DKPTMIACE 255
           +NGISIDG  SLA S D  ARF A G +   V+GHD   I   +  A+ S  KP++I C+
Sbjct: 183 DNGISIDGSTSLATSDDVRARFSAYGLDVFEVDGHDFGEIEQAIGAARESRGKPSIICCK 242

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIG   P +AGT+  H      E+ +  R A+ W+ + F IP++    WR    R+   
Sbjct: 243 TVIGKFMPPKAGTSAAHSWPFSPEDAQEFRNAIGWEGEKFEIPEEAKALWRKVRARAELE 302

Query: 316 RADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLE 375
              W ++ +    +  +      SD +P+   +    LK     ++P  ATRKS   VLE
Sbjct: 303 CELWMKKFAGCAKA--EVLNAILSDGVPNSVIDELDTLKNTLCETRPAEATRKSFGRVLE 360

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
            +   + +L+GGS+DLT SN TK   M  +S  +F   Y+HYGVREHAMAA MNG+ALH 
Sbjct: 361 FLAMRVNKLVGGSSDLTSSNNTKVPCMGVVSSKNFDASYVHYGVREHAMAACMNGMALHG 420

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
           G+ PY GTF+VFSDY RPAIRL++LM ++VI+V+THDSIG+GEDGPTHQPVEHLA+LR+I
Sbjct: 421 GIIPYGGTFLVFSDYCRPAIRLSALMRVQVIYVMTHDSIGVGEDGPTHQPVEHLASLRSI 480

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIS 555
           P+L V RPAD++E LECW++ALK    PS+ +LSRQ++ F R  Y  NNL + GAY    
Sbjct: 481 PNLYVFRPADAVEVLECWEMALKLTKSPSLFALSRQSVGFSRACYSHNNLASRGAYIIRE 540

Query: 556 TP-NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSP 614
              + +VTIFS+GSE+ +A+ A EIL  + I TRVVS+PC+ +F EQ + Y A ++G+  
Sbjct: 541 HEGDFRVTIFSTGSEVGVALGAREILQDQGIGTRVVSMPCWRIFDEQDEEYIASLLGNGS 600

Query: 615 IKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +K+A+EA    GW  +IG  G F+G+  FGASG C+ LY+HFGI    +   +  KL
Sbjct: 601 LKVAVEAACSLGWHKYIGEKGVFMGLDRFGASGKCEDLYRHFGITKENVAGTILAKL 657


>gi|126737911|ref|ZP_01753641.1| transketolase [Roseobacter sp. SK209-2-6]
 gi|126721304|gb|EBA18008.1| transketolase [Roseobacter sp. SK209-2-6]
          Length = 721

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/667 (48%), Positives = 435/667 (65%), Gaps = 9/667 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + D+   A AIR L++DA+   NSGH G+P+GMADV T LF + + FD   P W
Sbjct: 52  TALRTANPDHWNKAAAIRALALDAVAAANSGHTGMPIGMADVATVLFEKHLKFDAANPQW 111

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
           P+RDRF+LSAGHGSML Y+LLYL G + VT+E IKNFR  G+ TAGHPE      +E TT
Sbjct: 112 PDRDRFILSAGHGSMLIYSLLYLCGDKQVTLEQIKNFRQTGALTAGHPENFLIDAVETTT 171

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGIANAVG A+AE   R ++G  ++DH+TYV+ GDGCLMEGISQEAI  AG   L 
Sbjct: 172 GPLGQGIANAVGFAMAEEMQRAQYGRKIVDHHTYVIAGDGCLMEGISQEAIGLAGRHSLG 231

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           KLIVLWDNN I+IDG + L+D T+Q  RF+ASGW  + ++GHD  AI   L  A+ S KP
Sbjct: 232 KLIVLWDNNNITIDGTVELSDRTNQVQRFKASGWQVIEIDGHDPVAIDEALTAAKKSKKP 291

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           +MIAC+T I  G   +  T+K HG+    +++ A ++A  W   PF +P DI  +W   G
Sbjct: 292 SMIACKTHIALGHAAQ-DTSKGHGALTDADQMAAAKEAYGWTTGPFEVPADIKSQWEAIG 350

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R +  R  W+ R + +    +  F R ++   P         LKK+    +P +ATRK+
Sbjct: 351 SRGAAERVAWEARFAEVSQQKQDRFNRAYALEAPKKLSATIKALKKQVSEEQPKVATRKA 410

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE+ L  +N  +PE +GGSADLTGSN TKT  +      +  GRY+++G+REH MAAAMN
Sbjct: 411 SEMALAAINPVMPETVGGSADLTGSNNTKTGDLGVFDTDNRKGRYVYWGIREHGMAAAMN 470

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ LH G+  Y GTF  F+DY+RP++RLA+LM I  + V+THDSIG+GEDGPTHQPVEHL
Sbjct: 471 GMVLHGGIRAYGGTFFCFTDYARPSMRLAALMKIPSVFVMTHDSIGVGEDGPTHQPVEHL 530

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  RA P+  V RPAD++E  E W++AL EK+ PSV+ L+RQNLP LRT+++ +NL + G
Sbjct: 531 AICRATPNTNVFRPADAVEAAEAWEIALTEKSTPSVMVLTRQNLPTLRTEHKLSNLTSKG 590

Query: 550 AYDYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           AY         Q  + ++GSE+ +A++A   L +  I TRVVS+P  ELF +Q ++YR +
Sbjct: 591 AYVLAEAEGKRQAILIATGSEVSLAMDAKAKLEAEGIGTRVVSMPSMELFAQQDEAYRRK 650

Query: 609 IIGSSPIKIAIEAGLRQ-GWDAF-IGSDGS-----FIGMQGFGASGSCDLLYQHFGINAI 661
           I+   P+++ IEA +R  GWD + +G  G      FIGM  FGAS     L++ FGI A 
Sbjct: 651 ILPPGPVRVGIEAAVRAGGWDRWLLGERGQEKKAGFIGMDSFGASAPAGELFEKFGITAE 710

Query: 662 AIVDMVE 668
           A V  V+
Sbjct: 711 AAVAKVK 717


>gi|220924259|ref|YP_002499561.1| transketolase [Methylobacterium nodulans ORS 2060]
 gi|219948866|gb|ACL59258.1| transketolase [Methylobacterium nodulans ORS 2060]
          Length = 660

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/657 (48%), Positives = 434/657 (66%), Gaps = 4/657 (0%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D ++MADAIRFL++DAI     GHPG P+G A++ TALFT+ +V +P  P WPNRDRFVL
Sbjct: 5   DPRRMADAIRFLALDAIARAGDGHPGAPLGCAEIATALFTRHLVCNPDDPEWPNRDRFVL 64

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           S GHGSML YA L+L GY  ++++ IK+FR +GS   GHPE+    GIEATTGPLGQGIA
Sbjct: 65  SNGHGSMLLYAALHLAGYAGISLDAIKSFRELGSPCHGHPEFAPHHGIEATTGPLGQGIA 124

Query: 138 NAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           NAVGMA+AE +L  EFG  L+DH TY LVGDGCLMEGI+ E IS AGHL L KL  LWD+
Sbjct: 125 NAVGMAVAEARLAAEFGPDLVDHRTYALVGDGCLMEGIAHEVISLAGHLRLGKLTFLWDD 184

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           N I+ DG   L+ S D  ARFRA+ W  +  +GHD  A+++ L  A+   +P++IAC T+
Sbjct: 185 NRITDDGSTDLSISEDVRARFRAADWQVIDCDGHDVEAVSAALLLAKGDPRPSLIACRTI 244

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWR-LAGLRSSQTR 316
           IG G P   G    HG  +   +    R A  WD   F +P+D++  WR  AG R+    
Sbjct: 245 IGRGLPRLEGQRGAHGGRVFDSDCAEARAARFWDHPAFTVPEDVLAAWRDGAGARNRAAY 304

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           A WQER ++  ++IR EF+RR    LPD +    + LK+ +  + P   T + +  +L  
Sbjct: 305 AAWQERRAASPAAIRTEFDRRAEGRLPDAWRETLVGLKRHWTETAPERPTIEVAADILAA 364

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           + + +P+L  G+ DL G    K + + A +  +  GRYLHYG+REHAM A MNG+A H+G
Sbjct: 365 LTETIPDLFSGAPDLEGPTKHKQA-LPAFTAQNRGGRYLHYGIREHAMGAMMNGMAAHRG 423

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           L P   T++VFSDY RPA+R+A+LM + VI V +HDSIG+G +GPTHQPVE LA+LRAIP
Sbjct: 424 LIPVGATYLVFSDYLRPALRMAALMELPVITVYSHDSIGIGRNGPTHQPVEFLASLRAIP 483

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           ++LVLRPAD++ET+E W++AL  ++ P+ L  SRQ LP LR      NL A GAY     
Sbjct: 484 NMLVLRPADAVETVEAWEMALANRHGPTSLICSRQPLPPLRRSPGGENLSARGAYVLAQA 543

Query: 557 PNA--QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSP 614
                +VT+  +GSE+ +A++A   L +  I T VVS+P ++ F  Q DSYRA++I    
Sbjct: 544 AGGRQKVTLIGTGSEVAVALDARAQLQAEGIPTSVVSMPSWDAFAAQPDSYRAEVIPPGT 603

Query: 615 IKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +++A+EA +R GWD +IG +G F+GM GFGASG  + L++HFGI A A+V     +L
Sbjct: 604 VRVAVEAAVRLGWDRWIGENGGFVGMTGFGASGPGEELFRHFGITADAVVREARARL 660


>gi|86138817|ref|ZP_01057389.1| transketolase [Roseobacter sp. MED193]
 gi|85824464|gb|EAQ44667.1| transketolase [Roseobacter sp. MED193]
          Length = 673

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/667 (48%), Positives = 435/667 (65%), Gaps = 9/667 (1%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L   + D+   A AIR L++DA+   NSGH G+P+GMADV T LF + + FD   P W
Sbjct: 4   TALRTANPDHWNKAAAIRALALDAVAAANSGHTGMPIGMADVATVLFEKHLKFDVAAPQW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
           P+RDRF+LSAGHGSML Y+LLYL G + VT++ IKNFR +G+ TAGHPE      +E TT
Sbjct: 64  PDRDRFILSAGHGSMLIYSLLYLCGDKQVTLDQIKNFRQMGALTAGHPENFLLDAVETTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGI+NAVG A+AE   R ++G  ++DH+TYV+ GDGCLMEGISQEAI  AG   L 
Sbjct: 124 GPLGQGISNAVGFAMAEEMQRAQYGRKIVDHHTYVIAGDGCLMEGISQEAIGLAGRHSLG 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           KLIVLWDNN I+IDG + L+D T+Q  RFRASGW  + ++GHD  AI   L  A+ S KP
Sbjct: 184 KLIVLWDNNNITIDGTVELSDRTNQVQRFRASGWQVIEIDGHDPVAIDEALTAAKKSKKP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           +MIAC+T I  G   +  T+K HG+    +++ A ++A  W   PF +P +I  +W   G
Sbjct: 244 SMIACKTHIALGHAAQ-DTSKGHGALTDADQMAAAKEAYGWTTGPFEVPAEIKSQWEAIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R +  RA W+ R +      +  F R ++   P         LKK+    +P +ATRK+
Sbjct: 303 ARGADERAAWESRFAETSQQKQDRFNRAYALDAPKKLSATVKALKKQVSEEQPKVATRKA 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE+ L  +N  +PE +GGSADLTGSN TKT  +      +  GRY+++G+REH MAAAMN
Sbjct: 363 SEMALAAINPIMPETVGGSADLTGSNNTKTGDLGVFDTDNRKGRYVYWGIREHGMAAAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ LH G+  Y GTF  F+DY+RPA+RLA+L  I  + V+THDSIG+GEDGPTHQPVEHL
Sbjct: 423 GMVLHGGIRAYGGTFFCFTDYARPAMRLAALSKIPTVFVMTHDSIGVGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  RA P+  V RPAD++E  E W++AL EK  PSV+ L+RQNLP +RT+++ +NL + G
Sbjct: 483 AICRATPNTYVFRPADAVEAAEAWEIALTEKETPSVMVLTRQNLPTVRTEHKLSNLTSKG 542

Query: 550 AYDYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           AY         Q  + ++GSE+ +A+EA   L ++ I TRVVS+P  ELF +Q ++YR +
Sbjct: 543 AYVLAEAEGKRQAILIATGSEVSLAMEAKAQLEAQGIGTRVVSMPSMELFAQQDEAYRRK 602

Query: 609 IIGSSPIKIAIEAGLRQ-GWDAFI----GSD--GSFIGMQGFGASGSCDLLYQHFGINAI 661
           ++ + P+++ IEA +R  GWD ++    G D    FIGM  FGAS     L+  FGI A 
Sbjct: 603 VLPAGPVRVGIEAAVRAGGWDRWLMGERGQDKKAGFIGMDRFGASAPAGELFAKFGITAE 662

Query: 662 AIVDMVE 668
           A V  V+
Sbjct: 663 ATVAKVK 669


>gi|88607696|ref|YP_504948.1| transketolase [Anaplasma phagocytophilum HZ]
 gi|88598759|gb|ABD44229.1| transketolase [Anaplasma phagocytophilum HZ]
          Length = 659

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/662 (49%), Positives = 440/662 (66%), Gaps = 10/662 (1%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M+Y     +MA AIR LS+DAI+N  SGHPG+P+GMADV   LF++ + F  Q P W NR
Sbjct: 1   MQYSTQLTEMASAIRLLSVDAIQNAASGHPGMPLGMADVAAVLFSKFLRFSVQNPNWINR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DR V+S GHGSML Y++L+LLGY  ++I+DIK FR + S T GHPEYG   GIEATTGPL
Sbjct: 61  DRLVMSNGHGSMLIYSILHLLGY--ISIDDIKKFRQLHSITPGHPEYGCTPGIEATTGPL 118

Query: 133 GQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           GQG+  AVGMAIAER L + FG  LIDHYTYV+ GDGCLMEGIS EA S AGHLGL KLI
Sbjct: 119 GQGLGCAVGMAIAERMLAQRFGGDLIDHYTYVMAGDGCLMEGISHEAASLAGHLGLGKLI 178

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMI 252
           VL+D+NGISIDG ISLA S +  ARF + GW+   V+GHD   + + +  A+ +++P++I
Sbjct: 179 VLFDDNGISIDGKISLASSDNVAARFASYGWDVWEVDGHDFGHVYAAIASARETNRPSII 238

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNW-DLDPFFIPDDIMKKWRLAGLR 311
           AC+T+IG    ++  T+  H       + +  R++L   +   F +  D    W+    R
Sbjct: 239 ACKTIIGKFMRSKENTSAAHSWPFTPADAQEVRESLGQGESKAFEVSTDASALWKEVRER 298

Query: 312 SSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
           +      W  +  S +     E     +  +P+   + F  L + F       ATRKS  
Sbjct: 299 AELEYESWLSK--SEQCDKIGELNAATTKGVPE---SVFEGLDEHFRDLGFAEATRKSFG 353

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE  +  +  L+GGSADLT SN TK S MK I+K DFSG Y+HYG+REHAMAA MNG+
Sbjct: 354 RALEFFSQRVNNLVGGSADLTSSNNTKASWMKPITKEDFSGSYIHYGIREHAMAACMNGM 413

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G+ PY GTF+VFSDY RPAIRL++LM ++ I+V+THDSIG+GEDGPTHQPVEHLA+
Sbjct: 414 ALHAGVIPYGGTFLVFSDYCRPAIRLSALMALQAIYVMTHDSIGVGEDGPTHQPVEHLAS 473

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LRAIP+L V RPAD++E LECW++ALK    PS+  LSRQN+  +R++    N    GAY
Sbjct: 474 LRAIPNLYVFRPADAVEVLECWEIALKLTKSPSLFVLSRQNVEPMRSELGRENRSGRGAY 533

Query: 552 DYIS-TPNAQVTIFSSGSELKIAVEACEIL-SSRNISTRVVSVPCFELFFEQSDSYRAQI 609
                  + +VTIF++G+E+ +A+ AC+IL  +  + TRV+S+PC+ LF +Q   Y + +
Sbjct: 534 ILREFEGDLRVTIFATGTEVGVAMAACDILHKTYGVGTRVISMPCWRLFDQQEKKYISGL 593

Query: 610 IGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
           + ++ +K+A+EAG   GW  +IG DG FIG+  FGASG C+ LY HFGI    +V  V  
Sbjct: 594 LDNNSLKVAVEAGSSVGWHKYIGRDGIFIGLDEFGASGKCEDLYAHFGITKENLVSKVLA 653

Query: 670 KL 671
           +L
Sbjct: 654 RL 655


>gi|68171724|ref|ZP_00545078.1| transketolase [Ehrlichia chaffeensis str. Sapulpa]
 gi|67998857|gb|EAM85555.1| transketolase [Ehrlichia chaffeensis str. Sapulpa]
          Length = 618

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/618 (51%), Positives = 426/618 (68%), Gaps = 8/618 (1%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           +D   MA+AIR LS+DAI+   SGHPG+P+GMADV T LF + + F+P+ P W +RDRFV
Sbjct: 6   NDMVNMANAIRVLSVDAIQKAASGHPGMPLGMADVATVLFAKFLKFNPKDPNWFDRDRFV 65

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GHGSML Y++LY LG  D  IE+IK FR I S T GHPEYG   G++ATTGPLGQG+
Sbjct: 66  LSNGHGSMLLYSILYFLGCLD--IEEIKRFRQIHSLTPGHPEYGYTPGVDATTGPLGQGL 123

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           A AVGMAIAE+ L E+FG  +++H TYV+VGDGCLMEGIS EA S AGHL L+KLIVL+D
Sbjct: 124 ACAVGMAIAEKILSEKFGSEIVNHTTYVMVGDGCLMEGISHEAASLAGHLQLNKLIVLFD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +N ISIDGPISL+ S D  ARF +  W+   ++GHD   I S+++ AQ S+KP++I C+T
Sbjct: 184 DNNISIDGPISLSVSDDVKARFLSYQWDVFEIDGHDFGQIESSIKNAQKSEKPSLICCKT 243

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIG    ++  T   H     +EE+   ++ LNW  +PF IP++I++ W+    RS    
Sbjct: 244 VIGKHLSSKENTCAAHSWPFSEEEVMLMKEKLNWQCNPFNIPEEILQLWKNVSSRSEDEY 303

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
             W +R S+  S    +F     + +PD         KK+        ATR++S  VLEV
Sbjct: 304 NMWLDR-SAKYSKTFDDFVDMMKEGVPDSVFLGLKEFKKELYALNLSEATRRTSGRVLEV 362

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +     +LIGGSADLT SN TK   +  I++S+F+G YLHYG+REHAMA  MNG+ALH G
Sbjct: 363 IAKHTSKLIGGSADLTNSNNTKPQLISIINRSNFNGSYLHYGIREHAMAGCMNGMALHGG 422

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           + PY GTF+VFSDY RPAIRL++LM  +VI+V+THDSIG+GEDGPTHQP+EHL++LR+IP
Sbjct: 423 MIPYGGTFLVFSDYCRPAIRLSALMKKQVIYVMTHDSIGVGEDGPTHQPIEHLSSLRSIP 482

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY---DY 553
           +L V RPAD+IE LECW++ALK  + PSV  LSRQN+  +R+     NL   GAY   +Y
Sbjct: 483 NLYVFRPADAIEVLECWEIALKLTSSPSVFILSRQNVGSVRSVSVDENLSNKGAYVIREY 542

Query: 554 ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSS 613
               +  VTIF++GSE++IA++A +IL S+ + TRVVS+PC+ELF +Q   Y   ++ + 
Sbjct: 543 --EKDLDVTIFATGSEVEIALKASDILKSKGLGTRVVSIPCWELFVQQDKKYIFNLLNNK 600

Query: 614 PIKIAIEAGLRQGWDAFI 631
            IK A+EA    GW  ++
Sbjct: 601 SIKAAVEAASSFGWHRYM 618


>gi|254473052|ref|ZP_05086450.1| transketolase [Pseudovibrio sp. JE062]
 gi|211957773|gb|EEA92975.1| transketolase [Pseudovibrio sp. JE062]
          Length = 480

 Score =  630 bits (1624), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 289/461 (62%), Positives = 360/461 (78%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + + +MA+AIRFLSMDA+E   SGHPGLPMG AD+ T LF++ + FDP  P W +RDRFV
Sbjct: 20  EKHSRMANAIRFLSMDAVEKAKSGHPGLPMGAADIATVLFSKFLKFDPNSPKWADRDRFV 79

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSML Y+ LYLLGY+D +IE ++ FR +G++T GHPEYG  AGIE TTGPLGQG+
Sbjct: 80  LSAGHGSMLLYSTLYLLGYEDFSIEQLQQFRQLGARTCGHPEYGHGAGIETTTGPLGQGL 139

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           ANAVGMAIAER   E FG  L++H+TYVL GDGCLMEGISQEAIS AGHL L+KLI++WD
Sbjct: 140 ANAVGMAIAERLQEERFGKDLVNHFTYVLAGDGCLMEGISQEAISLAGHLKLNKLILIWD 199

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           +NGI+IDG + LADSTDQ ARF+ASGWNT++++GHD  AI + L +AQ SDKPTMIA +T
Sbjct: 200 DNGITIDGSVDLADSTDQIARFKASGWNTIAIDGHDPEAIEAALTEAQNSDKPTMIAAKT 259

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
            IGFGSPNRAGTNKVHG+ LG EEI ATR+AL W  +PF +P D++  WR+AGLRS+  R
Sbjct: 260 TIGFGSPNRAGTNKVHGAPLGAEEIAATREALGWSAEPFEVPSDVLDAWRIAGLRSANAR 319

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
            +W++R +      R EFERR    LP  FD A    KK+   ++P +ATRK+S+ VL+V
Sbjct: 320 KEWEQRFNEANPEQRGEFERRCRGDLPSGFDAAIDAYKKELADTQPKMATRKASQAVLKV 379

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +   +PE IGGSADLTGSN T T    +I+  DFSGR++H+G+REH MAAAMNG+ALH G
Sbjct: 380 ITGAVPETIGGSADLTGSNNTNTEHTPSITPDDFSGRFIHWGIREHGMAAAMNGMALHGG 439

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLG 477
           + PYSG F++FSDY RP++RLA+LM  RVIHV+THDSIG G
Sbjct: 440 VIPYSGGFLIFSDYCRPSLRLAALMKQRVIHVMTHDSIGPG 480


>gi|300309841|ref|YP_003773933.1| transketolase [Herbaspirillum seropedicae SmR1]
 gi|300072626|gb|ADJ62025.1| transketolase protein [Herbaspirillum seropedicae SmR1]
          Length = 664

 Score =  627 bits (1617), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 302/654 (46%), Positives = 421/654 (64%), Gaps = 3/654 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + +A AIRFLS+DAI     GH G+P+GMA++ TAL+ + + F+P  P W +RDR VLS 
Sbjct: 7   QPLAHAIRFLSIDAIVRATEGHQGVPLGMAEIATALYARHLRFNPAAPTWWDRDRVVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y LLYL GY+ +T+E +++FR  GS  AGHPEY    GIE TTGPLGQGIANA
Sbjct: 67  GHGSMLLYCLLYLTGYEHITLEQVRSFREFGSHCAGHPEYAPELGIEVTTGPLGQGIANA 126

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
            GMA+AE  L   FGD +++H TY  VGDGCL EGI QE IS AGHL L KL +LWD+N 
Sbjct: 127 FGMAVAEAYLNARFGDDIVNHRTYAFVGDGCLQEGIGQEMISLAGHLRLHKLTLLWDDNQ 186

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           I+ DG   L+ S +   RFR +GW+ + V+GHD  A++  L  AQ SD+P+MIAC TVIG
Sbjct: 187 ITDDGKTELSISENVAERFRVAGWHVVEVDGHDIQAVSRALDAAQGSDRPSMIACRTVIG 246

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADW 319
            G P   G    H + L +++ +A R+ L W   PF +P DI+ +WR  G R+      W
Sbjct: 247 RGIPRVQGQRGGHSARLYEDDAQAARELLQWPHAPFDVPQDILAQWRSFGQRNDAQHQQW 306

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           Q R+ ++ ++ R EFER     LP  +    +  K+     +        S  + +++ +
Sbjct: 307 QARVQALPAAQRAEFERVMRGELPSGWQEVLLPFKRSAHEPEQAQGGILISAAINKLLAE 366

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            +PE + G ADL      K   + A +  D SG Y+H GVREH M A  NG+A H G+  
Sbjct: 367 VMPERMVGCADLEAPTAHKGG-LHAFTADDRSGAYVHCGVREHLMGAMANGMAAHGGVIA 425

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
            S T++ FSDY RPA+R+++LMG+ V +V +HDSIG+G++GPTHQPVE LA+LRA+P++L
Sbjct: 426 LSVTYLAFSDYERPAMRMSALMGLPVKYVFSHDSIGIGKNGPTHQPVEILASLRAMPNML 485

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY--DYISTP 557
           V+RPAD+ E +ECW++A++ ++ P  +  +RQ LP +R QYE+ N CA G Y        
Sbjct: 486 VMRPADATEAVECWEIAMQHRSGPVSMVFARQALPPVRRQYEAENRCARGGYVLHEAQCG 545

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             QVT+ ++GSE+ +A  A   L +  I+T VVS+PC+ELF +Q  +YR Q++G   +++
Sbjct: 546 ARQVTLLATGSEVALACAARAQLEAAGIATAVVSLPCWELFDQQDTAYRQQVLGEQTVRV 605

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            +EA LR GWD ++G+ G F+GM GFGA G  D+LY+HF I A A+V    R L
Sbjct: 606 GVEAALRFGWDHYLGARGGFVGMPGFGAPGPADVLYRHFNITAEAVVAEARRLL 659


>gi|189219271|ref|YP_001939912.1| transketolase [Methylacidiphilum infernorum V4]
 gi|161075739|gb|ABX56617.1| transketolase [Methylacidiphilum infernorum V4]
 gi|189186129|gb|ACD83314.1| Transketolase [Methylacidiphilum infernorum V4]
          Length = 682

 Score =  627 bits (1617), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 327/668 (48%), Positives = 437/668 (65%), Gaps = 19/668 (2%)

Query: 16  DDDYKKMA-DAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDR 74
           D   +++A + IR L+MDA++  NSGHPG PMG+AD    L+T+ + FDP+ P WP+RDR
Sbjct: 15  DSKLEQLAVNVIRGLAMDAVQKANSGHPGTPMGLADAAVVLWTRFLNFDPEDPDWPDRDR 74

Query: 75  FVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQ 134
           FVLS GH SML Y+LL+L GY D+++ED+KNFR  GSKTAGHPEYG   GIE TTGPLGQ
Sbjct: 75  FVLSCGHASMLLYSLLFLSGY-DISLEDLKNFRQFGSKTAGHPEYGHAPGIETTTGPLGQ 133

Query: 135 GIANAVGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKL 191
           GIANAVGMA+AER L   +   G  L DH+TYV   DG LMEGIS E  S AGHLGL KL
Sbjct: 134 GIANAVGMALAERILASRYNKPGFELFDHWTYVFASDGDLMEGISHECCSLAGHLGLGKL 193

Query: 192 IVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLS-DKPT 250
           IVL+D+NGI+IDG  SLA S +   RF + GW    + G+D   +     KA+LS D+P 
Sbjct: 194 IVLYDDNGITIDGHTSLAYSDNVKERFLSYGWEVQQIYGNDRKQVEEAFSKAKLSTDRPH 253

Query: 251 MIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDP-FFIPDDIMKKWRLAG 309
           MI  +T IG+GSP++  T K HG  LG EE++  ++ L    D  F++P+++++ +    
Sbjct: 254 MIIAKTHIGYGSPHKQDTEKAHGEPLGVEEVRLAKEKLGLPADILFYVPEEVVQYFHAFA 313

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFE---RRFSDALPDCFDNAFINLKKKFEHSKPMIAT 366
            R    R  W E          +E E   +   + LP+ +D         F   KP IAT
Sbjct: 314 QRGKHKRQQWMELYKKYAHIYPREAESLHKALRNELPEDWDKQL----PTFPLDKP-IAT 368

Query: 367 RKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAA 426
           R +S  V+  +   +  L+GGSADLT SN T+  ++  ISK +FSGRY+HYGVREHAMAA
Sbjct: 369 RAASGAVINSIFSKIDSLVGGSADLTPSNNTRPKEVVDISKGNFSGRYIHYGVREHAMAA 428

Query: 427 AMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPV 486
            M+G++LHKG+ PY GTF++FSDY RP++RLA++M + VI++ THDSIGLGEDGPTHQPV
Sbjct: 429 IMSGMSLHKGIRPYGGTFLIFSDYMRPSMRLAAMMKLPVIYIFTHDSIGLGEDGPTHQPV 488

Query: 487 EHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNL 545
           E L ALRAIP++ V RP D++ET+E W+VAL +K RP+ L L+RQ LP L R++Y S+  
Sbjct: 489 EQLTALRAIPNMTVFRPCDAMETVEGWKVALSKKERPTCLILTRQALPVLDRSKYASSVG 548

Query: 546 CALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSY 605
              GAY     P  QV +  SGSE+ IA+EA E+L+ RNI  RVVS+P ++LF EQS  Y
Sbjct: 549 ALRGAYVISDAPGFQVILIGSGSEVHIALEAQELLAQRNIPARVVSMPSWDLFAEQSPEY 608

Query: 606 RAQIIGSSPIKIAIEAGLRQ--GWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAI 663
           + +++  SPI+  +         W  ++G +G  +G+  FGAS     +YQ FGI A  +
Sbjct: 609 QEEVL-PSPIRARVAVEAAATLAWAKWVGLEGEVVGLDHFGASAPYKTIYQKFGITAEKV 667

Query: 664 VDMVERKL 671
           V+   R L
Sbjct: 668 VEAAIRSL 675


>gi|300310747|ref|YP_003774839.1| transketolase [Herbaspirillum seropedicae SmR1]
 gi|300073532|gb|ADJ62931.1| transketolase protein [Herbaspirillum seropedicae SmR1]
          Length = 664

 Score =  626 bits (1614), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 320/652 (49%), Positives = 430/652 (65%), Gaps = 12/652 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           KMA+AIR L+MDA++  NSGHPG+PMGMA++  AL+ +    +P  P+W NRDRFVLS G
Sbjct: 9   KMANAIRALAMDAVQKANSGHPGMPMGMAEIAVALWAKHYRHNPANPHWANRDRFVLSNG 68

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YALL+L GY D+++EDIK+FR + SKTAGHPE     G+E TTGPLGQGI NAV
Sbjct: 69  HGSMLQYALLHLTGY-DLSMEDIKSFRQLHSKTAGHPEVHITPGVETTTGPLGQGITNAV 127

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DHYTY  VGDGCLMEGIS EA S AG L LSKLIVL+D+
Sbjct: 128 GMALAEKLLAAEFNKPGLAVVDHYTYAFVGDGCLMEGISHEACSLAGVLNLSKLIVLYDD 187

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           NGISIDG +      D   RF A GWN + +V+GH   A+++ + +A+L+DKPT+I C T
Sbjct: 188 NGISIDGHVEGWFKDDTPKRFEAYGWNVIPAVDGHSVEAVSAAIHQAKLADKPTLICCRT 247

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIG GSPN AGT+KVHG+ALG +EI A R+AL W   PF IP D+   W  A    +   
Sbjct: 248 VIGKGSPNLAGTDKVHGAALGDKEIAAVREALGWTSAPFEIPADVYSAWD-AKATGADFE 306

Query: 317 ADWQERLSSMKS---SIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
           A W++   +  +   S   E  RR    LP  F++            K  IATRK+S+  
Sbjct: 307 ASWKQTFDTYAAQYPSEAAELLRRLKGELPAAFESTVTAYINSTLEKKETIATRKASQNA 366

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           ++     LPE +GGSADLTGSN T   +  A+ ++D  G +++YGVRE  M+A MNGIAL
Sbjct: 367 IQAYAQALPEFLGGSADLTGSNLTNWKESVAV-RADQRGNHINYGVREFGMSAIMNGIAL 425

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H G  P+  TF+ FSDYSR A+R+A+LM IR + V THDSIGLGEDGPTHQ VEH+++LR
Sbjct: 426 HGGYLPFGATFLTFSDYSRNALRMAALMKIRALFVFTHDSIGLGEDGPTHQSVEHVSSLR 485

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYD 552
            IP+L   RP D+ ET   W  ++K  + PS L  SRQNLPF  RT  +  ++ A G Y 
Sbjct: 486 LIPNLDNWRPCDTTETAVAWAESIKRHDGPSTLIFSRQNLPFQERTDAQVKDI-ARGGYV 544

Query: 553 YISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
               PNA+V + ++GSE+++A +A + L++  I+ RVVS+P  ++F  Q  +Y+A ++  
Sbjct: 545 LRDAPNAKVILMATGSEIELATKAADALTAEGIAVRVVSMPSTDVFDRQDAAYKASVLTR 604

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
              ++AIEAG+   W  ++G +G+ +G+  FG S    +L++HFG     +V
Sbjct: 605 GVPRVAIEAGVTAFWHKYVGLEGAVVGIDTFGESAPAGVLFKHFGFTVENVV 656


>gi|47177005|ref|YP_015616.1| transketolase [Oligotropha carboxidovorans OM5]
 gi|47115396|emb|CAG28449.1| transketolase [Oligotropha carboxidovorans OM5]
          Length = 582

 Score =  625 bits (1611), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 302/576 (52%), Positives = 392/576 (68%), Gaps = 2/576 (0%)

Query: 98  VTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVL 157
           +TI++IK+FR  GSKT GHPEYG   G+E TTGPLGQGIA AVGMA++ER      G+ L
Sbjct: 1   MTIDEIKSFRQWGSKTPGHPEYGHTQGVETTTGPLGQGIATAVGMALSERMTNARLGNDL 60

Query: 158 IDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYAR 217
            +HYTYV+ GDGCLMEG+SQEAIS AGHL L +LIVL+D+NGISIDG  SL+ S D  AR
Sbjct: 61  FEHYTYVICGDGCLMEGVSQEAISLAGHLKLGRLIVLFDDNGISIDGSTSLSCSDDPLAR 120

Query: 218 FRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALG 277
             ASGW+   V+GHD  A+   + + + +D+P++IAC+T IG+GSP R G+ K HG+ LG
Sbjct: 121 AAASGWSVRRVDGHDPKAVEKAIAEERETDRPSLIACKTRIGYGSPGREGSEKAHGAPLG 180

Query: 278 QEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERR 337
            EEI +TR AL+W   PF IP D++  WR  G       + W +RL+ +    R+     
Sbjct: 181 AEEIVSTRAALDWPHAPFEIPRDVLAAWRTVGEHGQTEHSKWVDRLAQLDREEREHINSV 240

Query: 338 FSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGT 397
            S  L   +D A   L   F   +P IATR++S+ V+E++   LP L GGSADLT SN T
Sbjct: 241 LSGKLSSQYDAAMRKLCAGFATEQPKIATRQASQQVIEMLASVLPNLAGGSADLTHSNLT 300

Query: 398 KTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRL 457
                K I   D++G Y+HYG+REH MAAAMNGIALH G  PY GTF+ F+DYSRPAIR+
Sbjct: 301 HAKSQKPIKPGDYAGNYIHYGIREHGMAAAMNGIALHGGFIPYGGTFLTFADYSRPAIRM 360

Query: 458 ASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVAL 517
           A+LMG+RVIHV+THDSIGLGEDGPTHQPVEHLA+LRAIP+LLV RPAD++ET E W  AL
Sbjct: 361 AALMGLRVIHVMTHDSIGLGEDGPTHQPVEHLASLRAIPNLLVFRPADAVETAEAWDCAL 420

Query: 518 KEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN-AQVTIFSSGSELKIAVEA 576
           + ++RPS+L LSRQ LP  R+   + N  A GAY  +   +   VT+ ++GSE+ IA++A
Sbjct: 421 RAESRPSILCLSRQALPTFRSGSSAINKVAQGAYLVLDPQDRCDVTLIATGSEVAIALDA 480

Query: 577 CEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGS 636
             +L   +I   VVS PC ELF EQ + YR  ++G  P ++AIEA +   W   IG DG 
Sbjct: 481 ARLLEKDDIRAAVVSAPCLELFAEQPEEYRRAVLGQRP-RVAIEAAIEGAWARLIGDDGE 539

Query: 637 FIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
           F+GM GFGAS   ++LY+ FGI    +V   +R ++
Sbjct: 540 FVGMTGFGASAPANVLYREFGITPEGVVLAAKRSIA 575


>gi|187920811|ref|YP_001889843.1| transketolase [Burkholderia phytofirmans PsJN]
 gi|187719249|gb|ACD20472.1| transketolase [Burkholderia phytofirmans PsJN]
          Length = 682

 Score =  625 bits (1611), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 321/653 (49%), Positives = 428/653 (65%), Gaps = 5/653 (0%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           +ADAIRFLS+DAI     GH G+P+GMA++ TALFT+ + F+P  P WP+RDRFVLS GH
Sbjct: 32  LADAIRFLSIDAILRAGEGHQGVPLGMAEIATALFTRHLKFNPADPTWPDRDRFVLSNGH 91

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GS+L Y+LLYL GY  + +E IK+FR +GS  AGHPEY    GIEATTGPLGQGIANA+G
Sbjct: 92  GSLLLYSLLYLTGYDAIGLEQIKSFRELGSHCAGHPEYEPAHGIEATTGPLGQGIANALG 151

Query: 142 MAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGIS 201
           MAIAE  L  +FG  L+DHYTY  VGDGCL EGI QE IS AGHL L KLI+ WD+N I+
Sbjct: 152 MAIAEAYLAAKFGSDLVDHYTYAFVGDGCLQEGIGQEMISLAGHLQLGKLILCWDDNQIT 211

Query: 202 IDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFG 261
            DG  +L+ S D  ARFR  GW+ + V+GHD  A+++ L  A+   +P+MIAC+TVIG G
Sbjct: 212 DDGSTALSISEDVCARFRVGGWHVVEVDGHDLGAVSAALTIARADPRPSMIACKTVIGRG 271

Query: 262 SPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQE 321
                G    H   L Q +  A R  L W   PF IP +I+  WR AG RS      W E
Sbjct: 272 IARLQGQRGGHSGKLFQTDADAARDTLGWPHAPFEIPAEILGAWRAAGRRSDPQYYAWHE 331

Query: 322 RLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKK-FEHSKPMIATRKSSELVLEVVNDC 380
           RL+++ ++ R EFER  +  LP  + +   + +K+  E  +P      S E + +++   
Sbjct: 332 RLAALPAAQRDEFERVQAGYLPQGWRDVLDDYRKRAVERDEPQPGITVSGE-ISDLLAPL 390

Query: 381 LPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPY 440
           LPE + G ADL    G K  Q+ A +  D SG Y+H GVREH M +  NG+A H G+   
Sbjct: 391 LPERMVGCADLEAPTGHK-RQLHAFTAEDRSGAYVHCGVREHVMGSMANGMAAHGGVIAT 449

Query: 441 SGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLV 500
           S T++ FSDY RPA+R+A+LMG+ V +V +HDSIG+G++GPTHQPVE LA+LRA+P++ V
Sbjct: 450 SVTYLAFSDYQRPAMRMAALMGLPVHYVFSHDSIGVGKNGPTHQPVEILASLRAMPNMRV 509

Query: 501 LRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQ 560
           LRPAD++E  ECW +AL+ +  PS L  +RQ LP +R +Y +  L   GAY         
Sbjct: 510 LRPADAVEAAECWALALEHRRGPSTLVFARQALPLVRREYSAEPLSQRGAYVLEEAEGGA 569

Query: 561 --VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIA 618
             VT+ ++GSE+ +AVEA   L    I+T VVS+PC+E+F EQ D+YR  ++G+  +++ 
Sbjct: 570 RVVTLLATGSEVALAVEARRQLQDEGIATAVVSMPCWEIFDEQDDAYRTAVLGAGTVRVG 629

Query: 619 IEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +EA LR GWD ++G  G F+GM GFGAS S + LY+HFGI A  IV   +R L
Sbjct: 630 VEAALRFGWDRYLGERGGFVGMTGFGASASAETLYEHFGITAQHIVAEAKRHL 682


>gi|114321410|ref|YP_743093.1| transketolase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227804|gb|ABI57603.1| transketolase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 666

 Score =  625 bits (1611), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 332/659 (50%), Positives = 435/659 (66%), Gaps = 18/659 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + +A+AIR LSMDA++  +SGHPG PMGMAD+   L+   +  +P  P+W +RDRFVLS 
Sbjct: 5   RDLANAIRALSMDAVQRAHSGHPGAPMGMADIAEVLWNDYLRHNPANPHWWDRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ + I+D+K FR + S+T GHPEYG  AG+E TTGPLGQG+ANA
Sbjct: 65  GHGSMLLYSLLHLSGYE-LGIDDLKAFRQLHSRTPGHPEYGYTAGVETTTGPLGQGLANA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VG+A+AER L  +F   G  L+DH+TY  +GDGCLMEG+S EA S AG   L KLI  +D
Sbjct: 124 VGLALAERTLAAQFNRPGHELVDHWTYCFLGDGCLMEGVSHEACSLAGTWKLGKLIGFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +NGISIDG +    + D   RF A GW+ +  V+GHD  AI   + +A+ ++D+P++I C
Sbjct: 184 DNGISIDGKVEGWFTDDTPGRFEAYGWHVVREVDGHDSEAIKRAIDEARAVTDRPSLICC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFG+PN  GT+ VHG+ LG EEI+ATR+ L W+  PF IP +I   W  A  R  Q
Sbjct: 244 KTVIGFGAPNVCGTHGVHGAPLGDEEIQATREFLKWEHGPFEIPREIYSGWD-ARARGKQ 302

Query: 315 TRADWQERLSSMKSS---IRKEFERRFSDALPDCF-DNAFINLKKKFEHSKPMIATRKSS 370
             A W ERL++ + +   +  EFERR   ALP+ F  +A   L +  + S   +ATRK+S
Sbjct: 303 LEAAWHERLAAYRKAHPEMAAEFERRMKGALPERFAQHAEEALAEAVDESA-KVATRKAS 361

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAI--SKSDFSGRYLHYGVREHAMAAAM 428
           E  L  +   LPEL+GGSADL+GSN TK      I  +K+D  G YLHYGVRE  M+A  
Sbjct: 362 EQALNRLGPYLPELLGGSADLSGSNNTKWEDCAVIGGAKADADGNYLHYGVREFGMSAIA 421

Query: 429 NGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEH 488
           NG+ALH G  PY+GTF+VFSDY+R AIR+A+LMGI+ I V THDSIGLGEDGPTHQPVEH
Sbjct: 422 NGLALHGGFIPYTGTFLVFSDYARNAIRMAALMGIQQIFVHTHDSIGLGEDGPTHQPVEH 481

Query: 489 LAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCAL 548
           L +LR IP L V RP D+IET   WQ AL+ ++ PS+L+LSRQ L   +   E   L   
Sbjct: 482 LGSLRMIPGLDVWRPCDAIETQAAWQAALERRDGPSLLALSRQGLVAQQRTDEQVALIRR 541

Query: 549 GAYDYISTPN---AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSY 605
           G Y  ++ P    A++ + ++GSE+ I VEA E L+ R    RVVS+PC E+F  Q   Y
Sbjct: 542 GGY-VLAEPKQGEAELILMATGSEVAIMVEAAERLADRGRRVRVVSMPCLEVFQSQPADY 600

Query: 606 RAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           R  ++ +    IA+EA     W A +G  G  IG+  FG S     LY+HFGIN  A+V
Sbjct: 601 REAVLPAGVPVIAMEAAHPMPWQALLGDRGRVIGIDTFGESAPGPALYEHFGINVDAVV 659


>gi|317486903|ref|ZP_07945713.1| transketolase [Bilophila wadsworthia 3_1_6]
 gi|316921778|gb|EFV43054.1| transketolase [Bilophila wadsworthia 3_1_6]
          Length = 664

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 324/662 (48%), Positives = 437/662 (66%), Gaps = 19/662 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++ADAIR LSMDA++   SGHPG PMGMAD+  AL+   +  +P  P+W NRDRFVLS 
Sbjct: 5   KELADAIRILSMDAVDKAKSGHPGAPMGMADMAEALWRGVLRHNPADPHWANRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GH SML Y++L+L GY D++++DIKNFR +GS+T GHPE G   G+E TTGPLGQG A A
Sbjct: 65  GHASMLLYSVLHLTGY-DLSMDDIKNFRQLGSRTPGHPEKGVTPGVETTTGPLGQGFATA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  EF   G  ++DH+TYV +GDGCLMEG+SQEA S AG LGL KLIV++D
Sbjct: 124 VGMAVAEKLLAAEFNRDGFPIVDHHTYVFLGDGCLMEGLSQEACSLAGTLGLGKLIVMYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +      D  ARF A GW+ +S V+GHD   + + L  A+  +++PT+I C
Sbjct: 184 DNGISIDGDVHQWFGDDTPARFEACGWHVISGVDGHDAAMLDAALVLARKETERPTLICC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T IG+GSP + GT   HGS +G +E  A R AL W  +PF IP DI   W  A  R + 
Sbjct: 244 KTTIGYGSPKKGGTASSHGSPMGADENAAVRAALGWKDEPFVIPQDIKDAWD-ARERGAA 302

Query: 315 TRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
              +W+   ++   +   +  EFERR    LP  +++   +   +F+  KP +ATR ++ 
Sbjct: 303 LEGEWKALFAAYAKAYPDLAAEFERRMGGTLPADWESVSSSAIARFDADKPKVATRIANR 362

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
            VL  +   LPEL GGSADLTGS GT   +   I ++D++G YL YGVRE  M   MNG+
Sbjct: 363 DVLNAIAPHLPELFGGSADLTGSVGTWHEKASRIGRNDWNGNYLSYGVREFVMGTVMNGL 422

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY GTF+VFSDY+R AIRL++LM  R++ VLTHDSIG+GEDGPTHQPVEH+++
Sbjct: 423 ALHGGFIPYGGTFLVFSDYARNAIRLSALMKQRLVWVLTHDSIGVGEDGPTHQPVEHVSS 482

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGA 550
           LR IPDLLV RP D++E+   W+VAL E  +PS + L+RQ L P  RT+ E       GA
Sbjct: 483 LRLIPDLLVWRPCDAVESAVAWKVAL-ESAQPSCMVLTRQGLTPQTRTE-EQLEAVKRGA 540

Query: 551 Y---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
           Y   D   TP  +V + ++GSE+++AV A E L+ +    RVVS+PC ELF  Q   Y+ 
Sbjct: 541 YILKDCEGTP--EVILIATGSEVQLAVSAAEALAGKGRKARVVSMPCAELFDAQPAEYKE 598

Query: 608 QIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDM 666
            ++  +   ++A+EA    GW  ++G DG+ +GM GFG S   D+L++HFG     +VD+
Sbjct: 599 NVLPRAVRARVAVEAASVDGWWKYVGLDGAVVGMSGFGESAPGDVLFKHFGFTVDHVVDV 658

Query: 667 VE 668
            E
Sbjct: 659 AE 660


>gi|171060423|ref|YP_001792772.1| transketolase [Leptothrix cholodnii SP-6]
 gi|170777868|gb|ACB36007.1| transketolase [Leptothrix cholodnii SP-6]
          Length = 675

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 320/659 (48%), Positives = 437/659 (66%), Gaps = 12/659 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+++R L+MDA++  NSGHPG PMGMA++  AL+ + +  +P  P+WP+RDRFVLS G
Sbjct: 10  EMANSLRALAMDAVQKANSGHPGAPMGMAEMAVALWGRHLRINPADPHWPDRDRFVLSNG 69

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML YALL+L G+ D++I+D+K FR + S+T GHPE G   G+E TTGPLGQG+ NAV
Sbjct: 70  HASMLLYALLHLSGH-DLSIDDLKAFRQLRSRTPGHPEVGLTPGVETTTGPLGQGLTNAV 128

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           G A+AE+ L  EF   G  ++DH TYV +GDGCLMEGISQEAIS AG  GL+KL+ L+D+
Sbjct: 129 GFALAEKLLAREFNRPGHDIVDHRTYVFLGDGCLMEGISQEAISLAGVWGLNKLVALYDD 188

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIACE 255
           NGISIDGP+    + D   RF+A GWN + +++GHD  A+   + +AQ  S++PT+I C 
Sbjct: 189 NGISIDGPVQGWFADDTALRFKACGWNVIGTLDGHDVDAVDQAIAQAQHSSERPTLIICR 248

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T +G GSPNRA T + HG  LG  EI ATR A+ W   PF +P+ +   W  A  R +  
Sbjct: 249 TRLGHGSPNRANTARAHGEPLGAAEIAATRAAIGWPHAPFEVPESLRAAWD-ARERGAAL 307

Query: 316 RADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           +  W ERL++ +++   +  EFERR    LP  F+   +N   +F  S+  +A+RK+S+ 
Sbjct: 308 QQQWAERLTAYRAAHPALAAEFERRVRGDLPADFEETLLNAMLQFGQSRDSVASRKASQQ 367

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
           VL  +   +PEL+GGSADLTGSN T      A+   +F GR++HYGVRE  MAA MNGIA
Sbjct: 368 VLAALAPRVPELLGGSADLTGSNLTDFPGCGAVRGGEFGGRHVHYGVREFGMAAIMNGIA 427

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G  PY GTF+ FSDYSR A+R+A+LM +RV+HV THDS+GLGEDGPTHQPVEH A+L
Sbjct: 428 LHGGFIPYGGTFLTFSDYSRNAVRMAALMKLRVVHVFTHDSVGLGEDGPTHQPVEHAASL 487

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           R IP L V RP D+ ET   W  AL++  RPS L LSRQNLP    + E       GAY 
Sbjct: 488 RLIPGLDVWRPCDAAETAVAWTHALQQAQRPSALLLSRQNLPAQLREPEQLVAIRRGAYV 547

Query: 553 YISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
               P  Q  + ++GSE+ +A+ A ++L  R IS RVVS+PC  LF  Q  ++R  ++G 
Sbjct: 548 LSDRPQPQAVLLATGSEVGLAMAAQQLLDGRGISVRVVSLPCTTLFDRQDRAWRDAVLGR 607

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
              +I +EAG+ + W  +     + +G+  FG SG    +++HFG+ A A+  +VER++
Sbjct: 608 GLPRIGVEAGVSRWWGQY--GCCAALGIDRFGESGPGPAVFEHFGLTAAALASLVEREI 664


>gi|237749445|ref|ZP_04579925.1| transketolase [Oxalobacter formigenes OXCC13]
 gi|229380807|gb|EEO30898.1| transketolase [Oxalobacter formigenes OXCC13]
          Length = 665

 Score =  622 bits (1603), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 325/659 (49%), Positives = 423/659 (64%), Gaps = 10/659 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           KMA AIR L+MDA++  NSGHPG+PMGMAD+  AL++     +P  P W NRDRF+LS G
Sbjct: 9   KMASAIRALAMDAVQKANSGHPGMPMGMADIAVALWSGHYRHNPANPNWFNRDRFILSNG 68

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YALL+L GY D+T+EDIKNFR  GSKT GHPE     GI+ TTGPLGQGI+N V
Sbjct: 69  HGSMLQYALLHLTGY-DLTMEDIKNFRQFGSKTPGHPEVHLTPGIDTTTGPLGQGISNGV 127

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L EEF   G  ++DHYTYV +GDGCLMEG+S E+ S AG   L+KLI L+D+
Sbjct: 128 GMALAEKLLAEEFNKPGFDIVDHYTYVFLGDGCLMEGVSHESCSLAGTWKLNKLIALYDD 187

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           N ISIDG +    + +   RF A GW+ +  V+GHD +A+ + +  AQ SDKPT+I C+T
Sbjct: 188 NSISIDGDVKGWFTDNTPERFEAYGWHVIRDVDGHDVNAVDAAIVAAQKSDKPTLICCKT 247

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAGLRSSQ 314
           VIG GSPN+AG NK HGS LG EEI ATRKA+ WD  PF IP+D+   W  R +G     
Sbjct: 248 VIGKGSPNKAGLNKAHGSPLGDEEIAATRKAIGWDYPPFDIPEDVYTAWDARKSGNALES 307

Query: 315 TRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
              D   + S        E  RR S  LP  FD    N        K  IATRK+S+  +
Sbjct: 308 AWNDLFAKYSEKYPKEASELVRRISGQLPADFDEVVRNYIADCNAKKETIATRKASQNAI 367

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           + +   LPE +GGSADLTGSN T       + +    G Y++YGVRE  M+A MNGI LH
Sbjct: 368 DALAPALPEFLGGSADLTGSNLTNWKGCVPVREGK-EGNYINYGVREFGMSAIMNGIVLH 426

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            G  P+ GTF+ FSDY R AIR++SLM I  I+V THDSIG+GEDGPTHQP+E  A+LR 
Sbjct: 427 GGFIPFGGTFLTFSDYCRNAIRMSSLMQIGTIYVFTHDSIGVGEDGPTHQPIEQTASLRL 486

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYDY 553
           IP L   RP D++ET   W  A+K++  PSVL LSRQNLP+  RT+ +  N+   G Y  
Sbjct: 487 IPGLENWRPCDTVETAVAWGNAVKKRKTPSVLILSRQNLPYFERTEEQIGNISK-GGYVL 545

Query: 554 ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSS 613
              P+A+V + ++GSE+++A+++ + L+ +NI  RVVS+P  ++F +Q   YR  ++   
Sbjct: 546 RDAPDAKVILIATGSEVELAMKSADELAKKNIPARVVSMPSSDIFDKQDALYRNSVLPRE 605

Query: 614 PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
             ++AIEA     W  ++G DG  +GM  FG S     L++HFG     +V  VE  LS
Sbjct: 606 LPRVAIEAAASDYWRKYVGLDGDVVGMTTFGESAPAGTLFKHFGFTVENVVSKVESVLS 664


>gi|114321988|ref|YP_743671.1| transketolase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228382|gb|ABI58181.1| transketolase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 665

 Score =  621 bits (1602), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 330/663 (49%), Positives = 434/663 (65%), Gaps = 18/663 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + +A+AIR LSMDA++  +SGHPG PMGMAD+   L+   +  +P  P+W +RDRFVLS 
Sbjct: 5   RDLANAIRALSMDAVQRAHSGHPGAPMGMADIAEVLWNDYLRHNPANPHWWDRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ + I+D+K FR + S+T GHPEYG  AG+E TTGPLGQG+ANA
Sbjct: 65  GHGSMLLYSLLHLSGYE-LGIDDLKAFRQLHSRTPGHPEYGYTAGVETTTGPLGQGLANA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VG+A+AER L  +F   G  L+DH+TY  +GDGCLMEG+S EA S AG   L KLI  +D
Sbjct: 124 VGLALAERTLAAQFNRPGHELVDHWTYCFLGDGCLMEGVSHEACSLAGTWKLGKLIGFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +NGISIDG +    + D   RF A GW+ +  V+GHD  AI   + +A+ ++D+P++I C
Sbjct: 184 DNGISIDGKVEGWFTDDTPGRFEAYGWHVVREVDGHDAEAIKRAIDEARAVTDRPSLICC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFG+PN  GT+ VHG+ LG EEI+ATR+ L W+  PF IP +I   W  A  R  Q
Sbjct: 244 KTVIGFGAPNVCGTHGVHGAPLGDEEIQATREFLKWEHGPFEIPREIYSGWD-ARARGKQ 302

Query: 315 TRADWQERLSSMKSS---IRKEFERRFSDALPDCF-DNAFINLKKKFEHSKPMIATRKSS 370
             A W ERL++ + +   +  EFERR    LP+ F  +A   L +  + S   +ATRK+S
Sbjct: 303 LEAAWHERLAAYRKAHPEMAAEFERRMKGELPERFAQHAEEALAEAVDESA-KVATRKAS 361

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAI--SKSDFSGRYLHYGVREHAMAAAM 428
           E  L  +   LPEL+GGSADL+GSN TK      I  +K+D  G YLHYGVRE  M+A  
Sbjct: 362 EQALNRLGPYLPELLGGSADLSGSNNTKWEDCAVIGGAKADADGNYLHYGVREFGMSAIA 421

Query: 429 NGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEH 488
           NG+ALH G  PY+GTF+VFSDY+R AIR+A+LMGI+ I V THDSIGLGEDGPTHQPVEH
Sbjct: 422 NGLALHGGFIPYTGTFLVFSDYARNAIRMAALMGIQQIFVHTHDSIGLGEDGPTHQPVEH 481

Query: 489 LAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCAL 548
           L +LR IP L V RP D+IET   WQ AL+ ++ PS+L+LSRQ L   +   E   L   
Sbjct: 482 LGSLRMIPGLDVWRPCDAIETQAAWQAALERRDGPSLLALSRQGLVAQQRTDEQVALIRR 541

Query: 549 GAYDYISTPN---AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSY 605
           G Y  ++ P    A++ + ++GSE+ I VEA E L+ R    RVVS+PC E+F  Q   Y
Sbjct: 542 GGY-VLAEPKQGEAELILMATGSEVAIMVEAAERLADRGRRVRVVSMPCLEVFQSQPADY 600

Query: 606 RAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
           R  ++ +    IA+EA     W A +G  G  IG+  FG S     LY+HFG+   A+V 
Sbjct: 601 REAVLPAGVPVIAMEAAHPMPWQALLGDRGRVIGIDTFGESAPAPALYEHFGLTVDAVVQ 660

Query: 666 MVE 668
             E
Sbjct: 661 ATE 663


>gi|270158605|ref|ZP_06187262.1| transketolase [Legionella longbeachae D-4968]
 gi|289166567|ref|YP_003456705.1| transketolase [Legionella longbeachae NSW150]
 gi|269990630|gb|EEZ96884.1| transketolase [Legionella longbeachae D-4968]
 gi|288859740|emb|CBJ13721.1| putative transketolase [Legionella longbeachae NSW150]
          Length = 663

 Score =  620 bits (1598), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 325/667 (48%), Positives = 434/667 (65%), Gaps = 23/667 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LS+DA+E   SGHPG+P+GMAD+ T L+ + +  +PQ P+W NRDRFVLS 
Sbjct: 5   KELANAIRILSVDAVEQAQSGHPGMPLGMADIATVLWKKFLKHNPQNPHWFNRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSM+ Y+LL+L GY +++++D+K+FR + SKT GHPE+G   G+E TTGPLGQG+ANA
Sbjct: 65  GHGSMILYSLLHLTGY-NLSLDDLKHFRQLNSKTPGHPEFGHTPGVETTTGPLGQGLANA 123

Query: 140 VGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AER L   F      L+DHYTY  VGDGCLMEGIS EA S AG LGL KLIV +D
Sbjct: 124 VGMALAERVLATHFNQDNFNLVDHYTYTFVGDGCLMEGISHEACSLAGTLGLGKLIVFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           NNGISIDG I    + D   RF++  W  + ++NGHD H I   + KAQ  + +PT+I C
Sbjct: 184 NNGISIDGKIDSWFTDDTATRFKSYHWQVIEAINGHDAHEIEQAILKAQANTTQPTLIIC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
            TVIG GS + AG+ K HGSALG +++   R+  NW  +PF IPD I ++W        Q
Sbjct: 244 NTVIGLGS-SVAGSEKAHGSALGAKDVANVREFFNWKHEPFVIPDSIYQQWS----HVEQ 298

Query: 315 TRADWQERLSSMKSSIRK------EFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRK 368
            + D Q+ L  +    +       EF RR +  LPD + N      ++  +++  +ATRK
Sbjct: 299 GQKDEQQWLMLLNEYQKHYPQEHDEFLRRINGDLPDDWLNQSNTFFEQCRNNEKAVATRK 358

Query: 369 SSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAM 428
           +S+  +E     LPE++GGSADLTGSN T  S  KAI   ++SG YL+YGVRE AMAA M
Sbjct: 359 ASQQCIEYFARLLPEMLGGSADLTGSNNTDWSGSKAILGHEYSGNYLYYGVREFAMAAIM 418

Query: 429 NGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEH 488
           NGIA+H G  PY GTF+VF+DY+R A+RL++LM  RVI+V THDSIGLGEDGPTHQPVEH
Sbjct: 419 NGIAVHGGFIPYGGTFLVFADYARNAVRLSALMKQRVIYVFTHDSIGLGEDGPTHQPVEH 478

Query: 489 LAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCAL 548
            A LR  P + V RPAD +ET   WQ AL+  N P+ L LSRQNLP L     +  L   
Sbjct: 479 AAMLRMTPGMSVWRPADLMETAVAWQFALEHHNGPTSLLLSRQNLPALPHGETAAELIKK 538

Query: 549 GAY---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSY 605
           G Y   D   TP+A   + ++GSE+++A+ A E + ++ +  RV+S+PC E F EQ  +Y
Sbjct: 539 GGYIIKDCDGTPDA--LLIATGSEVQLAIAAAEQVQTQGLKVRVISMPCAERFLEQDQNY 596

Query: 606 RAQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           + Q++  +  ++IAIEA     W  F+G +G+ IG+  FG S      YQ  GI+   IV
Sbjct: 597 KNQVLPPNIRVRIAIEAASSAYWYQFVGLEGAVIGLDRFGVSAPAAQAYQFLGISVERIV 656

Query: 665 DMVERKL 671
             +   L
Sbjct: 657 KTLNTLL 663


>gi|291296208|ref|YP_003507606.1| transketolase [Meiothermus ruber DSM 1279]
 gi|290471167|gb|ADD28586.1| transketolase [Meiothermus ruber DSM 1279]
          Length = 653

 Score =  619 bits (1596), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 324/659 (49%), Positives = 429/659 (65%), Gaps = 19/659 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K   DAIR L++DA+E   SGHPG+PMGMA     L+T+ +  +P+ P+WP RDRFVLSA
Sbjct: 9   KASIDAIRMLALDAVEQAKSGHPGMPMGMAPAAYVLWTEFLKHNPKDPHWPARDRFVLSA 68

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY D+++E++K FR  GSKT GHPEYG   G+E TTGPLGQGI+ A
Sbjct: 69  GHGSMLLYALLHLTGY-DLSLEELKRFRQWGSKTPGHPEYGHTPGVEVTTGPLGQGISTA 127

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMAIAERKL  EFG++  +HYTYV+  DG LMEG+S EA S AGHL L KLIVL+D+N 
Sbjct: 128 VGMAIAERKLVAEFGEI-AEHYTYVIASDGDLMEGVSAEASSLAGHLRLGKLIVLYDDNE 186

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLSDKPTMIACETVI 258
           ISIDG  +LA + D+  R+ A GW+ +  V+G D  AI + LR+AQ   +P++I+  ++I
Sbjct: 187 ISIDGSTALAFTEDRLKRYEAYGWHVVPGVHGEDLEAIRAALREAQADPRPSLISVRSII 246

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSP  AG +K H  A+G E++ ATR+AL W   PF IP+++   +R A  R  Q +A+
Sbjct: 247 GFGSP-LAGHHKAHSDAMGPEKVAATRQALGWPYAPFEIPEEVYAHYRQAIARGQQAQAE 305

Query: 319 WQERLSSM-KSSIRK--EFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLE 375
           WQ +  +  KS   K  EF+RR   ALP  +++       +F   +  +ATR +S  VLE
Sbjct: 306 WQRKFEAFAKSHPEKAAEFQRRLGRALPLGWESHL----PRFSAGE-KLATRAASGKVLE 360

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
            +   LPEL+GGSADLT SN T+T  M      +  GRY+ YGVREHAM AAMNGIAL  
Sbjct: 361 KLVPVLPELMGGSADLTPSNNTRTPDMTDFGPENPGGRYIRYGVREHAMGAAMNGIALSG 420

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
            L PY GTF+VFSDY RPAIR+A+LMG   + V THDSI +GEDGPTHQP+EHL +LRAI
Sbjct: 421 ALRPYGGTFLVFSDYMRPAIRMAALMGTPTVFVFTHDSIAVGEDGPTHQPIEHLMSLRAI 480

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLR-TQYESNNLCALGAYDYI 554
           P+L V+RPAD+ ET   W++AL   + P+ L L+RQ LP L   + E       G Y   
Sbjct: 481 PNLWVVRPADANETAAAWKLALARTDGPTALILTRQALPVLAGVRLEG---VERGGYILS 537

Query: 555 STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSP 614
             PN Q  I ++GSE+ +A+EA ++L+   ++ RVVS+PC+E F  Q + YR  I+  S 
Sbjct: 538 EVPNPQAAIVATGSEVALALEAQQLLAEEGVAVRVVSLPCWEAFEAQPEDYRQAILPKSL 597

Query: 615 IKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
             +A+EAG   GW+ +       +G+  FGAS     +Y   G     +   V+  L V
Sbjct: 598 PTLALEAGTTLGWERYAHKA---VGLDRFGASAPYADVYSKLGFTKERVAAEVKSLLGV 653


>gi|212709224|ref|ZP_03317352.1| hypothetical protein PROVALCAL_00259 [Providencia alcalifaciens DSM
           30120]
 gi|212688136|gb|EEB47664.1| hypothetical protein PROVALCAL_00259 [Providencia alcalifaciens DSM
           30120]
          Length = 664

 Score =  617 bits (1590), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 321/653 (49%), Positives = 426/653 (65%), Gaps = 21/653 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K +A+AIRFLSMDA++   SGHPG PMGMAD+   L+   M  +P  P+W NRDRFVLS 
Sbjct: 5   KTLANAIRFLSMDAVQKAKSGHPGAPMGMADIAEVLWRNHMNHNPADPHWANRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++I+++KNFR + SKT GHPEYG   G+E TTGPLGQGIANA
Sbjct: 65  GHGSMLIYSLLHLTGY-DLSIDELKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGIANA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VG AIAER L  +F   G  ++DH+TYV +GDGC+MEGIS E  S AG L L+KL+  +D
Sbjct: 124 VGFAIAERTLAAQFNRPGHDVVDHHTYVFMGDGCMMEGISHEVCSLAGTLKLNKLVAFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKA-QLSDKPTMIAC 254
           +NGISIDG +    + D  ARF A GW+ +  +NGHD   I + + +A + SDKPT+I C
Sbjct: 184 DNGISIDGEVEGWFTDDTAARFEAYGWHVIRDINGHDADQINAAVNEAHKQSDKPTLIMC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAGLRS 312
           +TVIGFGSPN+AGT  VHG+ LG  EI ATR+AL W+  PF IP DI + W  R AG   
Sbjct: 244 KTVIGFGSPNKAGTEAVHGAPLGDAEIAATREALGWNYGPFEIPADIYQAWDAREAG--- 300

Query: 313 SQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            + +  W E+ ++   +   + KEFERR +  LP  FD          + +   IA+RK+
Sbjct: 301 KEKQHSWNEKFAAYAKAYPELAKEFERRMAGELPANFDAEAKKFIDNLQQNPANIASRKA 360

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           S+  LE     LPE +GGSADL  SN T  S  K +++ D +G Y+HYGVRE  M+A MN
Sbjct: 361 SQNALEAFGKVLPEFLGGSADLAPSNLTMWSGSKPLNE-DKAGNYIHYGVREFGMSAIMN 419

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           GIALH G  PY  TF++F +Y+R A+R+A+LM IR I V THDSIGLGEDGPTHQPVE L
Sbjct: 420 GIALHGGFVPYGATFLMFVEYARNAVRMAALMKIRSIFVYTHDSIGLGEDGPTHQPVEQL 479

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A+LR  P++   RP D +E+   W+ A++ K+ PS L  SRQNL       E       G
Sbjct: 480 ASLRVTPNMSTWRPCDQVESAVAWKYAIERKDGPSALIFSRQNLEQQPRTAEQLANIEKG 539

Query: 550 AY---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYR 606
           AY   D   TP  ++   ++GSE+++AV+A + L++     RVVS+P  + F +Q  +YR
Sbjct: 540 AYILKDCAGTP--ELIFIATGSEVELAVKAADQLTAEGRKVRVVSMPSTDAFDKQDAAYR 597

Query: 607 AQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGI 658
             ++ SS   ++AIEAG+   W  + G +G+ IGM  FG S   D+L++ FGI
Sbjct: 598 ESVLPSSVSARVAIEAGIADYWFKYTGLNGAIIGMHSFGESAPADVLFKEFGI 650


>gi|187931433|ref|YP_001891417.1| transketolase [Francisella tularensis subsp. mediasiatica FSC147]
 gi|187712342|gb|ACD30639.1| fusion protein of transketolase 1, tktA, and
           Glyceraldehyde-3-phosphate dehydrogenase, gapA
           [Francisella tularensis subsp. mediasiatica FSC147]
          Length = 1009

 Score =  617 bits (1590), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 318/661 (48%), Positives = 436/661 (65%), Gaps = 13/661 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA     SGHPG+PMGMAD+ T L+T+ +  +P  P+W NRDRFVLS 
Sbjct: 7   REFSNAIRFLSIDATLKAKSGHPGMPMGMADIATVLWTKFLKHNPNNPHWINRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L + +      +IDH+TYV +GDGCLMEG+S EA S AG LGL+KL+  WD
Sbjct: 126 VGMALGEKLLSDRYNTPDLKVIDHHTYVFLGDGCLMEGVSHEACSLAGTLGLNKLVAFWD 185

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +N ISIDG      S +   RFRA GW+ + +V+GHD  AI   + +A     KPT+I C
Sbjct: 186 DNNISIDGDTKGWFSDNTPERFRAYGWHVIENVDGHDFVAIEKAINEAHSQQQKPTLICC 245

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFGSP +AGT  VHGS L  +E  +  K LNWD   F IP D+ K W  A  +   
Sbjct: 246 KTVIGFGSPEKAGTASVHGSPLSDQERASAAKELNWDYQAFEIPQDVYKYWD-AREKGQA 304

Query: 315 TRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEHSKPM-IATRKSSEL 372
             A+WQ + +  K+S +  EFER  S  LP   ++A IN     + S P+ +ATRK+S++
Sbjct: 305 LEANWQGQWNLFKNSPKFDEFERVLSKELPVGLESA-INDYIASQLSNPVKVATRKASQM 363

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+   +PE+ GGSADLTGSN T  S    ++ +     YL YGVRE  MAA MNG++
Sbjct: 364 ALEVLCKNMPEMFGGSADLTGSNNTNWSGSVWLNNTQEGANYLSYGVREFGMAAIMNGLS 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G+ PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDGPTHQP+EH+ +L
Sbjct: 424 LYGGIKPYGGTFLVFSDYSRNAIRISALMKQPVVHVMSHDSIGLGEDGPTHQPIEHVPSL 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGAY 551
           R IP+L V RPAD+IET+  W+ A+K K+ PSV+ L+RQNL P ++TQ++  N+ A G Y
Sbjct: 484 RLIPNLSVWRPADTIETMIAWKEAVKSKDTPSVMVLTRQNLMPVVQTQHQVANI-ARGGY 542

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
                P+A++TI ++GSE+++AV+       + I   V S+PC E+F  Q+  Y+  +I 
Sbjct: 543 LVKDNPDAKLTIVATGSEVELAVKVANEFEKKGIKLNVASIPCVEVFATQAHEYKKTVIK 602

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIVDMVERK 670
                + +E      W  ++   G  + G+  FG S   + L++HFG     I ++V + 
Sbjct: 603 DDIPAVFVEMAQPDMWYKYMPKAGGEVKGIYSFGESAPAEDLFKHFGFTVENISNIVTKH 662

Query: 671 L 671
           +
Sbjct: 663 V 663


>gi|237747298|ref|ZP_04577778.1| transketolase [Oxalobacter formigenes HOxBLS]
 gi|229378649|gb|EEO28740.1| transketolase [Oxalobacter formigenes HOxBLS]
          Length = 665

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 323/659 (49%), Positives = 432/659 (65%), Gaps = 12/659 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           KMA+AIR L+MDA++  NSGHPG+PMGMAD+  AL++     +P  P+W NRDRF+LS G
Sbjct: 9   KMANAIRALAMDAVQKANSGHPGMPMGMADIAVALWSGHYRHNPANPHWFNRDRFILSNG 68

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YALL+L GY D+T+EDI+ FR   SKT GHPE     G++ TTGPLGQGI+NAV
Sbjct: 69  HGSMLQYALLHLTGY-DLTMEDIRQFRQFHSKTPGHPEVHVTPGVDTTTGPLGQGISNAV 127

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L EEF   G  ++DHYTYV +GDGCLMEG+S E+ S AG   L KLI L+D+
Sbjct: 128 GMALAEKLLAEEFNKPGFDIVDHYTYVFLGDGCLMEGVSHESCSLAGTWKLGKLIALYDD 187

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           N ISIDG +    + +   RF A GWN + +V+GHD  A+ + +  AQ SDKPT+I C+T
Sbjct: 188 NSISIDGNVKGWFTDNTPERFEAYGWNVIRNVDGHDVAAVDAAIIAAQKSDKPTLICCKT 247

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIG GSPN+AG NK HGS LG++EI ATRKA+ W+  PF IP+D+   W  A  + ++  
Sbjct: 248 VIGKGSPNKAGLNKAHGSPLGEDEIAATRKAIGWEYPPFEIPEDVYTAWD-ARKKGNELE 306

Query: 317 ADWQ---ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
           + W    E+ S       +E  RR S  +P  F+    N        K  IATRK+S+  
Sbjct: 307 SAWNSLFEKYSEKYPEEARELMRRISGEVPANFEEIVRNYIADCTAKKENIATRKASQNA 366

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           +E     LPE +GGSADLTGSN T   +  A+ +    G Y++YGVRE  M+A MNGI L
Sbjct: 367 IEAFAPALPEFLGGSADLTGSNLTNWKESVAVREGQ-PGNYINYGVREFGMSAIMNGIVL 425

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H G  P+ GTF+ FSDY R AIR++SLM I  I+V THDSIG+GEDGPTHQP+E +A+LR
Sbjct: 426 HGGFIPFGGTFLTFSDYCRNAIRMSSLMQIGTIYVFTHDSIGVGEDGPTHQPIEQIASLR 485

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYD 552
            IP L   RP D++ET   W  A+K++  PSVL LSRQNLP+  RTQ + +N+   GAY 
Sbjct: 486 LIPGLENWRPCDTVETAVAWGNAVKKRKIPSVLILSRQNLPYFERTQEQIDNINK-GAYV 544

Query: 553 YISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
               P+A+V + ++GSE+ +A+++ E L+ ++I  RVVS+P  ++F +Q   YR  ++  
Sbjct: 545 LKDAPDARVVLIATGSEVDLAMKSAEELARKSIPARVVSMPSADVFDKQDPLYRNSVLPK 604

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
              ++AIEAG    W  ++G DG  +GM  FG S    +L++HFG     +V  VE  L
Sbjct: 605 GLPRVAIEAGASDYWRKYVGLDGDVVGMTTFGESAPAGVLFKHFGFTVENVVSKVEAVL 663


>gi|90407567|ref|ZP_01215749.1| transketolase [Psychromonas sp. CNPT3]
 gi|90311377|gb|EAS39480.1| transketolase [Psychromonas sp. CNPT3]
          Length = 662

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 315/657 (47%), Positives = 432/657 (65%), Gaps = 15/657 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIR LSMDAI+  NSGHPG PMGMAD+   L+T  +  +P  P W +RDRF+LS 
Sbjct: 5   QELANAIRALSMDAIQKSNSGHPGAPMGMADIAQVLWTDFLKHNPTNPQWVDRDRFILSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IEDIK+FR + SKT GHPE G   G+E TTGPLGQG+ NA
Sbjct: 65  GHGSMLLYSLLHLSGY-DLSIEDIKSFRQLHSKTPGHPELGYTPGVETTTGPLGQGVTNA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L  +F   G  ++DH+TY  +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 124 VGMAIAEKSLAAQFNQAGHNIVDHHTYTFLGDGCLMEGISHEACSLAGTLGLGKLIAFWD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDKPTMIACE 255
           +NGISIDG +    + D  ARFRA GW+ +SV+GHD  A+T  +  A+  + KPTMI C+
Sbjct: 184 DNGISIDGNVEGWFTDDTPARFRAYGWHVISVDGHDAKALTDAIIAAKAETQKPTMICCK 243

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IGFGSP + GT+  HG+ LG +EI ATRKAL W    F IP+DI   W  A  +  Q 
Sbjct: 244 TIIGFGSPAKQGTHDCHGAPLGADEIIATRKALGWKYGDFEIPEDIYSAWN-AQQKGQQA 302

Query: 316 RADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
             DW  R ++   +   +  EF+RR ++ LP  ++       K+ + +   IATRK+S+ 
Sbjct: 303 EQDWNTRFAAYSEAYPELAAEFKRRTNEELPANWEEKSSAYIKQLQDAPTHIATRKASQN 362

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E     LPE++GGSADL  SN T  S  KAI+  D SG YLHYGVRE AM+A +NGIA
Sbjct: 363 CIEEFAKILPEMLGGSADLAPSNLTMWSGTKAITAEDASGNYLHYGVREFAMSAIINGIA 422

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LHKG  PY  TF++F +Y+R  +R+++LM  R I V THDSIGLGEDGPTHQPVE +A+L
Sbjct: 423 LHKGFVPYGATFLMFMEYARNGLRMSALMKKRAIQVFTHDSIGLGEDGPTHQPVEQMASL 482

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           R  P++ + RP D +E+   W+ A++  + P+ L  SRQNL   +   ++  L  +    
Sbjct: 483 RLTPNMDLWRPCDPVESAVAWKSAIERLDGPTCLIFSRQNLQ--QQPRDAAQLANVAKGG 540

Query: 553 YI---STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
           Y+   S   AQ+ + ++GSE+++AV+A   L+++  + RVVS+P  ++F +QSD Y+  +
Sbjct: 541 YVLLDSDKPAQIILIATGSEVQLAVDAYAELTAQGKAVRVVSIPSTDVFEQQSDEYKESV 600

Query: 610 IGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
           + S+  K +AIEAG+   W  ++G +G  IGM  FG S   D L++ FG     +V+
Sbjct: 601 LPSNISKRVAIEAGIADYWYKYVGLNGKVIGMTTFGESAPADQLFKMFGFTVENVVN 657


>gi|270308003|ref|YP_003330061.1| transketolase [Dehalococcoides sp. VS]
 gi|270153895|gb|ACZ61733.1| transketolase [Dehalococcoides sp. VS]
          Length = 666

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 315/660 (47%), Positives = 438/660 (66%), Gaps = 21/660 (3%)

Query: 24  DAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGS 83
           +A+RFLS+DA++  NSGHPG PMGMA +  AL+ + +  +PQ P WPNRDRF+LSAGH S
Sbjct: 12  NALRFLSVDAVQKANSGHPGAPMGMAAMAYALWQKFLKHNPQDPVWPNRDRFILSAGHAS 71

Query: 84  MLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMA 143
            L Y+LL+L GY D+ ++++KNFR  GSKT GHPEYG   G+E TTGPLGQG A+ VGMA
Sbjct: 72  ALLYSLLHLTGY-DLPLDELKNFRQWGSKTPGHPEYGLTPGVEMTTGPLGQGFASGVGMA 130

Query: 144 IAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           +AE  L   F      +IDHYTY +V DG LMEG++ EA S AGHL L KLI L+D+N I
Sbjct: 131 MAEAHLAAVFNQPDCKIIDHYTYGIVSDGDLMEGVASEAASLAGHLALGKLIYLYDDNEI 190

Query: 201 SIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQL-SDKPTMIACETVI 258
           SI+G   LA + +   RF + GW  +  V+G D  A++  +++AQ  S +P++I C+TVI
Sbjct: 191 SIEGSTELAFTENTALRFESYGWQVIGPVDGLDPEAVSVAIKEAQSDSARPSLIICKTVI 250

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSPN+AG    HG  LG +E+  +RK+L WD +PF IP + + ++R+A  +    +  
Sbjct: 251 GFGSPNKAGKASAHGEPLGTDEVAKSRKSLGWDYEPFVIPPEALAEFRMALDKGKTAQQV 310

Query: 319 WQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLE 375
           WQ +L    S   ++    + R S  LP+ +D    +L K F+ +   +A+R++S L++ 
Sbjct: 311 WQSKLDYYSSRYPEKAALLQDRLSGKLPEDWDK---DLDKLFDKA---MASREASGLIIN 364

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
            +   LP L+GGSADL+ SN T            + GR +H+GVREHAM A  NG+ALH 
Sbjct: 365 TLASRLPALMGGSADLSPSNKTVIKDGGEYEPPHYEGRNIHFGVREHAMGAIANGLALHG 424

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
           G+ PY  TF++F DY RPA+RLASLMG R+I++ THDSIGLGEDGPTHQP+E LA LR++
Sbjct: 425 GITPYVATFLIFYDYMRPAVRLASLMGQRIIYIFTHDSIGLGEDGPTHQPIEQLAGLRSV 484

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYDYI 554
           P L+ +RPADS ET + W++A+  KN P+ ++LSRQ LP L  +Q  S NL   GAY   
Sbjct: 485 PGLVTIRPADSYETAQAWKMAILRKNGPTAIALSRQKLPLLDNSQANSVNLSK-GAYILA 543

Query: 555 STPN-AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSS 613
            T +  QV + +SGSE+ IAV+A EIL ++ IS+RVVS P ++LF  Q  +YR  I+ +S
Sbjct: 544 ETDSRPQVALVASGSEVSIAVQAAEILKNKGISSRVVSFPSWQLFEAQPQTYRQSILPAS 603

Query: 614 PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
             ++ IEAG  QGW  ++G++G+ I +  FGAS    +LYQHFG+      +M E+ L +
Sbjct: 604 LPRVIIEAGSAQGWCKYLGANGALISIDHFGASAPVPVLYQHFGLTP---ENMAEKALKL 660


>gi|256823697|ref|YP_003147660.1| transketolase [Kangiella koreensis DSM 16069]
 gi|256797236|gb|ACV27892.1| transketolase [Kangiella koreensis DSM 16069]
          Length = 672

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 312/661 (47%), Positives = 427/661 (64%), Gaps = 12/661 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIR LSMDA++   SGHPG PMGMAD+   L+   +V +P  P W NRDRFV+S G
Sbjct: 13  QLANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWNDYLVHNPANPDWVNRDRFVMSNG 72

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y+LL+L GY D++I+D+KNFR + SKT GHPE+G   G+E TTGPLGQGIANAV
Sbjct: 73  HGSMLVYSLLHLTGY-DLSIDDLKNFRQLHSKTPGHPEFGYTPGVETTTGPLGQGIANAV 131

Query: 141 GMAIAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           G AIAE+KL  EF      +IDH+TYV +GDGC+MEGIS E  S AG LGL KL+  +D+
Sbjct: 132 GFAIAEKKLAAEFNKPDHDIIDHFTYVFMGDGCMMEGISHEVCSLAGTLGLGKLVAFYDD 191

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIACE 255
           NGISIDG +    S D   RF A GW  + +V+GHD  AI + + +A+  S++PT+I C+
Sbjct: 192 NGISIDGEVDGWFSDDTPKRFEAYGWQVIPAVDGHDPEAIKAAIEEARADSERPTLICCK 251

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IGFGSPN+ G  + HG+ LG +EI+  RK LNW    F +P+ I ++W  A     Q 
Sbjct: 252 TIIGFGSPNKQGKEECHGAPLGDDEIELARKQLNWPHPAFEVPESIREQWS-ARQVGQQQ 310

Query: 316 RADWQERLSSMKSSIRK---EFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            ADW ++  + K +  +   E ERR S  LP+ F         K +    ++A+RK+S++
Sbjct: 311 EADWNKKFIAYKEAFPELGSELERRLSRRLPEDFAEQAQAYIAKLQEEGQVVASRKASQM 370

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +      LPEL+GGSADL GSN T  SQ K I   D SG Y++YGVRE  M A MNG+A
Sbjct: 371 AINAYAPLLPELVGGSADLAGSNLTIHSQSKGIEAKDASGNYVYYGVREFGMCAIMNGMA 430

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           +H GL PY GTF++F +Y+R A+R+A+LM  + I+V THDSIGLGEDGPTHQP+E LA L
Sbjct: 431 IHGGLMPYGGTFLIFMEYARNALRMAALMKQQAIYVFTHDSIGLGEDGPTHQPIEQLANL 490

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           R  P++ V RP D++ET   W+VA++ +N P+ LSLSRQNL   +   E       G Y 
Sbjct: 491 RTTPNMSVWRPCDAVETAVAWKVAIERRNGPTALSLSRQNLQHQQRDAEQLASIERGGYV 550

Query: 553 YISTPNAQVTIF-SSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
            +   +    IF ++GSE+++A++A + LS +    RVVS+P  ++F  Q  SY+  ++ 
Sbjct: 551 LVDCTDKPELIFIATGSEVELAIQAAKELSGKGKQVRVVSMPSTDVFEAQDASYKEAVLP 610

Query: 612 SS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERK 670
           S  P ++AIEA +   W  ++G DG  +GM  FG S     L++HFG     +V + E  
Sbjct: 611 SDVPSRVAIEASIADYWYKYVGLDGRIVGMTSFGESAPAGDLFKHFGFTVDNVVAVAEEL 670

Query: 671 L 671
           L
Sbjct: 671 L 671


>gi|163746622|ref|ZP_02153980.1| transketolase [Oceanibulbus indolifex HEL-45]
 gi|161380507|gb|EDQ04918.1| transketolase [Oceanibulbus indolifex HEL-45]
          Length = 574

 Score =  615 bits (1586), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 291/572 (50%), Positives = 390/572 (68%), Gaps = 2/572 (0%)

Query: 10  VVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYW 69
             L + + D+   A AIR L++DA+   NSGH G+PMGMADV T LF + + FD   P W
Sbjct: 4   TALARANPDHWSKATAIRALTLDAVAAANSGHSGMPMGMADVATVLFEKHLKFDAANPLW 63

Query: 70  PNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATT 129
           P+RDRF+LSAGHGSML Y+LL+L GY+   IE++KNFR +G++TAGHPE      IE TT
Sbjct: 64  PDRDRFILSAGHGSMLIYSLLHLTGYEQFPIEELKNFRQMGARTAGHPENFLADAIETTT 123

Query: 130 GPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GPLGQGIAN+VG A+AE  LR ++G  ++DH+TYV+ GDGCLMEG+SQEAI+ AG   LS
Sbjct: 124 GPLGQGIANSVGFAMAEEMLRAQYGAKVVDHHTYVIAGDGCLMEGVSQEAITLAGRHKLS 183

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKP 249
           KLIV+WDNN I+IDGP+SL+D+TDQ ARF+A+ W+ + ++GH+   I + L +A+ SD P
Sbjct: 184 KLIVMWDNNNITIDGPVSLSDNTDQVARFKAAKWHVIEIDGHNPDEIDAALTEAKASDLP 243

Query: 250 TMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAG 309
           TMIAC+T I  G   +  T+K HG+    +++   +KA  W   PF +P D+   W   G
Sbjct: 244 TMIACKTHIALGHAAQ-DTSKGHGALTDADQMAEAKKAYGWTTGPFEVPADVKSAWEEIG 302

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            R +  R  W+ER   M  + R+ F R  +   P          KK+   + P IATR +
Sbjct: 303 KRGADVRRAWEERFDQMPRAKRETFNRALALDAPKKMSATIKAFKKQVSETAPKIATRAA 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           SE  LEV+N  LPE +GGSADLTGSN TKTS +      +  GRY+++G+REH MAAAMN
Sbjct: 363 SEKALEVLNPILPETVGGSADLTGSNNTKTSDLGVFDVDNRGGRYVYWGIREHGMAAAMN 422

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G+ PY GTFM F+DY+RP++RLA+LM +    V+THDSIGLGEDGPTHQPVEHL
Sbjct: 423 GMALHGGIRPYGGTFMCFTDYARPSMRLAALMQVPTAFVMTHDSIGLGEDGPTHQPVEHL 482

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A  R+ P+  V RPAD++ET E W++A   K  PSVLSL+RQ LP +R ++++NNL   G
Sbjct: 483 AISRSTPNTYVFRPADAVETAEAWEIAFTSKTTPSVLSLTRQGLPTVRLEHKNNNLTEKG 542

Query: 550 AYDYISTPNA-QVTIFSSGSELKIAVEACEIL 580
           AY         QV + ++GSE+ +A+ A ++L
Sbjct: 543 AYVLADAEGKRQVILIATGSEVHVALAARDLL 574


>gi|294338585|emb|CAZ86914.1| Transketolase 1 (TK 1) [Thiomonas sp. 3As]
          Length = 675

 Score =  615 bits (1586), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 313/652 (48%), Positives = 422/652 (64%), Gaps = 13/652 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIRFL++D ++  NSGHPG PMGMAD+   L+   +  +P  P+W NRDRFVLS 
Sbjct: 12  RRLANAIRFLAIDGVQAANSGHPGAPMGMADIAEVLWRNHLHHNPANPHWANRDRFVLSN 71

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY D+ IE++K FR + SKT GHPE G   G+E TTGPLGQGIAN 
Sbjct: 72  GHGSMLIYALLHLTGY-DLPIEELKRFRQLHSKTPGHPEVGYTPGVETTTGPLGQGIANG 130

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  +F   G  ++DH+TYV +GDGCLMEGIS E  S AG L L+KLI  +D
Sbjct: 131 VGMALAEKVLAAQFNQPGHAIVDHHTYVFLGDGCLMEGISHEVCSLAGTLKLNKLIAYYD 190

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLSDKPTMIACE 255
           +NGISIDG +    S +   RF+A GWN +  ++GHD  A+     +A+ SDKPT++ C 
Sbjct: 191 DNGISIDGHVEHWFSDNTAQRFQAYGWNVIGPIDGHDAVAVEKATAEAKTSDKPTLVICR 250

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T IG+GSPN+AGT+ VHG+ALGQ E  ATRKAL WD  PF IP DI + W  A    ++ 
Sbjct: 251 TTIGWGSPNKAGTHDVHGAALGQAEADATRKALGWDYGPFEIPADIYQAWD-AKFHGAKL 309

Query: 316 RADWQERLSSMK---SSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            ADW ER ++ +   S++  EF+RR +  LP  +      L  K        ATRKSS++
Sbjct: 310 EADWNERFAAYEKAHSALAAEFKRRMAGDLPADWGQTVQTLYAKAREVTAATATRKSSQI 369

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKS--DFSGRYLHYGVREHAMAAAMNG 430
            LE +   LP L GGSADLTGSN T      +  K+    +  YL YGVRE  M A MNG
Sbjct: 370 ALETLVPALPGLFGGSADLTGSNLTAVKASHSFEKAAPGTAFNYLSYGVREFGMVAMMNG 429

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           +ALH G  PY GTF++FSDYSR  +R+++LM  RVIHV +HDSIGLGEDGPTHQP+E  +
Sbjct: 430 MALHGGFLPYGGTFLMFSDYSRNGVRMSALMKQRVIHVFSHDSIGLGEDGPTHQPIEQPS 489

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
           +LR IP+L V RPAD +ET   W+ A++ K+ PS L LSRQNL       ++    + G 
Sbjct: 490 SLRLIPNLDVWRPADVLETAVAWKHAIERKHGPSALLLSRQNLVSTPHPEDAERTISRGG 549

Query: 551 Y--DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           Y          Q+ + ++GSE++IA++A  +L+ + ++ RVVS+PC   F  Q  +YR +
Sbjct: 550 YVLSEAQGGKPQIVLIATGSEVEIALKAQGMLAEQGVAARVVSMPCTNAFDRQDAAYRNE 609

Query: 609 IIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINA 660
           ++ +   ++AIEAG    W  ++G +G  +G+  FG S     LYQ+F + A
Sbjct: 610 VLPAGLPRVAIEAGHPDFWHKYVGLNGGIVGIATFGESAPAPQLYQYFKVTA 661


>gi|289209550|ref|YP_003461616.1| transketolase [Thioalkalivibrio sp. K90mix]
 gi|288945181|gb|ADC72880.1| transketolase [Thioalkalivibrio sp. K90mix]
          Length = 666

 Score =  615 bits (1585), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 310/653 (47%), Positives = 432/653 (66%), Gaps = 18/653 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIR LSMDA++  NSGHPG PMGMAD+   L+   M  +P  P+WP+RDRFV+S 
Sbjct: 5   RELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDYMQHNPANPHWPDRDRFVMSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ + ++++K FR + SKT GHPEYG   G+E TTGPLGQGI+NA
Sbjct: 65  GHGSMLIYSLLHLTGYE-LPMDELKQFRQLHSKTPGHPEYGYTPGVETTTGPLGQGISNA 123

Query: 140 VGMAIAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ +   F      ++DH+TY  +GDGC+MEG+S E+ + AG LGL KLI  WD
Sbjct: 124 VGMALAEKMMAAHFNQPEHDIVDHHTYAFLGDGCMMEGVSHESCALAGTLGLGKLIAFWD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKA-QLSDKPTMIAC 254
           +NGISIDG +    + D   RF A GW+ +  V+GHD  A+ + + +A Q SDKP++I C
Sbjct: 184 DNGISIDGEVEGWFTDDTPTRFEAYGWHVVRGVDGHDADAVKAAIEEARQNSDKPSLICC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
            TVIGFGSPN+ G  + HG+ALG +E+  TRK L W+  PF IP++I + W  A  + ++
Sbjct: 244 RTVIGFGSPNKCGKEECHGAALGDDEVALTRKELGWNHAPFEIPNEIYEGWS-AKDKGAK 302

Query: 315 TRADWQERLSSMKSS---IRKEFERRFSDALP-DCFDNAFINLKKKFEHSKPMIATRKSS 370
             ++W ER ++ K +   +  EFERR +  LP D  + A   +K+  E ++  +A+RK+S
Sbjct: 303 AESEWNERFAAYKQAHPELAAEFERRMAGDLPSDWSEKANAYIKETVEKAE-KVASRKAS 361

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           +  +  +   +PEL+GGSADL GSN T  S  K +S+ D +G Y++YGVRE  MAA MNG
Sbjct: 362 QNAIAGMAPAVPELLGGSADLAGSNLTMYSGSKGVSRDDAAGNYVYYGVREFGMAAIMNG 421

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           IALH G  PY GTF++FSDY+R  IR+++LMG RV++VLTHDSIGLGEDGPTHQP+E   
Sbjct: 422 IALHGGFIPYGGTFLIFSDYARNGIRMSALMGQRVMYVLTHDSIGLGEDGPTHQPIEQTP 481

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
           +LR IP+L V RP D++ET   W+  ++  + PS   LSRQ LP +    E     A G 
Sbjct: 482 SLRLIPNLNVWRPCDAVETAVAWKAGIERTDGPSAFILSRQGLPHMERDGEQLANIARGG 541

Query: 551 Y---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
           Y   D   TP+  +   ++GSE+++AV+A E L+      RVVS+PC ELF +Q  +YR 
Sbjct: 542 YILKDCDGTPD--LIFIATGSEVELAVKAAEELAGEGKKARVVSMPCVELFEQQDPAYRE 599

Query: 608 QIIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
            ++ ++  K +A+EAG   GW  F G DG+  GM  FG S     L+ +FG  
Sbjct: 600 AVLPAAVRKRVAVEAGATAGWYKFTGLDGAVFGMDRFGESAPGGALFDYFGFK 652


>gi|296134639|ref|YP_003641881.1| transketolase [Thiomonas intermedia K12]
 gi|295794761|gb|ADG29551.1| transketolase [Thiomonas intermedia K12]
          Length = 675

 Score =  614 bits (1584), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 313/652 (48%), Positives = 420/652 (64%), Gaps = 13/652 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIRFL++D ++  NSGHPG PMGMAD+   L+   +  +P  P+W NRDRFVLS 
Sbjct: 12  RRLANAIRFLAIDGVQAANSGHPGAPMGMADIAEVLWRNHLHHNPANPHWANRDRFVLSN 71

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY D+ IE++K FR + SKT GHPE G   G+E TTGPLGQGIAN 
Sbjct: 72  GHGSMLIYALLHLTGY-DLPIEELKRFRQLHSKTPGHPEVGYTPGVETTTGPLGQGIANG 130

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  +F   G  ++DH+TYV +GDGCLMEGIS E  S AG L L+KLI  +D
Sbjct: 131 VGMALAEKVLAAQFNQPGHAIVDHHTYVFLGDGCLMEGISHEVCSLAGTLKLNKLIAYYD 190

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLSDKPTMIACE 255
           +NGISIDG +    S +   RF+A GWN +  ++GHD  A+     +A+ SDKPT++ C 
Sbjct: 191 DNGISIDGHVEHWFSDNTAQRFQAYGWNVIGPIDGHDAVAVEKATAEAKTSDKPTLVICR 250

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T IG+GSPN+AGT+ VHG+ALGQ E  ATRKAL WD  PF IP DI + W  A    ++ 
Sbjct: 251 TTIGWGSPNKAGTHDVHGAALGQAEADATRKALGWDYGPFEIPADIYQAWD-AKFHGAKL 309

Query: 316 RADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            ADW ER ++ + +   +  EF+RR    LP  +      L  K        ATRKSS++
Sbjct: 310 EADWNERFAAYEKAHPALAAEFKRRMVGDLPADWGQTVQTLYAKAREVTAATATRKSSQI 369

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKS--DFSGRYLHYGVREHAMAAAMNG 430
            LE +   LP L GGSADLTGSN T      +  K+    +  YL YGVRE  M A MNG
Sbjct: 370 ALETLVPALPGLFGGSADLTGSNLTAVKASHSFEKAAPGTAFNYLSYGVREFGMVAMMNG 429

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           +ALH G  PY GTF++FSDYSR  +R+++LM  RVIHV +HDSIGLGEDGPTHQP+E  +
Sbjct: 430 MALHGGFLPYGGTFLMFSDYSRNGVRMSALMKQRVIHVFSHDSIGLGEDGPTHQPIEQPS 489

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
           +LR IP+L V RPAD +ET   W+ A++ K+ PS L LSRQNL       ++    + G 
Sbjct: 490 SLRLIPNLDVWRPADVLETAVAWKHAIERKHGPSALLLSRQNLVSTPHPEDAERTISRGG 549

Query: 551 Y--DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           Y          Q+ + ++GSE++IA++A  +L+ + ++ RVVS+PC   F  Q  +YR +
Sbjct: 550 YVLSEAQGGKPQIVLIATGSEVEIALKAQGMLAEQGVAARVVSMPCTNAFDRQDAAYRNE 609

Query: 609 IIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINA 660
           ++ +   ++AIEAG    W  ++G +G  +G+  FG S     LYQHF + A
Sbjct: 610 VLPAGLPRVAIEAGHPDFWHKYVGLNGGIVGIATFGESAPAPQLYQHFKVTA 661


>gi|326319293|ref|YP_004236965.1| transketolase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323376129|gb|ADX48398.1| transketolase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 695

 Score =  614 bits (1584), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 332/687 (48%), Positives = 438/687 (63%), Gaps = 48/687 (6%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++MA+AIR L+MDA++  NSGHPG PMGMAD+  AL+++ +  +P  P W +RDRFVLS 
Sbjct: 5   QQMANAIRALAMDAVQQANSGHPGAPMGMADMAVALWSRHLRHNPANPQWADRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY D+ IE++KNFR + SKTAGHPEYG   G+E TTGPLGQGI NA
Sbjct: 65  GHGSMLLYALLHLTGY-DLPIEELKNFRQLHSKTAGHPEYGITPGVETTTGPLGQGITNA 123

Query: 140 VGMAIAERKLREEF----GDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           VG A+AE+ L  EF    GDV   ++DH+TYV +GDGCLMEGISQEAIS AG   L KLI
Sbjct: 124 VGFALAEKLLAREFNRRNGDVDHTIVDHHTYVFLGDGCLMEGISQEAISLAGAWKLGKLI 183

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLS-DKPT 250
            L+D+NGISIDG ++     D   RFRASGWN +  V+GHD  A+ + ++ A+ S DKPT
Sbjct: 184 ALYDDNGISIDGQVAPWFVDDTPGRFRASGWNVIGPVDGHDVEAVAAAVQSAKTSTDKPT 243

Query: 251 MIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLA 308
           +I C+T IG GSPNRAGT+K HG  LG +EI  TR A+ W   PF IP ++   W  R A
Sbjct: 244 LIVCKTAIGKGSPNRAGTSKAHGEPLGADEITLTRNAIGWSHVPFEIPAEVYADWNARDA 303

Query: 309 GLRSSQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIA 365
           G   +Q  +DWQ+R  +  ++   +  EF RR +  LP  F    ++           +A
Sbjct: 304 G---AQAESDWQQRFDAYAAAYPELAAEFLRRMAGDLPRHFAQTAVDTVVNAHTKAETVA 360

Query: 366 TRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAI------------------SK 407
           +RK+S+L LE     LPEL+GGSADLTGSN T T    A+                    
Sbjct: 361 SRKASQLALEAFTAALPELLGGSADLTGSNLTNTKSTPALRFDENGDVVQVEVNTGGAET 420

Query: 408 SDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIH 467
           +   GR+++YGVRE  MAA MNGIALH G  PY GTF+ FSDYSR AIR+A+LM +RV+H
Sbjct: 421 AKLGGRHINYGVREFGMAAIMNGIALHGGFIPYGGTFLTFSDYSRNAIRMAALMKLRVVH 480

Query: 468 VLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLS 527
           V THDSIGLGEDGPTHQ +EH A+LR IP L V RPAD+ ET   W VAL  +NRP+ L 
Sbjct: 481 VFTHDSIGLGEDGPTHQSIEHAASLRLIPGLDVWRPADTAETAVAWSVALSNRNRPTALL 540

Query: 528 LSRQNLPFLRTQYESNNLCALGAYDYISTP-------NAQVTIFSSGSELKIAVEACEIL 580
           LSRQNL +   +   +   + GAY  +S P        AQ  I ++GSE+++A+ A ++L
Sbjct: 541 LSRQNLAYAPKRDLGD--ISRGAY-VLSEPADAGIKKKAQAVIIATGSEVQLALAAQKLL 597

Query: 581 SSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGM 640
           + + I+ RVVS+P    F  +   Y+A ++ +   +IA+E G+  GW  +     + +G+
Sbjct: 598 AEKKIAARVVSMPSTTTFDREDTKYKASVLPAGVPRIAVEMGVTDGWWKY--GCAAVVGI 655

Query: 641 QGFGASGSCDLLYQHFGINAIAIVDMV 667
             FG S    +L++HFG     + D V
Sbjct: 656 DTFGESAPAPVLFKHFGFTPENVADSV 682


>gi|118497912|ref|YP_898962.1| transketolase [Francisella tularensis subsp. novicida U112]
 gi|194323134|ref|ZP_03056918.1| transketolase [Francisella tularensis subsp. novicida FTE]
 gi|118423818|gb|ABK90208.1| transketolase I [Francisella novicida U112]
 gi|194322498|gb|EDX19978.1| transketolase [Francisella tularensis subsp. novicida FTE]
          Length = 663

 Score =  614 bits (1583), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 316/659 (47%), Positives = 435/659 (66%), Gaps = 13/659 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA     SGHPG+PMGMAD+ T L+T+ +  +P  P+W NRDRFVLS 
Sbjct: 7   REFSNAIRFLSIDATLKAKSGHPGMPMGMADIATVLWTKFLKHNPNNPHWINRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L + +      +IDH+TYV +GDGCLMEG+S EA S AG LGL+KL+  WD
Sbjct: 126 VGMALGEKLLSDRYNTPDLKVIDHHTYVFLGDGCLMEGVSHEACSLAGTLGLNKLVAFWD 185

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +N ISIDG      S +   RFRA GW+ + +V+GHD  AI   + +A     KPT+I C
Sbjct: 186 DNNISIDGDTKGWFSDNTPERFRAYGWHVIENVDGHDFVAIEKAINEAHSQQQKPTLICC 245

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFGSP +AGT  VHGS L ++E  +  K LNW+   F IP D+ K W  A  +   
Sbjct: 246 KTVIGFGSPEKAGTASVHGSPLSEQERASAAKELNWNYQAFEIPQDVYKYWD-AREKGQA 304

Query: 315 TRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEHSKPM-IATRKSSEL 372
             A+WQ + +  K S +  EFER  S  LP   ++A IN     + S P+ +ATRK+S++
Sbjct: 305 LEANWQGQWNLFKDSPKFDEFERVLSKELPVGLESA-INDYIASQLSNPVKVATRKASQM 363

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+   +PE+ GGSADLTGSN T  S    ++ +     YL YGVRE  MAA MNG++
Sbjct: 364 ALEVLCKNMPEMFGGSADLTGSNNTNWSGSVWLNNTQEGANYLSYGVREFGMAAIMNGLS 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G+ PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDGPTHQP+EH+ +L
Sbjct: 424 LYGGIKPYGGTFLVFSDYSRNAIRMSALMKQPVVHVMSHDSIGLGEDGPTHQPIEHVPSL 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGAY 551
           R IP+L V RPAD++ET+  W+ A+K K+ PSV+ L+RQNL P ++TQ++  N+ A G Y
Sbjct: 484 RLIPNLNVWRPADTVETMIAWKEAVKSKDTPSVMVLTRQNLIPVVQTQHQVANI-ARGGY 542

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
                P+A++TI ++GSE+++AV+       + I   V S+PC E+F  Q+  Y+  +I 
Sbjct: 543 LVKDNPDAKLTIVATGSEVELAVKVANEFEKKGIKLNVASIPCVEVFATQAQEYKKTVIK 602

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
                + +E      W  ++   G  + G+  FG S   + L++HFG     I ++V +
Sbjct: 603 DDIPAVFVEMAQPDMWYKYMPKAGGEVKGIYSFGESAPAEDLFKHFGFTVENISNIVAK 661


>gi|152980222|ref|YP_001352521.1| transketolase [Janthinobacterium sp. Marseille]
 gi|151280299|gb|ABR88709.1| transketolase [Janthinobacterium sp. Marseille]
          Length = 664

 Score =  614 bits (1583), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 312/659 (47%), Positives = 430/659 (65%), Gaps = 10/659 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           KMA+AIR L+MDA++  NSGHPG+PMGMAD+  AL+      +P  P W NRDRFVLS G
Sbjct: 9   KMANAIRALAMDAVQKANSGHPGMPMGMADIAVALWANHYSHNPANPKWVNRDRFVLSNG 68

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML+YALL+L GY D+++++I+NFR + SKT GHPE     GIE TTGPLGQGI NAV
Sbjct: 69  HGSMLHYALLHLTGY-DLSMDEIRNFRQLHSKTPGHPEVDITPGIETTTGPLGQGITNAV 127

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  +++H+TYV +GDGCLMEGIS EA S AG L LSKLI L+D+
Sbjct: 128 GMALAEKLLAAEFNRPGFDVVNHHTYVFLGDGCLMEGISHEACSLAGTLRLSKLIALYDD 187

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           NGISIDG +    + D   RF + GWN + +V+GHD +A+ + +++A+ SDKPT+I C T
Sbjct: 188 NGISIDGHVEGWFTDDTPKRFESYGWNVIRAVDGHDVNAVDAAIKQAKSSDKPTLICCRT 247

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIG GSPN  GT+ VHG+ALG +EI ATR+A+ W   PF +P D+   W  A  +     
Sbjct: 248 VIGKGSPNMEGTHNVHGAALGDKEIAATREAVGWTYAPFDVPADVYAAWD-AKEKGQALE 306

Query: 317 ADWQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
           ++W   L S      +E     RR +  LP   + A           K  IATRK+S+  
Sbjct: 307 SNWDTLLKSYSEKFPQEAAELARRMAGELPGDLNKAVDAYIAACVEKKETIATRKASQNA 366

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           ++ +   LPE +GGSADLTGSN T   +  A+ ++D +G +++YGVRE  M+A MNGIAL
Sbjct: 367 IQALAPVLPEFLGGSADLTGSNLTNWKECVAV-RADQAGNHINYGVREFGMSAIMNGIAL 425

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H G  P+  TF+ FSDYSR A+R+A+LM +R I V THDSIGLGEDGPTHQ VEH+++LR
Sbjct: 426 HGGYIPFGATFLTFSDYSRNALRMAALMKLRSIFVFTHDSIGLGEDGPTHQSVEHVSSLR 485

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY 553
            IP+L   RP D++E+   W+ A+K K+ PS L  SRQNLPF     E       G Y  
Sbjct: 486 LIPNLDNWRPCDTVESAVAWEQAVKRKDGPSTLIFSRQNLPFQERTAEQIANIKRGGYVL 545

Query: 554 ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSS 613
              PNA+  + ++GSE+++A +A + LS   ++ R+VS+P  ++F  Q  +Y+A ++   
Sbjct: 546 RDAPNAKAILIATGSEIELATKAADELSKHGVAVRIVSMPSTDVFDRQDAAYKAGVLTKG 605

Query: 614 PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
             ++AIEAG+   W  ++G +G  IG+  FG S    +L++HFG     ++  V++ L+
Sbjct: 606 VPRVAIEAGVTSFWYKYVGLEGGVIGIDTFGESAPAGVLFKHFGFTVENVIAAVKKTLA 664


>gi|170740957|ref|YP_001769612.1| transketolase [Methylobacterium sp. 4-46]
 gi|168195231|gb|ACA17178.1| transketolase [Methylobacterium sp. 4-46]
          Length = 659

 Score =  614 bits (1583), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 308/654 (47%), Positives = 426/654 (65%), Gaps = 4/654 (0%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MADA+RFL++DAI     GHPG P+G A++ TALFT+ +V +P  P WPNRDRFVLS G
Sbjct: 7   RMADAVRFLALDAIARAGDGHPGAPLGCAEIATALFTRHLVCNPDDPEWPNRDRFVLSNG 66

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YA L+L GY  ++IE I+ FR +GS   GHPEY    GIEATTGPLGQGIANAV
Sbjct: 67  HGSMLLYAALHLAGYAAISIEAIRGFRELGSPCHGHPEYAPRHGIEATTGPLGQGIANAV 126

Query: 141 GMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           GMA+AE KL  EFG  L+DH TY LVGDGCL EGI+ E +S AGHL L KL  LWD+N I
Sbjct: 127 GMAVAEAKLAAEFGPDLVDHRTYALVGDGCLQEGIAHEVVSLAGHLRLGKLTFLWDDNRI 186

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGF 260
           + DG   L+ S D  ARFRA+ W  +  +GHD  A+++ L  A+   +P++IAC TVIG 
Sbjct: 187 TDDGSTDLSISEDVRARFRAADWQVIDCDGHDVEAVSAALLLARGDPRPSLIACRTVIGR 246

Query: 261 GSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR-ADW 319
           G P   G    HG  + + +    R A  WD   F +P+D+   WR      ++   A W
Sbjct: 247 GLPRLEGQRGAHGGRVFESDCAEARAARAWDHPAFAVPEDVAAAWRAGAGARNRAAYAAW 306

Query: 320 QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVND 379
           Q   +++  + R EF+RR +  LP  +    + L++ +  + P   T + +  +L  + +
Sbjct: 307 QASRAALPEARRAEFDRRMAGRLPPSWRETLLALRRHWSETAPERPTIEVAADILAALAE 366

Query: 380 CLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAP 439
            +P+L  G+ DL G    K  ++ A + ++ +GRYLHYG+REHAM A MNG+A H+GL P
Sbjct: 367 TVPDLFSGAPDLEGPTRHK-QRLAAFTATERAGRYLHYGIREHAMGAMMNGMAAHRGLIP 425

Query: 440 YSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLL 499
              T++VFSDY RPA+R+A+LM + VI V +HDSIG+G +GPTHQPVE LA+LRAIP++L
Sbjct: 426 VGATYLVFSDYLRPALRMAALMELPVITVYSHDSIGIGRNGPTHQPVEFLASLRAIPNML 485

Query: 500 VLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNA 559
           VLRPAD++ET E W++AL  ++ P+ L  SRQ LP LR +  + NL A GAY        
Sbjct: 486 VLRPADAVETAEAWEMALAHRDGPTSLICSRQPLPALRREAGAENLSARGAYLLAPATGG 545

Query: 560 --QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             +VT+  +GSE+ +A+ A   L +  I T VVS+P +E F  Q ++YR ++I    +++
Sbjct: 546 RRRVTLVGTGSEVAVALAARAALQAEGIPTAVVSMPSWEAFAAQPETYRREVIPRDTVRV 605

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           A+EA +R GW+ +IG +G F+GM GFGASG  + L++HFGI   A++  V  +L
Sbjct: 606 AVEAAIRLGWERWIGEEGGFVGMTGFGASGPGEELFRHFGITPEAVLREVRARL 659


>gi|57234552|ref|YP_181420.1| transketolase [Dehalococcoides ethenogenes 195]
 gi|57234617|ref|YP_181386.1| transketolase [Dehalococcoides ethenogenes 195]
 gi|57225000|gb|AAW40057.1| transketolase [Dehalococcoides ethenogenes 195]
 gi|57225065|gb|AAW40122.1| transketolase [Dehalococcoides ethenogenes 195]
          Length = 666

 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 315/660 (47%), Positives = 436/660 (66%), Gaps = 21/660 (3%)

Query: 24  DAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGS 83
           +A+RFL++DA++  NSGHPG PMGMA +  AL+   +  +PQ P WPNRDRF+LSAGH S
Sbjct: 12  NALRFLAVDAVQKANSGHPGAPMGMAAMAYALWQNFLKHNPQDPAWPNRDRFILSAGHAS 71

Query: 84  MLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMA 143
            L Y+LL+L GY D+ ++++KNFR  GSKT GHPEYG   G+E TTGPLGQG A+ VGMA
Sbjct: 72  ALLYSLLHLTGY-DLPLDELKNFRQWGSKTPGHPEYGLTPGVEMTTGPLGQGFASGVGMA 130

Query: 144 IAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           +AE  L   F      +IDHYTY +V DG LMEG++ EA S AGHL L KLI L+D+N I
Sbjct: 131 MAEAHLAAVFNQPDCKIIDHYTYGIVSDGDLMEGVASEAASLAGHLALGKLIYLYDDNEI 190

Query: 201 SIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQL-SDKPTMIACETVI 258
           SI+G   LA + +   RF + GW  +  V+G +  A++  +++AQ  S +P++I C+TVI
Sbjct: 191 SIEGSTELAFTENTALRFESYGWQVIGPVDGLNPEAVSGAIKEAQSDSARPSLIICKTVI 250

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSPN+AG    HG  LG +E+  +RK+L WD +PF IP + + ++R+A  +    +  
Sbjct: 251 GFGSPNKAGKASAHGEPLGTDEVAKSRKSLGWDYEPFVIPPEALAEFRMALDKGKTAQQV 310

Query: 319 WQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLE 375
           WQ +L    S   ++    + R S  LPD +DN    L K F+ +   +A+R++S L++ 
Sbjct: 311 WQSKLDYYSSRYPEKAALLQDRLSGKLPDNWDN---ELDKLFDKA---MASREASGLIIN 364

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
            +   LP L+GGSADL+ SN T            + GR +H+GVREHAM A  NG+ALH 
Sbjct: 365 TLASRLPALMGGSADLSPSNKTVIKDGGEYEPPHYEGRNIHFGVREHAMGAIANGLALHG 424

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
           G+ PY  TF++F DY RPA+RLASLMG RVI++ THDSIGLGEDGPTHQP+E LA LR++
Sbjct: 425 GIIPYVATFLIFYDYMRPAVRLASLMGQRVIYIFTHDSIGLGEDGPTHQPIEQLAGLRSV 484

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYDYI 554
           P L+ +RPADS ET + W+ A+  K+ P+ ++LSRQ LP L  +Q  S NL A GAY   
Sbjct: 485 PGLVTIRPADSYETAQAWKTAILRKDGPTAIALSRQKLPLLDNSQANSVNL-AKGAYILA 543

Query: 555 STPN-AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSS 613
            T +  QV + +SGSE+ IAV+A EIL ++ +S+RVVS P ++LF  Q  +YR  I+ +S
Sbjct: 544 ETDSRPQVALVASGSEVSIAVQAAEILKNKGVSSRVVSFPSWQLFEAQPRTYRQSILPAS 603

Query: 614 PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
             ++ IEAG  QGW  ++G++G  I +  FGAS    +LYQHFG+      +M E+ L +
Sbjct: 604 LPRVIIEAGSAQGWCKYLGANGDIISIDHFGASAPAPVLYQHFGLTP---ENMAEKALKL 660


>gi|208779680|ref|ZP_03247025.1| transketolase [Francisella novicida FTG]
 gi|208744641|gb|EDZ90940.1| transketolase [Francisella novicida FTG]
          Length = 663

 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 316/659 (47%), Positives = 435/659 (66%), Gaps = 13/659 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA     SGHPG+PMGMAD+ T L+T+ +  +P  P+W NRDRFVLS 
Sbjct: 7   REFSNAIRFLSIDATLKAKSGHPGMPMGMADIATVLWTKFLKHNPNNPHWINRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L + +      +IDH+TYV +GDGCLMEG+S EA S AG LGL+KL+  WD
Sbjct: 126 VGMALGEKLLSDRYNTPDLKVIDHHTYVFLGDGCLMEGVSHEACSLAGTLGLNKLVAFWD 185

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKA-QLSDKPTMIAC 254
           +N ISIDG      S +   RFRA GW+ + +V+GHD  AI   + +A     KPT+I C
Sbjct: 186 DNNISIDGDTKGWFSDNTPERFRAYGWHVIENVDGHDFVAIEKAINEAYSQQQKPTLICC 245

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFGSP +AGT  VHGS L ++E  +  K LNW+   F IP D+ K W  A  +   
Sbjct: 246 KTVIGFGSPEKAGTASVHGSPLSEQERASAAKELNWNYQAFEIPQDVYKYWD-AREKGQA 304

Query: 315 TRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEHSKPM-IATRKSSEL 372
             A+WQ + +  K S +  EFER  S  LP   ++A IN     + S P+ +ATRK+S++
Sbjct: 305 LEANWQGQWNLFKDSPKFDEFERVLSKELPVGLESA-INDYIASQLSNPVKVATRKASQM 363

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+   +PE+ GGSADLTGSN T  S    ++ +     YL YGVRE  MAA MNG++
Sbjct: 364 ALEVLCKNMPEMFGGSADLTGSNNTNWSGSVWLNNTQEGANYLSYGVREFGMAAIMNGLS 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G+ PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDGPTHQP+EH+ +L
Sbjct: 424 LYGGIKPYGGTFLVFSDYSRNAIRMSALMKQPVVHVMSHDSIGLGEDGPTHQPIEHVPSL 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGAY 551
           R IP+L V RPAD++ET+  W+ A+K K+ PSV+ L+RQNL P ++TQ++  N+ A G Y
Sbjct: 484 RLIPNLNVWRPADTVETMIAWKEAVKSKDTPSVMVLTRQNLMPVVQTQHQVANI-ARGGY 542

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
                P+A++TI ++GSE+++AV+       + I   V S+PC E+F  Q+  Y+  +I 
Sbjct: 543 LVKDNPDAKLTIVATGSEVELAVKVANEFEKKGIKLNVASIPCVEVFATQAQEYKKTVIK 602

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
                + +E      W  ++   G  + G+  FG S   + L++HFG     I ++V +
Sbjct: 603 DDIPAVFVEMAQPDMWYKYMPKAGGEVKGIYSFGESAPAEDLFKHFGFTVENISNIVAK 661


>gi|56708422|ref|YP_170318.1| transketolase [Francisella tularensis subsp. tularensis SCHU S4]
 gi|110670893|ref|YP_667450.1| transketolase [Francisella tularensis subsp. tularensis FSC198]
 gi|254371048|ref|ZP_04987050.1| transketolase [Francisella tularensis subsp. tularensis FSC033]
 gi|56604914|emb|CAG46002.1| Transketolase [Francisella tularensis subsp. tularensis SCHU S4]
 gi|110321226|emb|CAL09385.1| Transketolase [Francisella tularensis subsp. tularensis FSC198]
 gi|151569288|gb|EDN34942.1| transketolase [Francisella tularensis subsp. tularensis FSC033]
 gi|282159611|gb|ADA79002.1| transketolase [Francisella tularensis subsp. tularensis NE061598]
          Length = 663

 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 318/659 (48%), Positives = 434/659 (65%), Gaps = 13/659 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA     SGHPG+PMGMAD+ T L+T+ +  +P  P+W NRDRFVLS 
Sbjct: 7   REFSNAIRFLSIDATLKAKSGHPGMPMGMADIATVLWTKFLKHNPNNPHWINRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L + +      +IDH+TYV +GDGCLMEG+S EA S AG LGL+KL+  WD
Sbjct: 126 VGMALGEKLLSDRYNTPDLKVIDHHTYVFLGDGCLMEGVSHEACSLAGTLGLNKLVAFWD 185

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +N ISIDG      S +   RFRA GW+ + +V+GHD  AI   + +A     KPT+I C
Sbjct: 186 DNNISIDGDTKGWFSDNTPERFRAYGWHVIENVDGHDFVAIEKAINEAHSQQQKPTLICC 245

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFGSP +AGT  VHGS L  +E  +  K LNWD   F IP D+ K W  A  +   
Sbjct: 246 KTVIGFGSPEKAGTASVHGSPLSDQERASAAKELNWDYQAFEIPQDVYKYWD-AREKGQA 304

Query: 315 TRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEHSKPM-IATRKSSEL 372
             A+WQ + +  K S +  EFER  S  LP   ++A IN     + S P+ +ATRK+S++
Sbjct: 305 LEANWQGQWNLFKDSPKFDEFERVLSKELPVGLESA-INDYIASQLSNPVKVATRKASQM 363

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
           VLEV+   +PE+ GGSADLTGSN T  S    ++ +     YL YGVRE  MAA MNG++
Sbjct: 364 VLEVLCKNMPEMFGGSADLTGSNNTNWSGSVWLNNTQEGANYLSYGVREFGMAAIMNGLS 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G+ PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDGPTHQP+EH+ +L
Sbjct: 424 LYGGIKPYGGTFLVFSDYSRNAIRMSALMKQPVVHVMSHDSIGLGEDGPTHQPIEHVPSL 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGAY 551
           R IP+L V RPAD+IET+  W+ A+K K+ PSV+ L+RQNL P ++TQ++  N+ A G Y
Sbjct: 484 RLIPNLSVWRPADTIETMIAWKEAVKSKDTPSVMVLTRQNLMPVVQTQHQVANI-ARGGY 542

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
                P+A++TI ++GSE+++AV+       + I   V S+PC E+F  Q+  Y+  +I 
Sbjct: 543 LVKDNPDAKLTIVATGSEVELAVKVANEFEKKGIKLNVASIPCVEVFATQAHEYKKTVIK 602

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
                + +E      W  ++   G  + G+  FG S   + L++ FG     I ++V +
Sbjct: 603 DDIPAVFVEMAQPDMWYKYMPKAGGEVKGIYSFGESAPAEDLFKRFGFTVENISNIVAK 661


>gi|115314904|ref|YP_763627.1| transketolase [Francisella tularensis subsp. holarctica OSU18]
 gi|115129803|gb|ABI82990.1| transketolase [Francisella tularensis subsp. holarctica OSU18]
          Length = 663

 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 317/659 (48%), Positives = 434/659 (65%), Gaps = 13/659 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA     SGHPG+PMGMAD+ T L+T+ +  +P  P+W NRDRFVLS 
Sbjct: 7   REFSNAIRFLSIDATLKAKSGHPGMPMGMADIATVLWTKFLKHNPNNPHWINRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYMPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L + +      +IDH+TYV +GDGCLMEG+S EA S AG LGL+KL+  WD
Sbjct: 126 VGMALGEKLLSDRYNTPDLKVIDHHTYVFLGDGCLMEGVSHEACSLAGTLGLNKLVAFWD 185

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +N ISIDG      S +   RFRA GW+ + +V+GH+  AI   + +A     KPT+I C
Sbjct: 186 DNNISIDGDTKGWFSDNTPERFRAYGWHVIENVDGHEFVAIEKAINEAHSQQQKPTLICC 245

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFGSP +AGT  VHGS L  +E  +  K LNWD   F IP D+ K W  A  +   
Sbjct: 246 KTVIGFGSPEKAGTASVHGSPLSDQERASAAKELNWDYQAFEIPQDVYKYWD-AREKGQA 304

Query: 315 TRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEHSKPM-IATRKSSEL 372
             A+WQ + +  K S +  EFER  S  LP   ++A IN     + S P+ +ATRK+S++
Sbjct: 305 LEANWQGQWNLFKDSPKFDEFERVLSKELPVGLESA-INDYIASQLSNPVKVATRKASQM 363

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+   +PE+ GGSADLTGSN T  S    ++ +     YL YGVRE  MAA MNG++
Sbjct: 364 ALEVLCKNMPEMFGGSADLTGSNNTNWSGSVWLNNTQEGANYLSYGVREFGMAAIMNGLS 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G+ PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDGPTHQP+EH+ +L
Sbjct: 424 LYGGIKPYGGTFLVFSDYSRNAIRMSALMKQPVVHVMSHDSIGLGEDGPTHQPIEHVPSL 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGAY 551
           R IP+L V RPAD+IET+  W+ A+K K+ PSV+ L+RQNL P ++TQ++  N+ A G Y
Sbjct: 484 RLIPNLSVWRPADTIETMIAWKEAVKSKDTPSVMVLTRQNLMPVVQTQHQVANI-AKGGY 542

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
                P+A++TI ++GSE+++AV+       + I   V S+PC E+F  Q+  Y+  +I 
Sbjct: 543 LVKDNPDAKLTIVATGSEVELAVKVANEFEKKGIKLNVASIPCVEVFATQAHEYKKTVIK 602

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
                + +E      W  ++   G  + G+  FG S   + L++HFG     I ++V +
Sbjct: 603 DDIPAVFVEMAQPDMWYKYMPKAGGEVKGIYSFGESAPVEDLFKHFGFTVENISNIVAK 661


>gi|89256469|ref|YP_513831.1| transketolase [Francisella tularensis subsp. holarctica LVS]
 gi|156502575|ref|YP_001428640.1| transketolase [Francisella tularensis subsp. holarctica FTNF002-00]
 gi|167010389|ref|ZP_02275320.1| transketolase [Francisella tularensis subsp. holarctica FSC200]
 gi|254367803|ref|ZP_04983824.1| transketolase [Francisella tularensis subsp. holarctica 257]
 gi|254368905|ref|ZP_04984918.1| transketolase [Francisella tularensis subsp. holarctica FSC022]
 gi|290953021|ref|ZP_06557642.1| transketolase [Francisella tularensis subsp. holarctica URFT1]
 gi|295313787|ref|ZP_06804361.1| transketolase [Francisella tularensis subsp. holarctica URFT1]
 gi|89144300|emb|CAJ79584.1| Transketolase [Francisella tularensis subsp. holarctica LVS]
 gi|134253614|gb|EBA52708.1| transketolase [Francisella tularensis subsp. holarctica 257]
 gi|156253178|gb|ABU61684.1| transketolase [Francisella tularensis subsp. holarctica FTNF002-00]
 gi|157121826|gb|EDO65996.1| transketolase [Francisella tularensis subsp. holarctica FSC022]
          Length = 663

 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 317/659 (48%), Positives = 434/659 (65%), Gaps = 13/659 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA     SGHPG+PMGMAD+ T L+T+ +  +P  P+W NRDRFVLS 
Sbjct: 7   REFSNAIRFLSIDATLKAKSGHPGMPMGMADIATVLWTKFLKHNPNNPHWINRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYMPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L + +      +IDH+TYV +GDGCLMEG+S EA S AG LGL+KL+  WD
Sbjct: 126 VGMALGEKLLSDRYNTPDLKVIDHHTYVFLGDGCLMEGVSHEACSLAGTLGLNKLVAFWD 185

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +N ISIDG      S +   RFRA GW+ + +V+GH+  AI   + +A     KPT+I C
Sbjct: 186 DNNISIDGDTKGWFSDNTPERFRAYGWHVIENVDGHEFVAIEKAINEAHSQQQKPTLICC 245

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFGSP +AGT  VHGS L  +E  +  K LNWD   F IP D+ K W  A  +   
Sbjct: 246 KTVIGFGSPEKAGTASVHGSPLSDQERASAAKELNWDYQAFEIPQDVYKYWD-AREKGQA 304

Query: 315 TRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEHSKPM-IATRKSSEL 372
             A+WQ + +  K S +  EFER  S  LP   ++A IN     + S P+ +ATRK+S++
Sbjct: 305 LEANWQGQWNLFKDSPKFDEFERVLSKELPVGLESA-INDYIASQLSNPVKVATRKASQM 363

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+   +PE+ GGSADLTGSN T  S    ++ +     YL YGVRE  MAA MNG++
Sbjct: 364 ALEVLCKNMPEMFGGSADLTGSNNTNWSGSVWLNNTQEGANYLSYGVREFGMAAIMNGLS 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G+ PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDGPTHQP+EH+ +L
Sbjct: 424 LYGGIKPYGGTFLVFSDYSRNAIRMSALMKQPVVHVMSHDSIGLGEDGPTHQPIEHVPSL 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGAY 551
           R IP+L V RPAD+IET+  W+ A+K K+ PSV+ L+RQNL P ++TQ++  N+ A G Y
Sbjct: 484 RLIPNLSVWRPADTIETMIAWKEAVKSKDTPSVMVLTRQNLMPVVQTQHQVANI-ARGGY 542

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
                P+A++TI ++GSE+++AV+       + I   V S+PC E+F  Q+  Y+  +I 
Sbjct: 543 LVKDNPDAKLTIVATGSEVELAVKVANEFEKKGIKLNVASIPCVEVFATQAHEYKKTVIK 602

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
                + +E      W  ++   G  + G+  FG S   + L++HFG     I ++V +
Sbjct: 603 DDIPAVFVEMAQPDMWYKYMPKAGGEVKGIYSFGESAPVEDLFKHFGFTVENISNIVAK 661


>gi|134094088|ref|YP_001099163.1| transketolase [Herminiimonas arsenicoxydans]
 gi|133737991|emb|CAL61036.1| transketolase [Herminiimonas arsenicoxydans]
          Length = 668

 Score =  612 bits (1579), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 311/659 (47%), Positives = 426/659 (64%), Gaps = 10/659 (1%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M +     KMA+AIR L+MDA++  NSGHPG PMGMAD+  AL++     +P  P W NR
Sbjct: 1   MTFTLPTTKMANAIRALAMDAVQKANSGHPGAPMGMADIAVALWSNHYSHNPANPKWINR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLS GHGSML+YALL+L GY D+++++I+NFR + SKT GHPE     GIE TTGPL
Sbjct: 61  DRFVLSNGHGSMLHYALLHLTGY-DLSMDEIRNFRQMHSKTPGHPEVDITPGIETTTGPL 119

Query: 133 GQGIANAVGMAIAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GQGI NAVGMA+AE+ L  EF      ++DH+TYV +GDGCLMEGIS EA S AG L L 
Sbjct: 120 GQGITNAVGMALAEKLLAAEFNRPNFNVVDHHTYVFLGDGCLMEGISHEACSLAGTLRLP 179

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDK 248
           KLI  +D+NGISIDG +      D   RF A GWN + +++GHD +A+ + +++A+ SDK
Sbjct: 180 KLIAFYDDNGISIDGHVEGWFQDDTPKRFEAYGWNVVRAIDGHDVNAVDAAIKQAKASDK 239

Query: 249 PTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLA 308
           PT+I C+TVIG GSPN AGT+ VHG+ALG +EI ATR A+ W   PF +P D+   W   
Sbjct: 240 PTLICCKTVIGKGSPNMAGTHNVHGAALGDKEIAATRAAIGWGYAPFEVPADVYAAWDAK 299

Query: 309 GLRSSQTRADW---QERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIA 365
              ++Q  A W   Q+  ++    +  E  RR S  LP   +             K  IA
Sbjct: 300 AKGAAQESA-WNTLQQAYAAQYPELASELTRRMSGELPANLEQTVAAYIATCVEKKETIA 358

Query: 366 TRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMA 425
           TRK+S+  ++ +   LPE +GGSADLTGSN T   +  A+ ++D  G +++YGVRE  M+
Sbjct: 359 TRKASQNAIQALAPVLPEFLGGSADLTGSNLTNWKECVAV-RADQWGNHINYGVREFGMS 417

Query: 426 AAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQP 485
           A MNGIALH G  P+  TF+ FSDYSR A+R+A+LM +R I V THDSIGLGEDGPTHQ 
Sbjct: 418 AIMNGIALHGGHIPFGATFLTFSDYSRNALRMAALMKLRSIFVFTHDSIGLGEDGPTHQS 477

Query: 486 VEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNL 545
           VEH+++LR IP+L   RP D++E+   W+ A+K  N P+ L  SRQNLPF     E    
Sbjct: 478 VEHVSSLRLIPNLDNWRPCDTVESAVAWEQAVKRHNGPTTLIFSRQNLPFQERSAEQIAN 537

Query: 546 CALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSY 605
              G Y     PNAQV + ++GSE+++AV++ + L+   ++ R+VS+P  ++F  Q  +Y
Sbjct: 538 IKRGGYVLRDAPNAQVILIATGSEIELAVKSADELAQHGMAVRIVSMPSTDVFDRQDAAY 597

Query: 606 RAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           +A ++     ++AIEAG+   W  ++G +G+ IG+  FG S    +L++HFG     +V
Sbjct: 598 KAAVLTKGVPRVAIEAGVTDFWHKYVGLEGAVIGIDTFGESAPAGVLFKHFGFTVENVV 656


>gi|171463045|ref|YP_001797158.1| transketolase [Polynucleobacter necessarius subsp. necessarius
           STIR1]
 gi|171192583|gb|ACB43544.1| transketolase [Polynucleobacter necessarius subsp. necessarius
           STIR1]
          Length = 664

 Score =  612 bits (1578), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 321/662 (48%), Positives = 429/662 (64%), Gaps = 16/662 (2%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIR LSMDA++  NSGHPG+PMGMAD+   L+ + +  +P  P+W +RDRFVLS G
Sbjct: 7   RMANAIRALSMDAVQQANSGHPGMPMGMADIAVGLWNEHLKHNPTDPHWIDRDRFVLSNG 66

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y+LL+L GY D+ IE++KNFR + SKT GHPEYG   G+E TTGPLGQGI+NAV
Sbjct: 67  HGSMLLYSLLHLSGY-DLPIEELKNFRQLHSKTPGHPEYGITPGVETTTGPLGQGISNAV 125

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L EEF   G  ++DHYTYV +GDGCLMEGIS E  S AG L L+KLI LWD+
Sbjct: 126 GMALAEKLLAEEFNRPGHNIVDHYTYVFLGDGCLMEGISHEVCSLAGILKLNKLIALWDD 185

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           NGISIDG +    + D   RF A GWN +  V+GHD  A+++ + KA+ SDKPT+I C+T
Sbjct: 186 NGISIDGKVVSWFNEDTPKRFEAYGWNVICDVDGHDAEAVSAAIAKAKKSDKPTLICCKT 245

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
            IG GSPN AG++KVHGS LG  EI ATR ALNW   PF IP DI   W     R     
Sbjct: 246 AIGQGSPNMAGSDKVHGSPLGAAEIAATRVALNWPYPPFEIPKDIYAAWDFKK-RGQAAE 304

Query: 317 ADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
            +W +     K+    +  E +RR    L   F +      K  +     IATRK+S+  
Sbjct: 305 HEWNKEFQKYKNKFPELASELQRRMEGELSKEFSSTLSTYLKTCQSKAETIATRKASQNA 364

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           +E +   LPE +GGSADLTGSN T  S  KA+ + D  G +++YGVRE  M A MNGIAL
Sbjct: 365 IEALAPALPEFMGGSADLTGSNLTNWSTCKAV-RGDQWGNHINYGVREFGMGAIMNGIAL 423

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H G  P+ GTF+ FSDYSR A+R+A+LM +R I V THDSIGLGEDGPTHQ VEH+A+LR
Sbjct: 424 HGGYIPFGGTFLTFSDYSRNALRMAALMKLRSIFVFTHDSIGLGEDGPTHQSVEHVASLR 483

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYD 552
            IP+L+V RP D+ E+   W  A+  KN PS L  SRQN PF+ RT  +  ++ A G Y 
Sbjct: 484 LIPNLMVWRPCDTTESAVAWGSAIGRKNGPSALIFSRQNCPFVSRTPAQIKDI-ARGGYV 542

Query: 553 YISTPNAQV--TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
                +A++   I ++GSE+ +A++  E L    +  RVVS+P   +F +Q  +Y+A+++
Sbjct: 543 LRDPKSAKIDAVIIATGSEIALALQTAEHLEKEGLGIRVVSIPSTTVFDQQDAAYKAKVL 602

Query: 611 GSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERK 670
            ++  ++A+EAG+   W  +     +  G+  FG S    +LY++FG+    I   V++ 
Sbjct: 603 PANIPRVAVEAGVSDFWWKY--GCAAAHGVDTFGESAPALVLYEYFGLTVGQIAKTVKQC 660

Query: 671 LS 672
           +S
Sbjct: 661 IS 662


>gi|120613218|ref|YP_972896.1| transketolase [Acidovorax citrulli AAC00-1]
 gi|120591682|gb|ABM35122.1| transketolase [Acidovorax citrulli AAC00-1]
          Length = 695

 Score =  612 bits (1577), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 330/685 (48%), Positives = 435/685 (63%), Gaps = 44/685 (6%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++MA+AIR L+MDA++  NSGHPG PMGMAD+  AL+++ +  +P  P W +RDRFVLS 
Sbjct: 5   QQMANAIRALAMDAVQQANSGHPGAPMGMADMAVALWSRHLRHNPANPQWADRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY D+ IE++KNFR + SKTAGHPEYG   G+E TTGPLGQGI NA
Sbjct: 65  GHGSMLLYALLHLTGY-DLPIEELKNFRQLHSKTAGHPEYGITPGVETTTGPLGQGITNA 123

Query: 140 VGMAIAERKLREEF----GDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLI 192
           VG A+AE+ L  EF    GDV   ++DH+TYV +GDGCLMEGISQEAIS AG   L KLI
Sbjct: 124 VGFALAEKLLAREFNRRNGDVDHTIVDHHTYVFLGDGCLMEGISQEAISLAGAWKLGKLI 183

Query: 193 VLWDNNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLS-DKPT 250
            L+D+NGISIDG ++     D   RFRASGWN +  V+GHD  A+ + ++ A+ S DKPT
Sbjct: 184 ALYDDNGISIDGQVAPWFVDDTPGRFRASGWNVIGPVDGHDVEAVAAAVQSAKTSIDKPT 243

Query: 251 MIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGL 310
           +I C+T IG GSPNRAGT+K HG  LG +EI  TR A+ W   PF IP ++   W  A  
Sbjct: 244 LIVCKTAIGKGSPNRAGTSKAHGEPLGADEITLTRNAIGWSHVPFEIPAEVYADWN-AKD 302

Query: 311 RSSQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATR 367
             +Q  ADWQ+R  +  ++   +  EF RR +  LP  F    ++           +A+R
Sbjct: 303 AGAQAEADWQQRFDAYAAAYPELAAEFLRRMAGDLPRHFAQTAVDTVVNAHTKAETVASR 362

Query: 368 KSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAI------------------SKSD 409
           K+S+L LE     LPEL+GGSADLTGSN T T    A+                    + 
Sbjct: 363 KASQLALEAFTAALPELLGGSADLTGSNLTNTKSTPALRFDEQGDVVQVEVNTGGAETAK 422

Query: 410 FSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVL 469
             GR+++YGVRE  MAA MNGIALH G  PY GTF+ FSDYSR AIR+A+LM +RV+HV 
Sbjct: 423 LGGRHINYGVREFGMAAIMNGIALHGGFIPYGGTFLTFSDYSRNAIRMAALMKLRVVHVF 482

Query: 470 THDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLS 529
           THDSIGLGEDGPTHQ +EH A+LR IP L V RPAD+ ET   W VAL  +NRP+ L LS
Sbjct: 483 THDSIGLGEDGPTHQSIEHAASLRLIPGLDVWRPADTAETAVAWSVALSNRNRPTALLLS 542

Query: 530 RQNLPFLRTQYESNNLCALGAYDYISTP-------NAQVTIFSSGSELKIAVEACEILSS 582
           RQNL +   +   +   + GAY  +S P        AQ  I ++GSE+++A+ A ++L+ 
Sbjct: 543 RQNLAYAAKRDLGD--ISRGAY-VLSEPADAGIKKKAQAVIIATGSEVQLALAAQKLLAE 599

Query: 583 RNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQG 642
           + I+ RVVS+P    F  +   Y+A ++ +   +IA+E G+   W  +     + +G+  
Sbjct: 600 KKIAVRVVSMPSTTTFDREDAKYKASVLPAGVPRIAVEMGVTDFWWKY--GCAAVVGIDT 657

Query: 643 FGASGSCDLLYQHFGINAIAIVDMV 667
           FG S    +L++HFG     + D V
Sbjct: 658 FGESAPAPVLFKHFGFTPENVADSV 682


>gi|148358298|ref|YP_001249505.1| transketolase I [Legionella pneumophila str. Corby]
 gi|296105649|ref|YP_003617349.1| transketolase [Legionella pneumophila 2300/99 Alcoy]
 gi|148280071|gb|ABQ54159.1| transketolase I [Legionella pneumophila str. Corby]
 gi|295647550|gb|ADG23397.1| transketolase [Legionella pneumophila 2300/99 Alcoy]
          Length = 668

 Score =  611 bits (1576), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 318/663 (47%), Positives = 426/663 (64%), Gaps = 15/663 (2%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + + ++A+A+R LS+DA+    SGHPG+P+GMAD+ T L+ + + F+P+ P+W NRDRFV
Sbjct: 2   NSFTELANAVRMLSIDAVNQAQSGHPGMPLGMADIATVLWKKFLKFNPKNPHWFNRDRFV 61

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GHGSML Y+LL+L GY ++ I ++KNFR + SKT GHPE+G   G+E TTGPLGQG+
Sbjct: 62  LSNGHGSMLLYSLLHLTGY-NLDINELKNFRQLHSKTPGHPEHGHTPGVETTTGPLGQGL 120

Query: 137 ANAVGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIV 193
           AN+VGMA+AER L   F      L+DHYTY   GDGCLMEGIS EA S AG LGL KLIV
Sbjct: 121 ANSVGMALAERVLASHFNHDHYNLVDHYTYTFAGDGCLMEGISHEACSLAGTLGLGKLIV 180

Query: 194 LWDNNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKA-QLSDKPTM 251
            +D+NGISIDG +    + D  +RF+A  W  +  ++GHD   I   +  A + + +P++
Sbjct: 181 FYDDNGISIDGKVESWFTDDTTSRFKAYNWQVIGPIDGHDAAQIEQAISAARENTTQPSL 240

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAG 309
           I C+TVIG GS + AG+ K HGS L  ++I   R+  NW   PF IPD I K+W  R  G
Sbjct: 241 IICKTVIGLGS-SVAGSEKAHGSPLSAQDINNVREFFNWKHAPFEIPDSIYKQWDHREQG 299

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            +  Q              S   EF RR +  LPD +        K+  +++  IATRK+
Sbjct: 300 EKEEQQWLQLLHEYRQQHPSEHDEFLRRANGDLPDDWQEISAGFLKQCLNNEKAIATRKA 359

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           S+  +E     LPE+ GGSADLTGSN T  S  KAI+  +FSG YL+YGVRE AMAA MN
Sbjct: 360 SQQCIEFFAPILPEMFGGSADLTGSNNTDWSGSKAITAHNFSGNYLYYGVREFAMAAIMN 419

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+A+H G  PY GTF+VF+DY+R AIRL++LM  RVI+VLTHDSIGLGEDGPTHQP+EH+
Sbjct: 420 GLAVHGGFIPYGGTFLVFADYARNAIRLSALMKQRVIYVLTHDSIGLGEDGPTHQPIEHI 479

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A LR  P + V RPAD +ET   WQ +L+  N PS L LSRQNLP L    ++ +L   G
Sbjct: 480 AMLRMTPGMTVWRPADLMETAVAWQQSLEHHNGPSALLLSRQNLPALAHGADAADLIKKG 539

Query: 550 AY---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYR 606
            Y   D    P+A   + ++GSE+++A+ A E   +R +  RVVS+PC E F  QSD+Y+
Sbjct: 540 GYIIADCEGKPDA--ILIATGSEVQLAITAAEKAKARGLQVRVVSMPCAERFLAQSDAYK 597

Query: 607 AQII-GSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
            Q++ G    +IAIEA     W  F+G DG+ IG+  FG S      + + GI    I++
Sbjct: 598 NQVLPGQVRTRIAIEAASSAYWHQFVGFDGAVIGLDCFGVSAPATDAFNYLGITVEKIIN 657

Query: 666 MVE 668
            ++
Sbjct: 658 TLD 660


>gi|307608884|emb|CBW98283.1| hypothetical protein LPW_01401 [Legionella pneumophila 130b]
          Length = 668

 Score =  611 bits (1576), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 319/663 (48%), Positives = 427/663 (64%), Gaps = 15/663 (2%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + + ++A+A+R LS+DA+    SGHPG+P+GMAD+ T L+ + + F+P+ P+W NRDRFV
Sbjct: 2   NSFTELANAVRMLSIDAVNQAQSGHPGMPLGMADIATVLWKKFLKFNPKNPHWFNRDRFV 61

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GHGSML Y+LL+L GY ++ I ++KNFR + SKT GHPE+G   G+E TTGPLGQG+
Sbjct: 62  LSNGHGSMLLYSLLHLTGY-NLDINELKNFRQLHSKTPGHPEHGHTPGVETTTGPLGQGL 120

Query: 137 ANAVGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIV 193
           AN+VGMA+AER L   F      L+DHYTY   GDGCLMEGIS EA S AG LGL KLIV
Sbjct: 121 ANSVGMALAERVLASTFNHDHYNLVDHYTYTFAGDGCLMEGISHEACSLAGTLGLGKLIV 180

Query: 194 LWDNNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLSD-KPTM 251
            +D+NGISIDG +    + D  +RF+A  W  +  ++GHD + I   + +A  ++ +P++
Sbjct: 181 FYDDNGISIDGKVESWFTDDTTSRFKAYNWQVIGPIDGHDANQIEHAILEASKNNTQPSL 240

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAG 309
           I C+TVIG GS + AG+ K HGS L  ++I   R+  NW   PF IPD I K+W  R  G
Sbjct: 241 IICKTVIGLGS-SVAGSEKAHGSPLSAQDINNVREFFNWKHAPFEIPDSIYKQWDHREQG 299

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            +  Q              S   EF RR +  LPD +        K+  +++  IATRK+
Sbjct: 300 EKEEQQWLQLLHEYRQQFPSEHDEFLRRANGDLPDDWQEISAGFLKQCLNNEKAIATRKA 359

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           S+  +E     LPE+ GGSADLTGSN T  S  KAI+  +FSG YL+YGVRE AMAA MN
Sbjct: 360 SQQCIEFFAPILPEMFGGSADLTGSNNTDWSGSKAITSHNFSGNYLYYGVREFAMAAIMN 419

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+A+H G  PY GTF+VF+DY+R AIRL++LM  RVI+VLTHDSIGLGEDGPTHQP+EH+
Sbjct: 420 GLAVHGGFIPYGGTFLVFADYARNAIRLSALMKQRVIYVLTHDSIGLGEDGPTHQPIEHI 479

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A LR  P + V RPAD +ET   WQ +L+  N PS L LSRQNLP L    ++ +L   G
Sbjct: 480 AMLRMTPGMTVWRPADLMETAVAWQQSLEHHNGPSALLLSRQNLPALAHGTDAADLIKKG 539

Query: 550 AY---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYR 606
            Y   D    P+A   + ++GSE+++A+ A E   +R +  RVVS+PC E F  QSD Y+
Sbjct: 540 GYIIADCEGKPDA--ILIATGSEVQLAITAAEKAKARGLQVRVVSMPCAERFLAQSDDYK 597

Query: 607 AQII-GSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
            QI+ G    +IAIEA     W  F+G DG+ IG+  FG S      + + GI    I++
Sbjct: 598 NQILPGQVRTRIAIEAASSAYWHQFVGFDGAVIGLDCFGVSAPATDAFNYLGITVEKIIN 657

Query: 666 MVE 668
            ++
Sbjct: 658 TLD 660


>gi|254373264|ref|ZP_04988752.1| transketolase [Francisella tularensis subsp. novicida GA99-3549]
 gi|151570990|gb|EDN36644.1| transketolase [Francisella novicida GA99-3549]
          Length = 663

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 315/659 (47%), Positives = 432/659 (65%), Gaps = 13/659 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA     SGHPG+PMGMAD+ T L+T+ +  +P  P+W NRDRFVLS 
Sbjct: 7   REFSNAIRFLSIDATLKAKSGHPGMPMGMADIATVLWTKFLKHNPNNPHWINRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L + +      +IDH+TYV +GDGCLMEG+S EA S AG LGL+KL+  WD
Sbjct: 126 VGMALGEKLLSDRYNTPDLKVIDHHTYVFLGDGCLMEGVSHEACSLAGTLGLNKLVAFWD 185

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +N ISIDG      S +   RFRA GW+ + +V+GHD  AI   + +A     KPT+I C
Sbjct: 186 DNNISIDGDTKGWFSDNTPERFRAYGWHVIENVDGHDFVAIEKAINEAHSQQQKPTLICC 245

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFGSP +AGT  VHGS L ++E  +  K LNW+   F IP D+ K W  A  +   
Sbjct: 246 KTVIGFGSPEKAGTASVHGSPLSEQERASAAKELNWNYQAFEIPQDVYKYWD-AREKGQA 304

Query: 315 TRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEHSKPM-IATRKSSEL 372
             A+WQ + +  K S +  EFER  S  LP   +   IN     + S P+ +ATRK+S++
Sbjct: 305 LEANWQGQWNLFKDSPKFDEFERVLSKELPVGLEGT-INDYIASQLSNPVKVATRKASQM 363

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+   +PE+ GGSADLTGSN T  S    ++ +     YL YGVRE  MAA MNG++
Sbjct: 364 ALEVLCKNMPEMFGGSADLTGSNNTNWSGSVWLNNTQEGANYLSYGVREFGMAAIMNGLS 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G+ PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDGPTHQP+EH+ +L
Sbjct: 424 LYGGIKPYGGTFLVFSDYSRNAIRMSALMKQPVVHVMSHDSIGLGEDGPTHQPIEHVPSL 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGAY 551
           R IP+L V RPAD++ET+  W+ A+K K+ PSV+ L+RQNL P ++TQ +  N+ A G Y
Sbjct: 484 RLIPNLNVWRPADTVETMIAWKEAVKSKDTPSVMVLTRQNLMPVVQTQQQVANI-ARGGY 542

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
                P+A++TI ++GSE+++AV+       + I   V S+PC E+F  Q+  Y+  +I 
Sbjct: 543 LVKDNPDAKLTIVATGSEVELAVKVANEFEKKGIKLNVASIPCVEVFATQAQEYKKTVIK 602

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
                + +E      W  ++   G  + G+  FG S   + L++HFG     I ++V +
Sbjct: 603 DDIPAVFVEMAQPDMWYKYMPKAGGEVKGIYSFGESAPAEDLFKHFGFTVENISNIVAK 661


>gi|52840394|ref|YP_094193.1| transketolase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52627505|gb|AAU26246.1| transketolase I [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 692

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 318/663 (47%), Positives = 425/663 (64%), Gaps = 15/663 (2%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + + ++A+A+R LS+DA+    SGHPG+P+GMAD+ T L+ + + F+P+ P+W NRDRFV
Sbjct: 26  NSFTELANAVRMLSIDAVNQAQSGHPGMPLGMADIATVLWKKFLKFNPKNPHWFNRDRFV 85

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GHGSML Y+LL+L GY ++ I ++KNFR + SKT GHPE+G   G+E TTGPLGQG+
Sbjct: 86  LSNGHGSMLLYSLLHLTGY-NLDISELKNFRQLHSKTPGHPEHGHTPGVETTTGPLGQGL 144

Query: 137 ANAVGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIV 193
           AN+VGMA+AER L   F      L+DHYTY   GDGCLMEGIS EA S AG LGL KLIV
Sbjct: 145 ANSVGMALAERVLASTFNHDHFNLVDHYTYTFAGDGCLMEGISHEACSLAGTLGLGKLIV 204

Query: 194 LWDNNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKA-QLSDKPTM 251
            +D+NGISIDG +    + D  +RF+A  W  +  ++GHD   I   +  A + + +P++
Sbjct: 205 FYDDNGISIDGKVESWFTDDTTSRFKAYNWQVIGPIDGHDADQIEQAISAARENTTQPSL 264

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAG 309
           I C+TVIG GS + AG+ K HGS L  ++I   R+  NW   PF IPD I K+W  R  G
Sbjct: 265 IICKTVIGLGS-SVAGSEKAHGSPLSAQDINNVREFFNWKHAPFEIPDSIYKQWDHREQG 323

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            +  Q              S   EF RR +  LPD +        K+  +++  IATRK+
Sbjct: 324 EKEEQQWLQLLHEYRQQHPSEHDEFLRRANGDLPDDWQEISAGFLKQCLNNEKAIATRKA 383

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           S+  +E     LPE+ GGSADLTGSN T  S  KAI+  +FSG YL+YGVRE AMAA MN
Sbjct: 384 SQQCIEFFAPILPEMFGGSADLTGSNNTDWSGSKAITAHNFSGNYLYYGVREFAMAAIMN 443

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+A+H G  PY GTF+VF+DY+R AIRL++LM  RVI+VLTHDSIGLGEDGPTHQP+EH+
Sbjct: 444 GLAVHGGFIPYGGTFLVFADYARNAIRLSALMKQRVIYVLTHDSIGLGEDGPTHQPIEHI 503

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A LR  P + V RPAD +ET   WQ +L+  N PS L LSRQNLP L    ++ +L   G
Sbjct: 504 AMLRMTPGMTVWRPADLMETAVAWQQSLEHHNGPSALLLSRQNLPALAHGTDAADLIKKG 563

Query: 550 AY---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYR 606
            Y   D    P+A   + ++GSE+++A+ A E   +R +  RVVS+PC E F  QSD Y+
Sbjct: 564 GYIIADCEGKPDA--ILIATGSEVQLAITAAEKAKARGLQVRVVSMPCAERFLAQSDDYK 621

Query: 607 AQII-GSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
            Q++ G    +IAIEA     W  F+G DG+ IG+  FG S      + + GI    I++
Sbjct: 622 NQVLPGQVRTRIAIEAASSAYWHQFVGFDGAVIGLDCFGVSAPATDAFNYLGITVEKIIN 681

Query: 666 MVE 668
            ++
Sbjct: 682 TLD 684


>gi|134301589|ref|YP_001121557.1| transketolase [Francisella tularensis subsp. tularensis WY96-3418]
 gi|134049366|gb|ABO46437.1| transketolase [Francisella tularensis subsp. tularensis WY96-3418]
          Length = 663

 Score =  610 bits (1573), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 317/659 (48%), Positives = 433/659 (65%), Gaps = 13/659 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA     SGHPG+PMGMAD+ T L+T+ +  +P  P+W NRDRFVLS 
Sbjct: 7   REFSNAIRFLSIDATLKAKSGHPGMPMGMADIATVLWTKFLKHNPNNPHWINRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L + +      +IDH+TYV +GDGCLMEG+S EA S AG LGL+KL+  WD
Sbjct: 126 VGMALGEKLLSDRYNTPDLKVIDHHTYVFLGDGCLMEGVSHEACSLAGTLGLNKLVAFWD 185

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +N ISIDG      S +   RFRA GW+ + +V+GHD  AI   + +A     KPT+I C
Sbjct: 186 DNNISIDGDTKGWFSDNTPERFRAYGWHVIENVDGHDFVAIEKAINEAHSQQQKPTLICC 245

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFGSP +AGT  VHGS L  +E  +  K LNWD   F IP D+ K W  A  +   
Sbjct: 246 KTVIGFGSPEKAGTASVHGSPLSDQERASAAKELNWDYQAFEIPQDVYKYWD-AREKGQA 304

Query: 315 TRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEHSKPM-IATRKSSEL 372
             A+WQ + +  K S +  EFER  S  LP   ++A IN     + S P+ +ATRK+S++
Sbjct: 305 LEANWQGQWNLFKDSPKFDEFERVLSKELPVGLESA-INDYIASQLSNPVKVATRKASQM 363

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
           VLEV+   +PE+ GGSADLTGSN T  S    ++ +     YL YGVRE  MAA MNG++
Sbjct: 364 VLEVLCKNMPEMFGGSADLTGSNNTNWSGSVWLNNTQEGANYLSYGVREFGMAAIMNGLS 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G+ PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDG THQP+EH+ +L
Sbjct: 424 LYGGIKPYGGTFLVFSDYSRNAIRMSALMKQPVVHVMSHDSIGLGEDGSTHQPIEHVPSL 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGAY 551
           R IP+L V RPAD+IET+  W+ A+K K+ PSV+ L+RQNL P ++TQ++  N+ A G Y
Sbjct: 484 RLIPNLSVWRPADTIETMIAWKEAVKSKDTPSVMVLTRQNLMPVVQTQHQVANI-ARGGY 542

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
                P+A++TI ++GSE+++AV+       + I   V S+PC E+F  Q+  Y+  +I 
Sbjct: 543 LVKDNPDAKLTIVATGSEVELAVKVANEFEKKGIKLNVASIPCVEVFATQAHEYKKTVIK 602

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
                + +E      W  ++   G  + G+  FG S   + L++ FG     I ++V +
Sbjct: 603 DDIPAVFVEMAQPDMWYKYMPKAGGEVKGIYSFGESAPAEDLFKRFGFTVENISNIVAK 661


>gi|254497280|ref|ZP_05110088.1| transketolase [Legionella drancourtii LLAP12]
 gi|254353508|gb|EET12235.1| transketolase [Legionella drancourtii LLAP12]
          Length = 666

 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 324/659 (49%), Positives = 425/659 (64%), Gaps = 21/659 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LS+DA+E   SGHPG+P+GMAD+ T L+ + + ++P+ P+W NRDRFVLS 
Sbjct: 5   KELANAIRILSIDAVEQAQSGHPGMPLGMADIATVLWKKFLKYNPKNPHWFNRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY ++ IE++KNFR + SKT GHPE+G   G+E TTGPLGQG+ANA
Sbjct: 65  GHGSMLLYSLLHLTGY-NLPIEELKNFRQLNSKTPGHPEFGHTPGVETTTGPLGQGLANA 123

Query: 140 VGMAIAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAER L   +      L+DH+TY  VGDGCLMEGIS EA SFAG LGL KLIV +D
Sbjct: 124 VGMAIAERALASRYNHEDCNLVDHHTYAFVGDGCLMEGISHEACSFAGTLGLGKLIVFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    + D   RF+A  W  + +++GHD  AI   +  AQ  + +PT+I C
Sbjct: 184 SNGISIDGKVDSWFTDDTAMRFKAYNWQVIEAIDGHDLDAIEQAIVAAQANTSQPTLIIC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLA--GLRS 312
           +T+IG GS   AG+ K HGS LG ++I+  R+  +W   PF IPD I ++W     G R 
Sbjct: 244 KTIIGLGSA-VAGSEKSHGSPLGAQDIEKVREFFHWQHAPFVIPDTIYQQWSHVEQGERD 302

Query: 313 SQTRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            Q    W   L   + S      EF RR +  LPD + +      ++   ++  IATRK+
Sbjct: 303 EQ---QWLSLLHHYQQSYPIEHYEFLRRINGDLPDDWKSHCQAFLEQCRRNEKAIATRKA 359

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           S+  +E     LPE++GGSADLTGSN T  S  +AI+  DFSG YL YGVRE AMAA MN
Sbjct: 360 SQQCIEHFARSLPEMLGGSADLTGSNNTDWSGSQAITHEDFSGNYLAYGVREFAMAAIMN 419

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+A+H G  PY GTF+VF+DY+R A+RL++LM  RVI+V THDSIGLGEDGPTHQPVEH 
Sbjct: 420 GLAVHGGFIPYGGTFLVFADYARNAVRLSALMKQRVIYVFTHDSIGLGEDGPTHQPVEHA 479

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           + LR  PD+ V RPAD +ET   WQ AL+  N P+ L LSRQNLP L     +  L   G
Sbjct: 480 SMLRMTPDMTVWRPADLMETAVAWQSALEHHNGPTSLLLSRQNLPALPHGVNAAELIKKG 539

Query: 550 AY---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYR 606
            Y   D   TP+A   + ++GSE+++A+ A E +S++ +  RVVS+PC E F  Q   Y+
Sbjct: 540 GYILVDCAGTPDA--ILIATGSEVQLAITAAEQISTQGLKVRVVSMPCAERFLAQDPGYK 597

Query: 607 AQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
            Q++      +IAIEA     W  F+G DG+ IG+  FG S      Y   GI    IV
Sbjct: 598 NQVLPKEVTARIAIEAASSAYWYQFVGLDGAVIGLDRFGVSAPAAKAYDFLGITIERIV 656


>gi|119503484|ref|ZP_01625567.1| transketolase [marine gamma proteobacterium HTCC2080]
 gi|119460546|gb|EAW41638.1| transketolase [marine gamma proteobacterium HTCC2080]
          Length = 666

 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 313/658 (47%), Positives = 415/658 (63%), Gaps = 12/658 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIR LSMDA++  NSGHPG PMGMAD+   L+   +  +P  P WP+RDRFVLS G
Sbjct: 6   QLANAIRALSMDAVQAANSGHPGAPMGMADIAEVLWNGYLKHNPNNPDWPDRDRFVLSNG 65

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y+LL+L GY D+TIED+KNFR   +KTAGHPEYG   G+E TTGPLGQG+ANAV
Sbjct: 66  HGSMLLYSLLHLSGY-DLTIEDLKNFRQFHAKTAGHPEYGYAPGVETTTGPLGQGLANAV 124

Query: 141 GMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  +F      LIDH T+  +GDGCLMEGIS EA S AG LGL KL+  +D+
Sbjct: 125 GMALAEKTLAAQFNTEKHTLIDHRTWAFLGDGCLMEGISHEACSLAGTLGLGKLVAFYDD 184

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKA-QLSDKPTMIACE 255
           NGISIDG ++   + D   RF + GW  + +V+GHDH +I++ +  A Q  +KPT+I C 
Sbjct: 185 NGISIDGEVTGWFTDDTTKRFESYGWQVIPNVDGHDHASISAAIDLALQDGEKPTLICCR 244

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG G+PN+ GT   HG+ LG +EI ATR AL W+  PF IP+ + + W  A  R ++ 
Sbjct: 245 TIIGKGAPNKQGTESCHGAPLGADEIAATRAALGWEHGPFEIPEAVYEGWD-AKARGAEQ 303

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
             DW  R +    +     +E ERR    LPD F+    +   +   +   +A+RK+S+ 
Sbjct: 304 EQDWHSRFADFSKAAPQQAEELERRLEGTLPDTFEAQMDDYITQCAEAGTDMASRKASQQ 363

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            L  +   LPE++GGSADL GSN T     K ++ +D SG Y++YGVRE AM+A MNG+A
Sbjct: 364 TLNTLGPLLPEMLGGSADLAGSNLTLWQGSKGVTATDASGNYVYYGVREFAMSAMMNGVA 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LHKG  PY  TF++F +Y+R A+R+A+LM  RVI V THDSIGLGEDGPTHQPVE L AL
Sbjct: 424 LHKGFIPYGATFLIFMEYARNAVRMAALMRQRVIFVYTHDSIGLGEDGPTHQPVEQLTAL 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           R+ P+L   RP D++E+   W++A+     P+ L  SRQ LP      E       G Y 
Sbjct: 484 RSTPNLETWRPCDTVESAVAWKMAVMRDAGPAALIFSRQTLPHQDRAEEGVKAIERGGYT 543

Query: 553 YIS-TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
            IS T      I ++GSE+ +AV A + L+      RVVS+PC E F  Q  +YR  I+ 
Sbjct: 544 LISETGELDAIIIATGSEVGLAVAAAQTLAENGRGIRVVSMPCAERFMAQEVTYRESILP 603

Query: 612 SSPI-KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           S  + ++A+EA     W  F+G DG  +GMQ FG S     L  HFG     +V  VE
Sbjct: 604 SDVLARVAVEAAHADYWYKFVGLDGRVVGMQSFGESAPGGELMAHFGFTVENVVAAVE 661


>gi|94310455|ref|YP_583665.1| transketolase [Cupriavidus metallidurans CH34]
 gi|93354307|gb|ABF08396.1| transketolase 1, thiamin-binding protein [Cupriavidus metallidurans
           CH34]
          Length = 684

 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 320/670 (47%), Positives = 424/670 (63%), Gaps = 12/670 (1%)

Query: 11  VLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWP 70
           VL      Y ++A+A+R L+MDA++  NSGHPG PMGMA++  AL++  +  +P  P WP
Sbjct: 9   VLRPESGRYDELANALRALAMDAVQQANSGHPGAPMGMAEMAVALWSGHLRHNPGNPGWP 68

Query: 71  NRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTG 130
           +RDRFVLS GH SML YALL+L GY D+ IE+++ FR + SKT GHPE G   G+E TTG
Sbjct: 69  DRDRFVLSNGHASMLLYALLHLSGY-DLPIEELQRFRQLHSKTPGHPEVGLTPGVETTTG 127

Query: 131 PLGQGIANAVGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLG 187
           PLGQG+ANAVGMA+A + L +EF   G V++DH+TYV +GDGCLMEGIS E  S AG   
Sbjct: 128 PLGQGLANAVGMALAGKLLGDEFNRPGHVVVDHHTYVFLGDGCLMEGISHEVCSLAGVWR 187

Query: 188 LSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLS 246
           L+KLI L+D+NGISIDG +      D  ARFRA GWN +  ++GHD  AI  ++  A+ S
Sbjct: 188 LNKLIALYDDNGISIDGAVDAWFRDDTAARFRAYGWNVIGPIDGHDVVAIGRSIADARRS 247

Query: 247 -DKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW 305
            D+PT+I C T IG GSP RAGT K HG  LG +EI ATR A+ W   PF IPD +  +W
Sbjct: 248 ADRPTLIVCRTTIGRGSPGRAGTAKAHGEPLGADEIAATRAAIGWHEAPFEIPDTVRARW 307

Query: 306 RLAGLRSSQTRADWQ---ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKP 362
               L  ++  A W+   E   S   ++  EFERR +  LP  F  A      +   +  
Sbjct: 308 SARDL-GARREAQWRLGFEAYRSEYPALAAEFERRIAGDLPSSFHEAASAAMIELGQATT 366

Query: 363 MIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREH 422
            +A+RK+S+  L ++   +PE++GGSADLTGSN T      A+      GR+++YGVRE 
Sbjct: 367 PVASRKASQQALAMLAPKIPEMLGGSADLTGSNLTDFPGCGAVRAGQPGGRHVNYGVREF 426

Query: 423 AMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPT 482
            MAA MNG+ALH G  PY GTF+ FSDYSR  IR+A+LM +RV+HV THDSIGLGEDGPT
Sbjct: 427 GMAAIMNGLALHGGFIPYGGTFLTFSDYSRNGIRMAALMKLRVVHVFTHDSIGLGEDGPT 486

Query: 483 HQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYES 542
           HQ VEH A+LR IP+L V RP D+ ET   W  AL+++ RPS L LSRQNLP      E 
Sbjct: 487 HQAVEHAASLRLIPNLDVWRPCDAAETAVAWAFALEQRTRPSALLLSRQNLPPQARTAEQ 546

Query: 543 NNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQS 602
                 G Y     P  QV +  +GSE+ IA+EA  +L +  I+ RVVS+PC  LF  Q 
Sbjct: 547 VAQIRRGGYVLSDRPEPQVVLIGTGSEVSIAMEAQRLLDAVGIAARVVSLPCSTLFDRQE 606

Query: 603 DSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIA 662
            ++  Q++G    +I +EAG+   W  +     + +G+  FG S     +Y+HFG++A A
Sbjct: 607 AAWHEQVLGRGIPRIGVEAGVTSWWGQYHCV--AALGVNSFGESAPGPQVYEHFGLDAKA 664

Query: 663 IVDMVERKLS 672
           + D+    L+
Sbjct: 665 LADLAREVLA 674


>gi|54296135|ref|YP_122504.1| transketolase [Legionella pneumophila str. Paris]
 gi|53749920|emb|CAH11302.1| hypothetical protein lpp0154 [Legionella pneumophila str. Paris]
          Length = 668

 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 320/666 (48%), Positives = 430/666 (64%), Gaps = 21/666 (3%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + + ++A+A+R LS+DA+    SGHPG+P+GMAD+ T L+ + + F+P+ P+W NRDRFV
Sbjct: 2   NSFTELANAVRMLSIDAVNQAQSGHPGMPLGMADIATVLWKKFLKFNPKNPHWFNRDRFV 61

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GHGSML Y+LL+L GY ++ I ++KNFR + SKT GHPE+G   G+E TTGPLGQG+
Sbjct: 62  LSNGHGSMLLYSLLHLTGY-NLDINELKNFRQLHSKTPGHPEHGHTPGVETTTGPLGQGL 120

Query: 137 ANAVGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIV 193
           AN+VGMA+AER L   F      L+DHYTY   GDGCLMEGIS EA S AG LGL KLIV
Sbjct: 121 ANSVGMALAERVLASHFNHDHYNLVDHYTYTFAGDGCLMEGISHEACSLAGTLGLGKLIV 180

Query: 194 LWDNNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKA-QLSDKPTM 251
            +D+NGISIDG +    + D  +RF+A  W  +  ++GHD   I   +  A + + +P++
Sbjct: 181 FYDDNGISIDGKVESWFTDDTTSRFKAYNWQVIGPIDGHDADQIEQAISAARENTTQPSL 240

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAG 309
           I C+TVIG GS + AG+ K HGS L  ++I   R+  NW   PF IPD I K+W  R  G
Sbjct: 241 IICKTVIGLGS-SVAGSEKAHGSPLSAQDINNVREFFNWKHAPFEIPDSIYKQWDHREQG 299

Query: 310 LRSSQTRADWQERLSSMK---SSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIAT 366
            +  Q    W + L   +    S   EF RR +  LPD +        K+  +++  IAT
Sbjct: 300 DKEEQ---QWLQLLHEYRLQYPSEHDEFLRRANGDLPDDWQEISAGFLKQCLNNEKAIAT 356

Query: 367 RKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAA 426
           RK+S+  +E     LPE+ GGSADLTGSN T  S  KAI+  +FSG YL+YGVRE AMAA
Sbjct: 357 RKASQQCIEFFAPILPEMFGGSADLTGSNNTDWSGSKAITAHNFSGNYLYYGVREFAMAA 416

Query: 427 AMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPV 486
            MNG+A+H G  PY GTF+VF+DY+R AIRL++LM  RVI+VLTHDSIGLGEDGPTHQP+
Sbjct: 417 IMNGLAVHGGFIPYGGTFLVFADYARNAIRLSALMKQRVIYVLTHDSIGLGEDGPTHQPI 476

Query: 487 EHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLC 546
           EH+A LR  P + V RPAD +ET   WQ +L+  N PS L LSRQNLP L    ++ +L 
Sbjct: 477 EHIAMLRMTPGMTVWRPADLMETAVAWQQSLEHHNGPSALLLSRQNLPALAHGTDAADLI 536

Query: 547 ALGAY---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSD 603
             G Y   D    P+A   + ++GSE+++A+ A E   +R +  RVVS+PC E F  QSD
Sbjct: 537 KKGGYIIADCEGKPDA--ILIATGSEVQLAITAAEKAKARGLQVRVVSMPCAERFLAQSD 594

Query: 604 SYRAQII-GSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIA 662
           +Y+ Q++ G    +IAIEA     W  F+G DG+ IG+  FG S      + + GI    
Sbjct: 595 AYKNQVLPGQVRTRIAIEAASSAYWHQFVGFDGAVIGLDCFGVSAPATDAFNYLGITVEK 654

Query: 663 IVDMVE 668
           I++ ++
Sbjct: 655 IINTLD 660


>gi|91777685|ref|YP_552893.1| transketolase [Burkholderia xenovorans LB400]
 gi|91690345|gb|ABE33543.1| transketolase [Burkholderia xenovorans LB400]
          Length = 680

 Score =  609 bits (1570), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 313/664 (47%), Positives = 425/664 (64%), Gaps = 17/664 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MADA+R L++DA+E   SGHPG+P+GMA++  AL+ + +  +P+ P WP+RDRFVLS 
Sbjct: 14  RLMADALRMLAIDAVEAAKSGHPGMPLGMAEIAVALWDRHLKHNPRNPAWPDRDRFVLSN 73

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHG+ML Y LL+L GY D+ I++++ FR + S+T GHPE G   G+E TTGPLGQG+ANA
Sbjct: 74  GHGAMLLYGLLHLTGY-DLPIDELRRFRQLYSRTPGHPEVGVTPGVETTTGPLGQGLANA 132

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE  L  EF   G  ++DH TYV VGDGC+MEGIS EA S AG L L KL VL+D
Sbjct: 133 VGMALAEALLAREFNRPGHSIVDHRTYVFVGDGCMMEGISHEAASLAGTLKLDKLTVLYD 192

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACE 255
           +NGISIDG +S   S D  ARF A GW+ +  V+GHD  A+   L +A+ + +PT+I C 
Sbjct: 193 DNGISIDGHVSQWFSDDTPARFAAYGWHVVREVDGHDVDAVDRALSRARAAGRPTLICCR 252

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIG GSP++AGT+ VHG+ LG +E+  TR+AL W   PF +P ++   W  A  R + T
Sbjct: 253 TVIGKGSPSKAGTHDVHGAPLGADEVANTRRALGWPHAPFAMPAEVRTLWD-ASERGAAT 311

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            ADW  R  + +        EFERR    LP  + +    +    +H+   IATRK+S+ 
Sbjct: 312 EADWNTRFEAYRKHYPHEAAEFERRTQRTLPVQWRDTVRAMVSDADHAGESIATRKASQQ 371

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFS---GRYLHYGVREHAMAAAMN 429
            + V+   LPEL+GGSADLTGSN T       +   D     G YLH+GVRE  M+A MN
Sbjct: 372 AIAVLARALPELLGGSADLTGSNLTNWKTAVDVHADDSGLQGGNYLHFGVREFGMSAVMN 431

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           GIALH+G  P+ GTF+ FSDYSR A+R+A+LM  R I V THDSIGLGEDGPTHQ VEH 
Sbjct: 432 GIALHRGHIPFGGTFLTFSDYSRSALRMAALMKTRAIFVFTHDSIGLGEDGPTHQSVEHA 491

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A+LR IP L V RP D++ET + W  A+ E++ PS L LSRQNLPF     E  +    G
Sbjct: 492 ASLRLIPGLDVWRPCDTVETAQAWASAV-ERDGPSCLLLSRQNLPFAARSAEQIDAIERG 550

Query: 550 AYDYISTP----NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSY 605
            Y     P      ++ + ++GSE+ +A++A   L+   I+ RVVS+P   +F  Q  ++
Sbjct: 551 GYVLRDWPAERAQTRIVLIATGSEVSLALDAVAPLAQAGIAARVVSMPSTSVFDRQPAAW 610

Query: 606 RAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
           R  ++     ++A+EAG+R  W  ++G +G  +G+  FG S     L++HFG+ A A+VD
Sbjct: 611 RDAVLPPRVPRVAVEAGVRAFWRQYVGLEGGVVGIDTFGESAPAAALFEHFGLTARAVVD 670

Query: 666 MVER 669
              R
Sbjct: 671 EARR 674


>gi|332678628|gb|AEE87757.1| Transketolase [Francisella cf. novicida Fx1]
          Length = 663

 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 312/659 (47%), Positives = 431/659 (65%), Gaps = 13/659 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA    NSGHPG+PMGMAD+ T L+T+ +  +P  P+W NRDRF+LS 
Sbjct: 7   REFSNAIRFLSIDATLKANSGHPGMPMGMADIATVLWTKFLKHNPNNPHWINRDRFILSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYAPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L + +      +IDH+TYV +GDGCLMEG+S EA S AG LGL+KL+  WD
Sbjct: 126 VGMALGEKLLSDRYNTPDLKVIDHHTYVFLGDGCLMEGVSHEACSLAGTLGLNKLVAFWD 185

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +N ISIDG      S +   RFRA GW+ + +V+GHD   I   + +A     KP +I C
Sbjct: 186 DNNISIDGDTKGWFSDNTPERFRAYGWHVIENVDGHDFVGIEKAINEAHSQQQKPALICC 245

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFGSP +AGT  VHGS L  +E  +  K LNW+   F IP D+ K W  A  +   
Sbjct: 246 KTVIGFGSPEKAGTASVHGSPLSDQERASAAKELNWNYQAFEIPQDVYKYWD-AREKGQA 304

Query: 315 TRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEHSKPM-IATRKSSEL 372
             A+WQ + +  K S + +EFER     LP   +   IN     + S P+ +ATRK+S++
Sbjct: 305 LEANWQRQWNLFKDSPKFEEFERVLGKELPVGLEGT-INDYIASQLSNPVKVATRKASQM 363

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+   +PE+ GGSADLTGSN T  S    ++ +     YL YGVRE  MAA MNG++
Sbjct: 364 ALEVLCKNMPEMFGGSADLTGSNNTNWSGSVWLNNTQEGANYLSYGVREFGMAAIMNGLS 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G+ PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDGPTHQP+EH+ +L
Sbjct: 424 LYGGIKPYGGTFLVFSDYSRNAIRMSALMKQPVVHVMSHDSIGLGEDGPTHQPIEHVPSL 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGAY 551
           R IP+L V RPAD++ET+  W+ A+K K+ PSV+ L+RQNL P ++TQ++  N+ A G Y
Sbjct: 484 RLIPNLNVWRPADTVETMIAWKEAVKSKDTPSVMVLTRQNLMPVVQTQHQVANI-ARGGY 542

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
                P+A++TI ++GSE+++AV+       + I   V S+PC E+F  Q+  Y+  +I 
Sbjct: 543 LVKDNPDAKLTIVATGSEVELAVKVANEFEKKGIKLNVASIPCVEVFATQAQEYKKTVIK 602

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
                + +E      W  ++   G  + G+  FG S   + L++HFG     I ++V +
Sbjct: 603 DDIPAVFVEMAQPDMWYKYMPKAGGEVKGIYSFGESAPAEDLFKHFGFTVENISNIVAK 661


>gi|261346333|ref|ZP_05973977.1| transketolase [Providencia rustigianii DSM 4541]
 gi|282565647|gb|EFB71182.1| transketolase [Providencia rustigianii DSM 4541]
          Length = 664

 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 315/653 (48%), Positives = 427/653 (65%), Gaps = 21/653 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K +A+AIRFLSMDA++   SGHPG PMGMAD+   L+   M  +P  P+W NRDRFVLS 
Sbjct: 5   KTLANAIRFLSMDAVQKAKSGHPGAPMGMADIAEVLWRNHMNHNPANPHWANRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++I+++KNFR + SKT GHPEYG   G+E TTGPLGQGIANA
Sbjct: 65  GHGSMLIYSLLHLTGY-DLSIDELKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGIANA 123

Query: 140 VGMAIAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VG AIAER L  +F      ++DH+TYV +GDGC+MEGIS E  S AG L L+KL+  +D
Sbjct: 124 VGFAIAERTLAAQFNRPSHDIVDHHTYVFMGDGCMMEGISHEVCSLAGTLKLNKLVAFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKA-QLSDKPTMIAC 254
           +NGISIDG +    + D  ARF A GW+ +  ++GHD   I + + +A + +DKPT+I C
Sbjct: 184 DNGISIDGEVEGWFTDDTAARFEAYGWHVIRDIDGHDADQINAAVNEAHKQTDKPTLIMC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAGLRS 312
           +TVIGFGSPN+AGT  VHG+ LG  EI ATR+AL W+  PF IP +I + W  R AG   
Sbjct: 244 KTVIGFGSPNKAGTEAVHGAPLGDAEIAATREALGWNYGPFEIPAEIYQAWDARTAG--- 300

Query: 313 SQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            + ++ W  + ++   +   + KEFERR +  LP  F+       +  + +   IA+RK+
Sbjct: 301 KEKQSAWDVKFAAYAKAYPELAKEFERRMAGELPANFEAEAKQFIENLQQNPANIASRKA 360

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           S+  LE     LPE +GGSADL  SN T  S  K +++ D +G Y+HYGVRE  M+A MN
Sbjct: 361 SQNALEAFGKVLPEFMGGSADLAPSNLTMWSGSKPLNE-DKAGNYIHYGVREFGMSAIMN 419

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           GIALH G  PY  TF++F +Y+R A+R+A+LM IR I V THDSIGLGEDGPTHQPVE L
Sbjct: 420 GIALHGGFIPYGATFLMFVEYARNAVRMAALMKIRSIFVYTHDSIGLGEDGPTHQPVEQL 479

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A+LR  P++   RP D +E+   W+ A++ K+ PS L  SRQNL       +       G
Sbjct: 480 ASLRVTPNMSTWRPCDQVESAVAWKYAIERKDGPSALIFSRQNLEQQPRTAQQLADIEKG 539

Query: 550 AY---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYR 606
           AY   D + TP  ++   ++GSE+++AV+A + L++     RVVS+P  + F +Q  +YR
Sbjct: 540 AYILKDCVGTP--ELIFIATGSEVELAVKAADQLTAEGRKVRVVSMPSTDAFDKQDAAYR 597

Query: 607 AQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGI 658
             ++ SS   ++AIEAG+   W  + G +G+ IGM  FG S   DLL++ FGI
Sbjct: 598 EAVLPSSVSARVAIEAGIADYWYKYTGLNGAIIGMHSFGESAPADLLFKEFGI 650


>gi|332184446|gb|AEE26700.1| Transketolase [Francisella cf. novicida 3523]
          Length = 663

 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 312/661 (47%), Positives = 436/661 (65%), Gaps = 17/661 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA     SGHPG+PMGMAD+ T L+T+ +  +P  P+W NRDRFVLS 
Sbjct: 7   REFSNAIRFLSIDATLKAKSGHPGMPMGMADIATVLWTKFLKHNPNNPHWINRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYAPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L   +      +IDH+TYV +GDGCLMEG+S EA S AG LGL+KL+  WD
Sbjct: 126 VGMALGEKLLSARYNTPDLKIIDHHTYVFLGDGCLMEGVSHEACSLAGTLGLNKLVAFWD 185

Query: 197 NNGISIDGPIS--LADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSD-KPTMI 252
           +N ISIDG      +D+T Q  RFRA GW+ + +V+GHD+ AI   + +A     KPT+I
Sbjct: 186 DNNISIDGDTKGWFSDNTPQ--RFRAYGWHVIENVDGHDYAAIEKAINEAHAQQQKPTLI 243

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
            C+TVIGFGSP +AGT  VHGS L ++E  +  K L+W+  PF IP+DI K W  A  + 
Sbjct: 244 CCKTVIGFGSPEKAGTASVHGSPLSEQERASAAKELDWNYAPFEIPNDIYKYWD-AKEKG 302

Query: 313 SQTRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEHSKPM-IATRKSS 370
               A+WQ +    K++ + +EF+R     LP   +   +N     + + P+ +ATRK+S
Sbjct: 303 KALEANWQNQWDLYKNNPKFEEFDRVLKKQLPANLEQE-VNQYIASQLANPVKVATRKAS 361

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           ++ LEV+   +PE+ GGSADLTGSN T  S    ++ +     YL YGVRE  MAA MNG
Sbjct: 362 QMALEVLCKNMPEMFGGSADLTGSNNTNWSGSVWLNNTQEGANYLSYGVREFGMAAIMNG 421

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           ++L+  + PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDGPTHQP+EH+ 
Sbjct: 422 LSLYGAIKPYGGTFLVFSDYSRNAIRMSALMKQPVVHVMSHDSIGLGEDGPTHQPIEHIP 481

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALG 549
           +LR IP+L V RPAD+IET+  W+ A+K K+ PSV+ L+RQNL P ++TQ++  N+ A G
Sbjct: 482 SLRLIPNLNVWRPADTIETMIAWKEAVKSKDTPSVMVLTRQNLMPIVQTQHQVANI-AKG 540

Query: 550 AYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
            Y     P+A++TI ++GSE+++AV        + ++  V S+PC E+F  Q   Y+  +
Sbjct: 541 GYLVKDNPDAKLTIVATGSEVELAVNVANEFEKKGMNLNVASIPCVEVFATQVQEYKKTV 600

Query: 610 IGSSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           I      + IE      W  ++   G  + G+  FG S   + L+++FG     I ++V 
Sbjct: 601 IKDDIPAVFIEMAQPDIWYKYMPKAGGEVKGIYSFGESAPAEDLFEYFGFTVENISNIVA 660

Query: 669 R 669
           +
Sbjct: 661 K 661


>gi|145588415|ref|YP_001155012.1| transketolase [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145046821|gb|ABP33448.1| transketolase [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 657

 Score =  608 bits (1568), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 318/658 (48%), Positives = 426/658 (64%), Gaps = 16/658 (2%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR LSMDA++  NSGHPG+PMGMAD+   L+ + +  +P  P+W +RDRFVLS GH
Sbjct: 1   MANAIRALSMDAVQQANSGHPGMPMGMADIAVGLWNEHLKHNPTDPHWIDRDRFVLSNGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML Y+LL+L GY D+ IE++KNFR + SKT GHPEYG   G+E TTGPLGQGI+NAVG
Sbjct: 61  GSMLLYSLLHLSGY-DLPIEELKNFRQLHSKTPGHPEYGITPGVETTTGPLGQGISNAVG 119

Query: 142 MAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           MA+AE+ L EEF   G  +IDHYTYV +GDGCLMEGIS E  S AG L L+KLI LWD+N
Sbjct: 120 MALAEKLLAEEFNRPGMDIIDHYTYVFLGDGCLMEGISHEVCSLAGTLKLNKLIALWDDN 179

Query: 199 GISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           GISIDG +    + D   RF A GWN + +V+GHD  A+++ + KA+ SDKPT+I C+T 
Sbjct: 180 GISIDGKVVSWFNEDTPKRFEAYGWNVIRAVDGHDAEAVSAAIAKAKKSDKPTLICCKTA 239

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IG GSPN AG++KVHGS LG  EI ATR ALNW   PF +P DI   W     R      
Sbjct: 240 IGQGSPNMAGSDKVHGSPLGAAEIAATRVALNWPYAPFEVPKDIYTAWDFKK-RGQAAEH 298

Query: 318 DWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
           +W +     K+    +  E +RR    L   F        K  +     IATRK+S+  +
Sbjct: 299 EWNKEFQKYKNKYPELASELQRRMEGELSKDFSATLNAYLKTCQSKAETIATRKASQNAI 358

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           E +   LPE +GGSADLTGSN T  S  KA+ ++D  G +++YGVRE  M+A MNGIALH
Sbjct: 359 EALAPALPEFMGGSADLTGSNLTNWSTCKAV-RADQWGNHINYGVREFGMSAIMNGIALH 417

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            G  P+ GTF+ FSDYSR A+R+A+LM +R I V THDSIGLGEDGPTHQ VE +A+LR 
Sbjct: 418 GGYIPFGGTFLTFSDYSRNALRMAALMKLRSIFVFTHDSIGLGEDGPTHQSVEQVASLRL 477

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYDY 553
           IP+L+V RP D+ E+   W  A++ KN PS L  SRQN PF+ RT  +  ++ A G Y  
Sbjct: 478 IPNLMVWRPCDTTESAVAWGAAIERKNGPSALIFSRQNCPFVSRTAAQIKDI-ARGGYVL 536

Query: 554 ISTPNAQV--TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
           +   + +V   I ++GSE+ +A++  + L    +  R+VS+P   +F +Q  +Y++ ++ 
Sbjct: 537 LDPQSGKVDAVIIATGSEIALALQTAQQLEKEGLGIRIVSMPSTTVFDQQDAAYKSTVLP 596

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
           +   +IA+EAG+   W  +     +  G+  FG S     LY++FG+ A  I   V++
Sbjct: 597 AKIPRIAVEAGVSDFWWKY--GCAAVHGVDTFGESAPAPQLYEYFGLTADQISKTVKQ 652


>gi|91224874|ref|ZP_01260134.1| transketolase [Vibrio alginolyticus 12G01]
 gi|91190420|gb|EAS76689.1| transketolase [Vibrio alginolyticus 12G01]
          Length = 663

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 312/666 (46%), Positives = 426/666 (63%), Gaps = 15/666 (2%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D K +A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +P  P W +RDRFVL
Sbjct: 2   DRKHLANAIRALSMDGVQQANSGHPGAPMGMADIAEVLWRSHLNHNPSNPEWADRDRFVL 61

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           S GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI 
Sbjct: 62  SNGHGSMLIYSLLHLAGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGIT 120

Query: 138 NAVGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVL 194
           NAVGMA+AE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  
Sbjct: 121 NAVGMALAEKALAAQFNKEGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAF 180

Query: 195 WDNNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIA 253
           WD+NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+   +PT+I 
Sbjct: 181 WDDNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKADPRPTLIC 240

Query: 254 CETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSS 313
            +T+IGFGSPN++G++  HG+ LG EEI ATRK L W+  PF IP ++  +W  A    +
Sbjct: 241 TKTIIGFGSPNKSGSHDCHGAPLGAEEIAATRKELGWEHGPFEIPQEVYAEWS-AKETGA 299

Query: 314 QTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSS 370
              A W E+ ++ +++   +  EF+RR +  LP  ++     +    + +   IA+RK+S
Sbjct: 300 AKEAAWNEKFAAYEAAYPELAAEFKRRVNGELPAQWEEKASQIIADLQANPANIASRKAS 359

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           +  LE     LPE +GGSADL  SN T  S  K++  SDFSG Y+HYGVRE  M A MNG
Sbjct: 360 QNALEAFGALLPEFMGGSADLAPSNLTMWSGSKSLEASDFSGNYIHYGVREFGMTAIMNG 419

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           IALH G  PY  TF++F +Y+R A+R+A+LM I+ I V THDSIGLGEDGPTHQPVE +A
Sbjct: 420 IALHGGFVPYGATFLMFMEYARNAMRMAALMKIQNIQVYTHDSIGLGEDGPTHQPVEQMA 479

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
           +LR  P++   RP D +E+   W++A++ K+ P+ L  SRQNL       E     A GA
Sbjct: 480 SLRLTPNMSTWRPCDQVESAVAWKLAIERKDAPTALIFSRQNLAQQERTAEQVADIAKGA 539

Query: 551 Y---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
           Y   D    P  ++ + ++GSE+++AVEA   L++     RVVS+P  + F +Q  +YR 
Sbjct: 540 YILKDCEGKP--ELILIATGSEVELAVEAAAQLTTEGKKVRVVSMPSTDAFDKQDAAYRE 597

Query: 608 QIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDM 666
            ++ S    +IAIEAG+   W  ++G DG  IGM  FG S     L++ FG     +V+ 
Sbjct: 598 SVLPSDVTARIAIEAGIADFWYKYVGFDGRIIGMTSFGESAPAGELFKMFGFTTENVVNT 657

Query: 667 VERKLS 672
            +  L+
Sbjct: 658 AKELLA 663


>gi|254374724|ref|ZP_04990205.1| transketolase [Francisella novicida GA99-3548]
 gi|151572443|gb|EDN38097.1| transketolase [Francisella novicida GA99-3548]
          Length = 663

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 312/659 (47%), Positives = 431/659 (65%), Gaps = 13/659 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA    NSGHPG+PMGMAD+ T L+T+ +  +P  P+W NRDRF+LS 
Sbjct: 7   REFSNAIRFLSIDATLKANSGHPGMPMGMADIATVLWTKFLKHNPNNPHWINRDRFILSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L + +      +IDH+TYV +GDGCLMEG+S EA S AG LGL+KL+  WD
Sbjct: 126 VGMALGEKLLSDRYNTPDLKVIDHHTYVFLGDGCLMEGVSHEACSLAGTLGLNKLVAFWD 185

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +N ISIDG      S +   RFRA GW+ + +V+GHD   I   + +A     KP +I C
Sbjct: 186 DNNISIDGDTKGWFSDNTPERFRAYGWHVIENVDGHDFVGIEKAINEAHSQQQKPALICC 245

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFGSP +AGT  VHGS L  +E  +  K LNW+   F IP D+ K W  A  +   
Sbjct: 246 KTVIGFGSPEKAGTASVHGSPLSDQERASAAKELNWNYQAFEIPQDVYKYWD-AREKGQA 304

Query: 315 TRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEHSKPM-IATRKSSEL 372
             A+WQ + +  K S + +EFER     LP   +   IN     + S P+ +ATRK+S++
Sbjct: 305 LEANWQRQWNLFKDSPKFEEFERVLGKELPVGLEGT-INDYIASQLSNPVKVATRKASQM 363

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LEV+   +PE+ GGSADLTGSN T  S    ++ +     YL YGVRE  MAA MNG++
Sbjct: 364 ALEVLCKNMPEMFGGSADLTGSNNTNWSGSVWLNNTQEGANYLSYGVREFGMAAIMNGLS 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           L+ G+ PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDGPTHQP+EH+ +L
Sbjct: 424 LYGGIKPYGGTFLVFSDYSRNAIRMSALMKQPVVHVMSHDSIGLGEDGPTHQPIEHVPSL 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGAY 551
           R IP+L V RPAD++ET+  W+ A+K K+ PSV+ L+RQNL P ++TQ++  N+ A G Y
Sbjct: 484 RLIPNLNVWRPADTVETMIAWKEAVKSKDTPSVMVLTRQNLMPVVQTQHQVANI-ARGGY 542

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
                P+A++TI ++GSE+++AV+       + I   V S+PC E+F  Q+  Y+  +I 
Sbjct: 543 LVKDNPDAKLTIVATGSEVELAVKVANEFEKKGIKLNVASMPCVEVFATQTQEYKKTVIK 602

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
                + +E      W  ++   G  + G+  FG S   + L++HFG     I ++V +
Sbjct: 603 DDIPAVFVEMAQPDMWYKYMPKAGGEVKGIYSFGESAPAEDLFKHFGFTVENISNIVAK 661


>gi|257092456|ref|YP_003166097.1| transketolase [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257044980|gb|ACV34168.1| transketolase [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 662

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 311/662 (46%), Positives = 434/662 (65%), Gaps = 13/662 (1%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +  +  AIR L+MDA++  NSGHPG+PMGMA++   L+ + +  +P  P+WP+RDRFVLS
Sbjct: 5   FTPLTSAIRALAMDAVQRANSGHPGMPMGMAEIAEVLWRRHLRHNPANPHWPDRDRFVLS 64

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
            GHGSML YA+L+L GY D++I+D+K+FR   SKT GHPE G   G+E TTGPLGQG+AN
Sbjct: 65  NGHGSMLIYAVLHLTGY-DLSIDDLKSFRQFRSKTPGHPEVGHTPGVETTTGPLGQGLAN 123

Query: 139 AVGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLW 195
           AVGMAIAE+ L  EF   G  +++H TYV +GDGCLMEG+S EA S AG LGL KLI  +
Sbjct: 124 AVGMAIAEKVLAAEFNRPGHEIVNHSTYVFLGDGCLMEGVSHEACSLAGTLGLGKLIAFY 183

Query: 196 DNNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTL--RKAQLSDKPTMI 252
           D+NGISIDG +    + D   RF A GW  ++ V+GHD HAI + L   +A+   +PT+I
Sbjct: 184 DDNGISIDGRVEGWFTDDTPQRFAAYGWRVIADVDGHDVHAIDNALLTARAEQDHRPTLI 243

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
            C+T IG GSPN+ G++ VHG+ LG +E+ ATR+ ++W   PF IPD +  +W    +R 
Sbjct: 244 CCKTRIGLGSPNKVGSHDVHGAPLGVDEVAATRRLIDWPHAPFEIPDSVYAQWD-GRMRG 302

Query: 313 SQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
           +   ++W  RL++ +++   +  EF RR    LP  +      +  +    +  +ATRK+
Sbjct: 303 NVFESNWNSRLTAYEAAFPELAAEFSRRMRGELPTDWTAYAAQVLAELAARRDNVATRKA 362

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           S+ VL      LPELIGGSADL GSN T     +AIS+++  G YL+YGVRE AM A  N
Sbjct: 363 SQNVLSAFAPRLPELIGGSADLAGSNLTLWQGSRAISRAE-GGNYLYYGVREFAMTAIAN 421

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           GIALH GL PY+ TF+VFSDY+R AIR+A+LM +R I V THDSIGLGEDGPTHQPVEH+
Sbjct: 422 GIALHGGLIPYTATFLVFSDYARNAIRMAALMKLRQIMVYTHDSIGLGEDGPTHQPVEHV 481

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A LR IP++ V RPAD+ ET   W  A++  + P+VL+LSRQNLP +       ++   G
Sbjct: 482 ACLRLIPNVDVWRPADASETAVAWLAAIERCDGPTVLALSRQNLPAVTAGVAPTSI-RRG 540

Query: 550 AYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
           AY        ++ + ++GSE+ +A++AC  L+   ++ RVVS+PC E+F  Q  +++  +
Sbjct: 541 AYVLAHCAAPRIVLIATGSEVALALDACRALAEDGVAVRVVSMPCAEVFDRQDTAWKESV 600

Query: 610 IGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
           +  +  ++AIEAG+   W  ++G DG+ IG+  FG S   D L+  FG     +V  V+ 
Sbjct: 601 LPHAVPRVAIEAGVSSFWRKYVGLDGAVIGIDRFGESAPADQLFDFFGFTVANVVATVKS 660

Query: 670 KL 671
            L
Sbjct: 661 LL 662


>gi|88812482|ref|ZP_01127731.1| transketolase [Nitrococcus mobilis Nb-231]
 gi|88790268|gb|EAR21386.1| transketolase [Nitrococcus mobilis Nb-231]
          Length = 664

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 313/664 (47%), Positives = 431/664 (64%), Gaps = 16/664 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIR LSMDA++   SGHPG PMGMAD+   L+   +  +P  P W NRDRFVLS 
Sbjct: 5   RELANAIRALSMDAVQRAKSGHPGAPMGMADIAEVLWNDFLRHNPGNPQWCNRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY  +TI D++ FR + SKT GHPE+G   G+E TTGPLGQG+AN+
Sbjct: 65  GHGSMLQYALLHLTGY-GLTIGDLQQFRQLHSKTPGHPEFGYTLGVETTTGPLGQGLANS 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L  +F   G  ++DHYTYV +GDGCLMEGIS EA S AG LGL KLI ++D
Sbjct: 124 VGMAIAEKVLGAQFNRPGHAIVDHYTYVFLGDGCLMEGISHEACSLAGTLGLGKLIAVYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +NGISIDG ++   + D   RF A GW+ +  ++GHD  A+ +   +A+ ++D+PT+I  
Sbjct: 184 DNGISIDGKVAGWFTDDTPGRFEAYGWHVIREIDGHDAEAVKAAFEQARSVADRPTLICA 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFG+PN  GT+ VHG+ LG +EI+ATR+ L+W   PF IP+ I   W  A    ++
Sbjct: 244 KTIIGFGAPNVCGTHGVHGAPLGDDEIRATREFLDWPHPPFHIPEAIYAGWD-AHESGAR 302

Query: 315 TRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
              +W E  +  K +   + + FERR    LP  + +    L ++ +  +  +ATRK+S+
Sbjct: 303 WEREWDEIFADYKRAHPELARTFERRIRGDLPGSWQSLARELVQQADEQRRTVATRKASQ 362

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
           + L      LPELIGGSADLT SN T      A+S+ D  G Y++YGVRE  M+A +NGI
Sbjct: 363 MALNGFGQHLPELIGGSADLTESNNTWWDDCTAVSRQDGDGNYIYYGVREFGMSAIVNGI 422

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY+GTF+VFSDY+R A+R+A+LM IR I V THDSIGLGEDGPTHQP+EHLA 
Sbjct: 423 ALHGGFVPYAGTFLVFSDYARNAVRMAALMKIRSIFVYTHDSIGLGEDGPTHQPIEHLAT 482

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR IP++ + RP D++ET+  WQ AL+ +  P+ LSLSRQNLP      E   L  +   
Sbjct: 483 LRLIPNISLWRPCDAVETVVAWQAALERRTGPTCLSLSRQNLP--HQPREPGQLEQIRRG 540

Query: 552 DYI---STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
            Y+   + P  Q  I ++GSE+ +AV+A E L++     RVVS+P  + F  Q+ +YR  
Sbjct: 541 GYVLRDAGPEPQAIIIATGSEVALAVDAQERLAAEGYRVRVVSMPSVDTFLAQNVAYRES 600

Query: 609 IIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ S+   ++AIEA +   W  F+G  G  +G+  FG S     +YQ FG+     ++ V
Sbjct: 601 VLPSAITARLAIEAAVPDSWLRFVGPQGRILGLSAFGESAPGPDVYQQFGLTVDQAIETV 660

Query: 668 ERKL 671
              L
Sbjct: 661 RNLL 664


>gi|94266586|ref|ZP_01290269.1| transketolase [delta proteobacterium MLMS-1]
 gi|93452781|gb|EAT03316.1| transketolase [delta proteobacterium MLMS-1]
          Length = 667

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 320/659 (48%), Positives = 424/659 (64%), Gaps = 15/659 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K +A+AIR LSMDAI+  NSGHPG P+GMAD+   L+   +  +P  P WP+RDRFV S 
Sbjct: 6   KDLANAIRALSMDAIQQANSGHPGAPLGMADIAQVLWNDFLKHNPANPSWPDRDRFVFSN 65

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y++L+L GYQ +TIED+KNFR + S T GHPEYG   G+E T+GPLGQGIANA
Sbjct: 66  GHGSMLLYSVLHLTGYQ-LTIEDLKNFRQLHSPTPGHPEYGYTPGVETTSGPLGQGIANA 124

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAER L  +F   G  +IDH+TYV +GDGCLMEGIS EA S AG LGL+KLI ++D
Sbjct: 125 VGMAIAERTLAAQFNHPGHAIIDHHTYVFLGDGCLMEGISHEACSLAGTLGLNKLIAIYD 184

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSD-KPTMIAC 254
           +NGISIDG +    + D   RF A GW  + +V+GHD  A+   + +A+  + +PT+I C
Sbjct: 185 DNGISIDGEVGGWFTEDIPGRFEAYGWRVIPAVDGHDPEAVKQAIEQARAEEQRPTLICC 244

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IG  SPN+ G    HG+ LG EEI+ TRK +NW   PF IP++I   W  A  R +Q
Sbjct: 245 KTIIGCCSPNKQGKEICHGAPLGDEEIELTRKEMNWPHPPFVIPEEIAAAWN-ARQRGNQ 303

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W++RL++ +        E ERR +  LP  +     +     E     +A+RK+S+
Sbjct: 304 AEAAWRDRLAAYRQQFPAQAAELERRLAGELPANWPQQATDFIAASEEKAAKVASRKASQ 363

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
           L LE     LPELIGGSADL GSN T  S  + I K    G Y+++GVRE AM A  NG+
Sbjct: 364 LTLEGYGPLLPELIGGSADLAGSNLTIWSGSRDI-KQQADGNYIYFGVREFAMVAIGNGL 422

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY+ TF++FSDY+R AIR+A+LM  R I VLTHDSIGLGEDGPTHQP+E  A+
Sbjct: 423 ALHGGFIPYTATFLIFSDYARNAIRMAALMKQRAIFVLTHDSIGLGEDGPTHQPIEQAAS 482

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGA 550
           LR IP+L V RP D++ET   W+  ++  + PS L LSRQ LP   RT  +S ++ A G 
Sbjct: 483 LRLIPNLHVWRPCDAVETAVAWKAGVERVDGPSALLLSRQGLPHQSRTAQQSADI-ARGG 541

Query: 551 YDYISTPNAQVTI-FSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
           Y  +       TI  ++GSE+++A+ A   L+ +    RVVS+PC ELF  Q ++YR Q+
Sbjct: 542 YVLLDCQGQPETILLATGSEVELAMAAARQLNEQGRKIRVVSLPCLELFAAQDEAYRQQV 601

Query: 610 IGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           +  S   ++AIEAG   GW  ++G  G  IG+  FG S   + L++ FG     +V  V
Sbjct: 602 LPDSVEHRVAIEAGCTAGWYKYVGRRGQVIGLDRFGESAPAEQLFELFGFTVEKVVAAV 660


>gi|328470935|gb|EGF41846.1| transketolase [Vibrio parahaemolyticus 10329]
          Length = 663

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 312/666 (46%), Positives = 428/666 (64%), Gaps = 15/666 (2%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D K +A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +P  P W +RDRFVL
Sbjct: 2   DRKYLANAIRALSMDGVQQANSGHPGAPMGMADIAEVLWRSHLNHNPSNPEWADRDRFVL 61

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           S GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI 
Sbjct: 62  SNGHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGIT 120

Query: 138 NAVGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVL 194
           NAVGMA+AE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  
Sbjct: 121 NAVGMAMAEKALAAQFNKEGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAF 180

Query: 195 WDNNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIA 253
           WD+NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+   +PT+I 
Sbjct: 181 WDDNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKADPRPTLIC 240

Query: 254 CETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSS 313
            +T+IGFGSPN++G++  HG+ LG EEI ATRK L W+  PF IP ++  +W  A    +
Sbjct: 241 TKTIIGFGSPNKSGSHDCHGAPLGAEEIAATRKELGWEHGPFEIPQEVYAEWS-AKETGA 299

Query: 314 QTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSS 370
              A W E+ ++ +++   +  EF+RR +  LP  ++     +    + +   IA+RK+S
Sbjct: 300 AKEAAWNEKFAAYEAAYPELAAEFKRRVNGELPAEWEEKASQIIADLQANPANIASRKAS 359

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           +  LE     LPE +GGSADL  SN T  S  K++  +DFSG Y+HYGVRE  M A MNG
Sbjct: 360 QNALEAFGALLPEFMGGSADLAPSNLTMWSGSKSLEANDFSGNYIHYGVREFGMTAIMNG 419

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           IALH G  PY  TF++F +Y+R A+R+A+LM I+ I V THDSIGLGEDGPTHQPVE +A
Sbjct: 420 IALHGGFVPYGATFLMFMEYARNAMRMAALMKIQNIQVYTHDSIGLGEDGPTHQPVEQMA 479

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
           +LR  P++   RP D +E+   W++A++ K+ P+ L  SRQNL       E     A GA
Sbjct: 480 SLRLTPNMNTWRPCDQVESAVAWKLAIERKDAPTALIFSRQNLAQQPRSAEQVADIAKGA 539

Query: 551 Y---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
           Y   D    P  ++ + ++GSE+++AV+A E L++     RVVS+P  + F +Q  +YR 
Sbjct: 540 YILKDSEGKP--ELILIATGSEVELAVKAAEQLTAEGKKVRVVSMPSTDAFDKQDAAYRE 597

Query: 608 QIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDM 666
            ++ S    +IAIEAG+   W  ++G DG  IGM  FG S   D L++ FG     +V+ 
Sbjct: 598 AVLPSDVTARIAIEAGIADFWYKYVGFDGRIIGMTTFGESAPADQLFEMFGFTVENVVNT 657

Query: 667 VERKLS 672
            +  L+
Sbjct: 658 AKELLA 663


>gi|54293101|ref|YP_125516.1| transketolase [Legionella pneumophila str. Lens]
 gi|53752933|emb|CAH14369.1| hypothetical protein lpl0139 [Legionella pneumophila str. Lens]
          Length = 668

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 318/663 (47%), Positives = 426/663 (64%), Gaps = 15/663 (2%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           + + ++A+A+R LS+DA+    SGHPG+P+GMAD+ T L+ + + F+PQ P+W NRDRFV
Sbjct: 2   NSFTELANAVRMLSIDAVNQAQSGHPGMPLGMADIATVLWKKFLKFNPQNPHWFNRDRFV 61

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GHGSML Y+LL+L GY ++ I ++KNFR + SKT GHPE+G   G+E TTGPLGQG+
Sbjct: 62  LSNGHGSMLLYSLLHLTGY-NLDIGELKNFRQLHSKTPGHPEHGHTPGVETTTGPLGQGL 120

Query: 137 ANAVGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIV 193
           AN+VGMA+AER L   F      L+DHYTY   GDGCLMEGIS EA S AG LGL KLIV
Sbjct: 121 ANSVGMALAERVLASTFNHDHFNLVDHYTYTFAGDGCLMEGISHEACSLAGTLGLGKLIV 180

Query: 194 LWDNNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKA-QLSDKPTM 251
            +D+NGISIDG +    + D  +RF+A  W  +  ++GHD + I   + +A + + +P++
Sbjct: 181 FYDDNGISIDGKVESWFTDDTTSRFKAYNWQVIGPIDGHDANQIEHAISEARENTTQPSL 240

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAG 309
           I C+TVIG GS + AG+ K HGS L  ++I   R+  NW    F IPD I K+W  +  G
Sbjct: 241 IICKTVIGLGS-SVAGSEKAHGSPLSAQDISNVREFFNWKHASFEIPDSIYKQWNHKEQG 299

Query: 310 LRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            +  Q              S   +F RR +  LPD +        K+  +++  IATRK+
Sbjct: 300 EKEEQLWLQLLHEYQQQYPSEHDDFLRRANGDLPDDWQEISAGFLKQCLNNEKAIATRKA 359

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           S+  +E     LPE+ GGSADLTGSN T  S  KAI+  +FSG YL+YGVRE AMAA MN
Sbjct: 360 SQQCIEFFAPILPEMFGGSADLTGSNNTDWSGSKAITAHNFSGNYLYYGVREFAMAAIMN 419

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+A+H G  PY GTF+VF+DY+R AIRL++LM  RVI+VLTHDSIGLGEDGPTHQPVEH+
Sbjct: 420 GLAVHGGFIPYGGTFLVFADYARNAIRLSALMKQRVIYVLTHDSIGLGEDGPTHQPVEHI 479

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A LR  P + V RPAD +ET   WQ +L+  N PS L LSRQNLP L    ++ +L   G
Sbjct: 480 AMLRMTPGMTVWRPADLMETAVAWQQSLEHHNGPSALLLSRQNLPALAHGTDAADLIKKG 539

Query: 550 AY---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYR 606
            Y   D    P+A   + ++GSE+++A+ A E   +R +  RVVS+PC E F  QSD Y+
Sbjct: 540 GYIIADCEGKPDA--ILIATGSEVQLAITAAEKAKARGLQVRVVSMPCAEQFLAQSDDYK 597

Query: 607 AQII-GSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
            QI+ G    +IAIEA     W  F+G DG+ IG+  FG S      + + GI    I++
Sbjct: 598 NQILPGQVRTRIAIEAASSAYWHQFVGFDGAVIGLDCFGVSAPATDAFNYLGITVEKIIN 657

Query: 666 MVE 668
            ++
Sbjct: 658 TLD 660


>gi|94263195|ref|ZP_01287012.1| transketolase [delta proteobacterium MLMS-1]
 gi|93456413|gb|EAT06533.1| transketolase [delta proteobacterium MLMS-1]
          Length = 667

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 320/659 (48%), Positives = 423/659 (64%), Gaps = 15/659 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K +A+AIR LSMDAI+  NSGHPG P+GMAD+   L+   +  +P  P WP+RDRFV S 
Sbjct: 6   KDLANAIRALSMDAIQQANSGHPGAPLGMADIAQVLWNDFLKHNPANPSWPDRDRFVFSN 65

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y++L+L GYQ +TIED+KNFR + S T GHPEYG   G+E T+GPLGQGIANA
Sbjct: 66  GHGSMLLYSVLHLTGYQ-LTIEDLKNFRQLHSPTPGHPEYGYTPGVETTSGPLGQGIANA 124

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAER L  +F   G  +IDH+TYV +GDGCLMEGIS EA S AG LGL+KLI ++D
Sbjct: 125 VGMAIAERTLAAQFNHPGHAIIDHHTYVFLGDGCLMEGISHEACSLAGTLGLNKLIAIYD 184

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSD-KPTMIAC 254
           +NGISIDG +    + D   RF A GW  + +V+GHD  A+   + +A+  + +PT+I C
Sbjct: 185 DNGISIDGEVDGWFTEDIPGRFEAYGWRVIPAVDGHDPEAVKQAIEQARAEEQRPTLICC 244

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IG  SPN+ G    HG+ LG EEI+ TRK +NW   PF IP++I   W  A  R  Q
Sbjct: 245 KTIIGCCSPNKQGKEICHGAPLGDEEIELTRKEMNWPHPPFVIPEEIAAAWN-ARQRGDQ 303

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W++RL++ +        E ERR +  LP  +     +     E     +A+RK+S+
Sbjct: 304 AEAAWRDRLAAYRQQFPAQAAELERRLAGELPANWPQQATDFIAASEEKAAKVASRKASQ 363

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
           L LE     LPELIGGSADL GSN T  S  + I K    G Y+++GVRE AM A  NG+
Sbjct: 364 LTLEGYGPLLPELIGGSADLAGSNLTIWSGSRDI-KQQADGNYIYFGVREFAMVAIGNGL 422

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY+ TF++FSDY+R AIR+A+LM  R I VLTHDSIGLGEDGPTHQP+E  A+
Sbjct: 423 ALHGGFIPYTATFLIFSDYARNAIRMAALMKQRAIFVLTHDSIGLGEDGPTHQPIEQAAS 482

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGA 550
           LR IP+L V RP D++ET   W+  ++  + PS L LSRQ LP   RT  +S ++ A G 
Sbjct: 483 LRLIPNLHVWRPCDAVETAVAWKAGVERVDGPSALLLSRQGLPHQSRTAQQSADI-ARGG 541

Query: 551 YDYISTPNAQVTI-FSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
           Y  +       TI  ++GSE+++A+ A   L+ +    RVVS+PC ELF  Q ++YR Q+
Sbjct: 542 YVLLDCQGQPETILLATGSEVELAMAAARQLNEQGRKIRVVSLPCLELFAAQDEAYRQQV 601

Query: 610 IGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           +  S   ++AIEAG   GW  ++G  G  IG+  FG S   + L++ FG     +V  V
Sbjct: 602 LPDSVEHRVAIEAGCTAGWYKYVGRRGQVIGLDRFGESAPAEQLFELFGFTVEKVVAAV 660


>gi|163802932|ref|ZP_02196819.1| transketolase [Vibrio sp. AND4]
 gi|159173222|gb|EDP58050.1| transketolase [Vibrio sp. AND4]
          Length = 668

 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 311/664 (46%), Positives = 428/664 (64%), Gaps = 15/664 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K +A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +P  P W +RDRFVLS 
Sbjct: 9   KHLANAIRALSMDGVQQANSGHPGAPMGMADIAEVLWRSHLNHNPSNPEWADRDRFVLSN 68

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI NA
Sbjct: 69  GHGSMLIYSLLHLAGY-DLSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGITNA 127

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  +F   G  ++DH+TY  +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 128 VGMAMAEKALAAQFNQEGHDIVDHFTYAFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 187

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACE 255
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+   +PT+I  +
Sbjct: 188 DNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDPEAINAAILAAKADPRPTLICTK 247

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IGFGSPN++G++  HG+ LG EEI ATRKAL W+  PF IP ++  +W    + +++ 
Sbjct: 248 TIIGFGSPNKSGSHDCHGAPLGAEEIAATRKALGWEHGPFEIPQEVYAEWSAKEVGAAK- 306

Query: 316 RADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A W E+ ++ +++   +  EF+RR +  LP  ++     +    + +   IA+RK+S+ 
Sbjct: 307 EAAWNEKFAAYEAAYPELAAEFKRRVNGDLPAQWEAKANQIIADLQANPANIASRKASQN 366

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LE     LPE +GGSADL  SN T  S  K++  SDFSG Y+HYGVRE  M A MNGIA
Sbjct: 367 ALEAFGQMLPEFMGGSADLAPSNLTMWSGSKSLEASDFSGNYIHYGVREFGMTAIMNGIA 426

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G  PY  TF++F +Y+R A+R+A+LM I+ I V THDSIGLGEDGPTHQPVE +A+L
Sbjct: 427 LHGGFVPYGATFLMFMEYARNAMRMAALMKIQNIQVYTHDSIGLGEDGPTHQPVEQVASL 486

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY- 551
           R  P++   RP D +E+   W++A++ K+ PS L  SRQNL       E     A G Y 
Sbjct: 487 RLTPNMSTWRPCDQVESAVAWKLAIERKDGPSALIFSRQNLAQQARSTEQVADIAKGGYV 546

Query: 552 --DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
             D    P  ++ + ++GSE+++AV+A + L++     RVVS+P  + F +Q  +YR  +
Sbjct: 547 LKDSDGKP--ELILIATGSEVELAVKAADQLTAEGKKVRVVSMPSTDAFDKQDAAYRESV 604

Query: 610 IGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           + S    +IAIEAG+   W  ++G DG  IGM  FG S   D L++ FG     +V+  +
Sbjct: 605 LPSDVTARIAIEAGIADFWYKYVGFDGRIIGMTTFGESAPADQLFEMFGFTVENVVNTAQ 664

Query: 669 RKLS 672
             L+
Sbjct: 665 ELLA 668


>gi|255020277|ref|ZP_05292345.1| Transketolase [Acidithiobacillus caldus ATCC 51756]
 gi|254970197|gb|EET27691.1| Transketolase [Acidithiobacillus caldus ATCC 51756]
          Length = 665

 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 315/658 (47%), Positives = 432/658 (65%), Gaps = 13/658 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           +A+AIR LSMDAIE   SGHPG+PMGMAD+   L+   +V +P  P+WPNRDRF+LS GH
Sbjct: 8   LANAIRVLSMDAIEKAKSGHPGMPMGMADIAEVLWNDFLVHNPADPHWPNRDRFLLSNGH 67

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L GY D++I+D+K FR   SKT GHPEY    G+E TTGPLGQG+AN VG
Sbjct: 68  GSMLQYALLHLTGY-DLSIDDLKQFRQWHSKTPGHPEYRDTPGVETTTGPLGQGLANGVG 126

Query: 142 MAIAERKLREEFG---DVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           MA+AE+ L   F      +I+HYTYV +GDGCLMEGIS EA S AG  GL+KLI  +D+N
Sbjct: 127 MALAEQILGRHFNRPDHEIINHYTYVFLGDGCLMEGISHEACSLAGVWGLNKLICFYDDN 186

Query: 199 GISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIACET 256
            ISIDG +    + D  ARFRA GW+ +  V+GHD  A+   + +A+  + KPT+I C+T
Sbjct: 187 NISIDGHVDDWFADDTPARFRAYGWHVIPGVDGHDPEAVKKAILEARAQTTKPTLICCKT 246

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIG GSPN+AGT+ VHG+ LG EEI  TRK L W  +PF +P+ I + +   G +  Q +
Sbjct: 247 VIGHGSPNKAGTHDVHGAPLGAEEIALTRKNLGWSGEPFEVPEAIYRAFDARG-KGEQAQ 305

Query: 317 ADWQERLSSMKSSIRK---EFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
           A+W+ER +  +    +   E ERR++      FD A  +L  +F    P IATR +S   
Sbjct: 306 AEWKERFAKYRELFPQDAAELERRWAGKASPEFDRAIADLIAEFRKDPPKIATRVASGKC 365

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           ++ V   +PE +GGSADLT SN T+  +   I K    G Y+HYGVRE  MAA MNG+AL
Sbjct: 366 IQAVAKAVPEFVGGSADLTPSNNTRWKEALDIGKHRLMGNYIHYGVREFGMAAIMNGMAL 425

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           + GL P+ GTF++FSDY+R AIR+++LMG+RVI+++THDSIGLGEDGPTHQPVE + +LR
Sbjct: 426 YGGLLPFGGTFLIFSDYARNAIRMSALMGLRVIYIMTHDSIGLGEDGPTHQPVEQVNSLR 485

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY 553
            +P+L V RPAD++ET   W++++K++  PS+L+LSRQNL  L     +      G Y  
Sbjct: 486 LVPNLHVWRPADAVETATAWEISVKQERTPSLLALSRQNLAPLPHSDATIAGARRGGYVL 545

Query: 554 ISTPNAQVT--IFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
                 +    + ++GSE+++A+ A   L+ R ++ RVVS+PC ELF  Q  +YR  ++ 
Sbjct: 546 KDAEGGEPAGILIATGSEVELALAAQARLAERGVAVRVVSMPCVELFDAQDANYRESVLP 605

Query: 612 SSPI-KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           S    ++AIEAG    W  ++G  G+ IG+  FGAS    ++++  G     IVD  +
Sbjct: 606 SKVTRRLAIEAGTTALWYKYVGLQGAVIGIDRFGASAPAPVIFEKLGFTVDHIVDTFQ 663


>gi|317154252|ref|YP_004122300.1| transketolase [Desulfovibrio aespoeensis Aspo-2]
 gi|316944503|gb|ADU63554.1| transketolase [Desulfovibrio aespoeensis Aspo-2]
          Length = 671

 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 314/669 (46%), Positives = 432/669 (64%), Gaps = 19/669 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LSMDAI+   SGHPG PMGMAD+   L+   MV +P  P W NRDRFVLS 
Sbjct: 5   KELANAIRALSMDAIQKAKSGHPGAPMGMADIAEVLWNDYMVHNPANPDWANRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY DVTI+DIKNFR + S+T GHPEYG   G+E+T+GPLGQGIA A
Sbjct: 65  GHGSMLLYSLLHLSGY-DVTIDDIKNFRQLHSRTPGHPEYGMTPGVESTSGPLGQGIACA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+    +F   G  ++DH+TYV +GDGC+MEG+S EA S AG L L KL   +D
Sbjct: 124 VGMAVAEKVFAAQFNRDGHSIMDHHTYVFMGDGCMMEGVSHEACSLAGTLKLGKLFAFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLS-DKPTMIAC 254
           +NGISIDG +    + D   RF A GW+ +  V+GHD  +I + + +A+ + DKP++I C
Sbjct: 184 DNGISIDGCVDGWFTDDTPGRFEAYGWHVVRDVDGHDASSIKAAIEEARANKDKPSLICC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIG G+PN  G+ K HGS LG +EI   R+ ++W   PF IP  I  +W   G     
Sbjct: 244 KTVIGQGAPNICGSEKCHGSPLGNDEIACARENMDWPHPPFEIPKMIYSRWSAKG-NGFM 302

Query: 315 TRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
               W  R    + +   +  EF RR +  LP+ F +   N     +     +ATRKSS+
Sbjct: 303 AEDSWNARFKEYEKAYPHLATEFTRRMTGTLPEDFASHTSNFIDSVDVKAESLATRKSSQ 362

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             +E +   LPE  GGSADL GSN T+ S  K  S +++ G Y++YGVRE AM+  MNG+
Sbjct: 363 NAIEGLAPVLPEFFGGSADLAGSNLTRWSGSKTASSAEWDGNYMNYGVREFAMSVMMNGM 422

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           +LH G  PY GTF+VFSDY+R A+R+++LMG++V++V+THDSIG+GEDGPTHQPVEH+A+
Sbjct: 423 SLHGGFIPYGGTFLVFSDYARNAMRMSALMGLKVLYVMTHDSIGVGEDGPTHQPVEHVAS 482

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR IP++ V RP DS+ET   W+ A+   + PS L +SRQNLP+     E+ +  + G Y
Sbjct: 483 LRLIPNMDVWRPCDSVETAVAWEQAVTRGDGPSTLVMSRQNLPYQSRSTETMDQISRGGY 542

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D   TP+A   + ++GSE+ +AVEA   L S+    RVVS+PC E F  Q  +YR  
Sbjct: 543 VLRDCDGTPDA--ILIATGSEVGLAVEAAMTLESKGTQVRVVSIPCVEAFDRQDQAYRRA 600

Query: 609 IIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGI---NAIAIV 664
           ++      ++AIEAG   GW  ++G +G+ +G+  FG S   + L+ +FG    N +A+V
Sbjct: 601 VLPPRVTARVAIEAGTTLGWYRYVGLNGAVMGIDRFGESAPGNELFDYFGFTPDNVMALV 660

Query: 665 DMVERKLSV 673
           + V  K S+
Sbjct: 661 EQVMEKTSM 669


>gi|300112996|ref|YP_003759571.1| transketolase [Nitrosococcus watsonii C-113]
 gi|299538933|gb|ADJ27250.1| transketolase [Nitrosococcus watsonii C-113]
          Length = 665

 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 311/663 (46%), Positives = 429/663 (64%), Gaps = 12/663 (1%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIR LSMDA++   SGHPG PMGMAD+   L+   +  +P  P+W NRDRFVLS 
Sbjct: 5   RELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWNNFLTHNPNNPHWVNRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY DV++ED+K FR + SKT GHPEYG   GIE TTGPLGQG++NA
Sbjct: 65  GHGSMLLYSLLHLSGY-DVSMEDLKQFRQLHSKTPGHPEYGYAPGIETTTGPLGQGLSNA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  +F   G  ++DHYTYV +GDGCLMEGIS E+ + AG  GL KL+  +D
Sbjct: 124 VGMALAEKVLAGQFNRDGHEIVDHYTYVFLGDGCLMEGISHESCALAGTWGLGKLVAFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +NGISIDG ++   + D   RF A GW+ +  V+GHD  A+     +A+ + DKPT+I C
Sbjct: 184 DNGISIDGDVAGWFTDDTPKRFDAYGWHVIRDVDGHDSEAVRRATEEARSVIDKPTLICC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IG+G+PN AG+   HG+ LG++EI ATR  L W   PF IP++I + W     +   
Sbjct: 244 KTLIGYGAPNLAGSGDCHGAPLGEDEIFATRDKLGWSYPPFEIPEEIYEGWD-GTEKGKA 302

Query: 315 TRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W ++L + +++   +  EF+RR    LP+ ++       +        IATRK+S+
Sbjct: 303 AEAAWDKKLVAYQAAYPELAAEFKRRLQHKLPENWEATVAEAIQAAAVKAEKIATRKASQ 362

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE     LPEL+GGSADLTGSN T  S  K ISK+   G Y+HYGVRE  M+A MNGI
Sbjct: 363 NALEAYAPVLPELLGGSADLTGSNLTHWSGSKVISKTAPEGNYIHYGVREFGMSAIMNGI 422

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY GTF++FS+Y+R A+R+A+LMG++ I V THDSIGLGEDGPTHQ VE  A 
Sbjct: 423 ALHGGFIPYGGTFLMFSEYARNAVRMAALMGVQSIFVYTHDSIGLGEDGPTHQAVEQAAT 482

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR IP + V RP D++E+L  W+ A++ +  P+ L  SRQ LP  +   E       G Y
Sbjct: 483 LRYIPRMSVWRPCDAVESLVAWRAAIERQEGPTSLLFSRQGLPPQKRTPEQIENIRRGGY 542

Query: 552 DYISTPNA-QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
               T +   V + ++GSE+ +A+EA E L S+ I  RVVS+PC ++F  QS +YR  I+
Sbjct: 543 ILRDTEDKPDVIMVATGSEVALAMEAAETLGSKGIQARVVSMPCTDVFDAQSKAYREAIL 602

Query: 611 GSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
            S    ++A+EAG+   W  ++G +G   G+  FG S   + +Y+HFG+ A  +  + E 
Sbjct: 603 PSEVRARVAVEAGITDYWRKYVGLEGKVSGIDTFGESAPAEDVYRHFGLTAENLAKIAED 662

Query: 670 KLS 672
            +S
Sbjct: 663 MVS 665


>gi|92112517|ref|YP_572445.1| transketolase [Chromohalobacter salexigens DSM 3043]
 gi|91795607|gb|ABE57746.1| transketolase [Chromohalobacter salexigens DSM 3043]
          Length = 663

 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 317/664 (47%), Positives = 420/664 (63%), Gaps = 18/664 (2%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIR LSMDA++  NSGHPG PMGMAD+   L+   +  +P  P+W NRDRFVLS G
Sbjct: 6   EMANAIRALSMDAVQKANSGHPGAPMGMADIAQVLWHDYLAHNPANPHWANRDRFVLSNG 65

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y+LL+L GY D+++ED++NFR + SKTAGHPE G   GIE TTGPLGQG+ANAV
Sbjct: 66  HGSMLLYSLLHLTGY-DISLEDLQNFRQLHSKTAGHPELGYAPGIETTTGPLGQGLANAV 124

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMAIAER L  +F   G  ++DH+TYV VGDGCLMEGIS E  S AG  GL KLI  +D 
Sbjct: 125 GMAIAERTLAAQFNRPGHDIVDHHTYVFVGDGCLMEGISHEVASLAGTQGLGKLIAFYDA 184

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSD-KPTMIACE 255
           NGISIDG +    + D   RF + GW+ + +V+GHD  A+ + +  A+ +D KP+MI C+
Sbjct: 185 NGISIDGEVEGWFTDDTAKRFESYGWHVVPNVDGHDPEAVKAAIELARTNDDKPSMIICK 244

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IGFG+PN+ G  + HG+ALG++E+ A R+ L W   PF +P+DI + W  A  R  + 
Sbjct: 245 TIIGFGAPNKQGKEESHGAALGEDEVAAAREQLGWSHPPFHVPEDIYQAWD-ATQRGREA 303

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            ADW  R +  +++     +E ERR    LP    +    L ++ +     +A+RK+S  
Sbjct: 304 EADWDARFARYQAAYPEEARELERRLKGELPAALTSE--KLIEEAQEKGESLASRKASLA 361

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            L  +   LPEL+GGSADL  SN T     KAI++S+ SG YLHYGVRE  MAA MNGIA
Sbjct: 362 CLNELGPQLPELLGGSADLAPSNLTFWKGAKAITQSEASGNYLHYGVREFGMAAIMNGIA 421

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G  PY  TF++F +Y R A+R+A+LMG RVIHV THDSIGLGEDGPTHQP+E L  L
Sbjct: 422 LHGGFVPYGATFLIFMEYMRNAVRMAALMGQRVIHVFTHDSIGLGEDGPTHQPIEQLTTL 481

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY- 551
           R+ P+L   RP D++ET   W  ALK +  PS L LSRQ LP      +     A G Y 
Sbjct: 482 RSTPNLATWRPCDAVETAVAWDAALKRQAGPSALVLSRQGLPHQARSKQQLADIARGGYI 541

Query: 552 --DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
             D   TP   + + ++GSE+ +A++A   L +     RVVS+P  + F  Q   YR  +
Sbjct: 542 LKDSQGTP--ALILIATGSEVGLAMDAAAELENAGTPVRVVSMPSTDTFDAQDADYREAV 599

Query: 610 IGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           +  +   ++AIEAG R  W  ++G DG  +GM  FG S     L++HFG     +V   +
Sbjct: 600 LPRAVTARLAIEAGHRDFWFKYVGLDGRIVGMTTFGESAPAGDLFKHFGFTVDNVVAEAK 659

Query: 669 RKLS 672
             LS
Sbjct: 660 ALLS 663


>gi|309790536|ref|ZP_07685094.1| transketolase [Oscillochloris trichoides DG6]
 gi|308227452|gb|EFO81122.1| transketolase [Oscillochloris trichoides DG6]
          Length = 673

 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 317/662 (47%), Positives = 435/662 (65%), Gaps = 16/662 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ A+AIR L++D ++  NSGHPGLP+GMAD    L+ + +  +P  P+WPNRDRF+LSA
Sbjct: 16  QRCANAIRALAIDGVQKANSGHPGLPLGMADAAYVLWAKFLSHNPSDPHWPNRDRFILSA 75

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY DV+++D+K FR +GSKT GHPEY    G+E TTGPLGQG+A A
Sbjct: 76  GHGSMLIYALLHLTGY-DVSLDDLKQFRQVGSKTPGHPEYHDTPGVEMTTGPLGQGVATA 134

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AER L   F   G  ++DHYTYVL GDG LMEGISQEA S AGHL L KLI L+D
Sbjct: 135 VGMALAERWLATTFNRPGMPIVDHYTYVLCGDGDLMEGISQEAASLAGHLKLGKLIYLYD 194

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDKPTMIACE 255
           +N IS+ GP SLA S D  ARF ASGW  L  +GH+   + S L +A+  +++P++I C 
Sbjct: 195 SNNISLVGPTSLAFSEDVAARFAASGWQVLHADGHNMSEVGSALAEAKADTERPSIIICT 254

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDP-FFIPDDIMKKWRLAGLRSSQ 314
           T IG+GSP +  ++  HG  LG   +  T++  NW  +P FF+PD++  + R+A    + 
Sbjct: 255 THIGYGSPKQ-DSHGAHGEPLGAANVAKTKEFFNWPTEPDFFVPDEVYDQMRVAVEVGAA 313

Query: 315 TRADWQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
            + +W+  L+  K S  ++   ++R  S  LP      ++     F        TR +S 
Sbjct: 314 RQREWEATLARYKESYPEQGALWDRMLSGDLP----ADWLTSLPTFPTDPKAKGTRVASG 369

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
            VL  +   +P L+GGSADL  S+ T      +I+ +DFSGR +HYGVREH M AAMNG+
Sbjct: 370 DVLNAIAATVPSLLGGSADLHTSDQTYLKNYGSITPTDFSGRNVHYGVREHLMGAAMNGM 429

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G+ PY GTF VFSDY RPAIRLA+LM +RV++V THDSIG+GEDGPTHQPVEHLAA
Sbjct: 430 ALHGGVIPYGGTFFVFSDYLRPAIRLAALMKLRVVYVFTHDSIGVGEDGPTHQPVEHLAA 489

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCAL-GA 550
           LR IP+L V R  D+ E    W++AL+ ++ P+ L  +RQN+P L  +  ++   +L G 
Sbjct: 490 LRVIPNLYVFRAGDANEAAMGWRLALERRDGPTALIFTRQNVPTLDREVLASAEGSLRGG 549

Query: 551 YDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
           Y   S  N QV +  +GSEL +A+EA ++L+++ ++ +VVS+PC+ELF  Q  +YR  ++
Sbjct: 550 YVLRSVENPQVILIGTGSELSMALEAADLLAAQGVAAQVVSLPCWELFEAQDQAYRDSVL 609

Query: 611 GSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
             S   ++A+EAG+  GWD ++G  G+ +GM  FGASG    LY  FGI A  +     R
Sbjct: 610 PPSISARVAVEAGVSMGWDRYVGPQGAVVGMSSFGASGPAPQLYAKFGITAQQVAAAAMR 669

Query: 670 KL 671
            L
Sbjct: 670 VL 671


>gi|297568451|ref|YP_003689795.1| transketolase [Desulfurivibrio alkaliphilus AHT2]
 gi|296924366|gb|ADH85176.1| transketolase [Desulfurivibrio alkaliphilus AHT2]
          Length = 663

 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 320/661 (48%), Positives = 426/661 (64%), Gaps = 17/661 (2%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+A+R LSMDA++  NSGHPG PMGMAD+   L+   +  +P  P WP+RDRFV S G
Sbjct: 7   QLANAVRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLKHNPGNPAWPDRDRFVFSNG 66

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y++L+L GY D+ IE+IKNFR + SKT GHPEYG   G+E T+GPLGQGIANAV
Sbjct: 67  HGSMLLYSVLHLSGY-DLGIEEIKNFRQLHSKTPGHPEYGYTPGVETTSGPLGQGIANAV 125

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMAIAER L  +F   G  ++DH+TYV +GDGC+MEGIS EA S AG LGL+KLI ++D+
Sbjct: 126 GMAIAERTLAAQFNRPGHEIVDHHTYVFLGDGCMMEGISHEACSLAGTLGLNKLIAIYDD 185

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLSD-KPTMIACE 255
           NGISIDG +    + D   RF A GW  ++ V+GHD  AI + + +A+    KPT+I C+
Sbjct: 186 NGISIDGEVEGWFTEDIPGRFAAYGWKVIAEVDGHDPEAIKAAINEARAEQAKPTLICCK 245

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG  SPN+ G    HG+ LG+EEI  TR  ++W   PF IP +I   W  A  R  Q 
Sbjct: 246 TIIGCCSPNKQGKEICHGAPLGEEEIALTRAEMDWPHGPFEIPAEIYAGWN-ARERGGQA 304

Query: 316 RADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A WQE+L++ + +      E +RR +  LP  +         + E     +A+RK+S+L
Sbjct: 305 EAAWQEKLAAYQQAHPEAAAELKRRLAGELPADWAAKSQAFIAESEAKAAKVASRKASQL 364

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LE     LPELIGGSADL GSN T  S  K I K D +G Y+++GVRE AM A  NG+A
Sbjct: 365 ALEGYGPLLPELIGGSADLAGSNLTIWSGSKDI-KQDQAGNYIYFGVREFAMVAIGNGLA 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G  PY+ TF++FSDY+R AIR+A+LM  R + VLTHDSIGLGEDGPTHQP+E  ++L
Sbjct: 424 LHGGFIPYTATFLIFSDYARNAIRMAALMKQRALFVLTHDSIGLGEDGPTHQPIEQTSSL 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY- 551
           R IP+L V RP D++ET   WQ A++ K  PS L LSRQ LP      E +   A G Y 
Sbjct: 484 RLIPNLNVWRPCDAVETAVAWQQAVERKEGPSALLLSRQGLPHQERSAEQSAAIARGGYV 543

Query: 552 --DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
             D  +TP  ++ I ++GSE+++AV A E L+ +   TRVVS+PC E+F  Q ++Y+ Q+
Sbjct: 544 LRDCDTTP--ELIIMATGSEVELAVAAAEQLNQQGRPTRVVSLPCVEVFEAQDEAYQQQV 601

Query: 610 IGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           +  +  K IAIEAG   GW  ++G  G  IG+  FG S     L++ FG     + +   
Sbjct: 602 LPDAVSKRIAIEAGCTTGWYKYVGRKGQVIGLDRFGESAPAGELFKLFGFTVEKVAEAAA 661

Query: 669 R 669
           R
Sbjct: 662 R 662


>gi|309379721|emb|CBX21710.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 659

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 314/660 (47%), Positives = 437/660 (66%), Gaps = 12/660 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIRFLS DA++  NSGHPG PMGMA++   L+T+ +  +P  P + NRDRF+LS G
Sbjct: 3   QLANAIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHNPANPKFYNRDRFILSNG 62

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML Y+LL+L GY +++IED+KNFR + SKT GHPEYG   G+E TTGPLGQGIANAV
Sbjct: 63  HASMLLYSLLHLTGY-NLSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANAV 121

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DHYTYV +GDGCLMEG+S EA S AG LGL KLIVL+D+
Sbjct: 122 GMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEACSLAGTLGLGKLIVLYDD 181

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIACE 255
           N ISIDG +    + +   RF + GW+ + +VNGHD  AI + +  A+  + KP++I C+
Sbjct: 182 NNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTAAIQTAIEAARAETGKPSIICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG GS N+ G++K HG+ LG +EI+ATRK L W    F IP +I   W  A  + ++ 
Sbjct: 242 TLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWAYPAFEIPQEIYDAWN-AKEQGAKL 300

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A+W E  +  ++       EF RR    LPD FD       K+       +ATRK+S+ 
Sbjct: 301 EAEWNELFAQYQAKYPAEAAEFVRRMDKKLPDNFDEYVQAALKEVCAKAETVATRKASQN 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E++   LPEL+GGSADLT SN T  S   ++++ D  G Y+HYGVRE  M A MNG+A
Sbjct: 361 SIEILAKELPELVGGSADLTPSNLTDWSNSISVTR-DKGGNYIHYGVREFGMGAIMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ P+  TF++FS+Y R A+R+A+LM I  I V THDSIGLGEDGPTHQP+E  A L
Sbjct: 420 LHGGVKPFGATFLMFSEYERNALRMAALMKINPIFVFTHDSIGLGEDGPTHQPIEQTATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYESNNLCALGAY 551
           R IP++ V RP D+ E+L  W  A+K  + PS L  SRQNL F +R++ + N++   G  
Sbjct: 480 RLIPNMDVWRPCDTAESLVAWAEAVKAADHPSCLIFSRQNLKFQVRSEQQLNDIKRGGYV 539

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              +  NAQ  I ++GSE+++A+EA + L+++NI+ RVVS+P   +F  Q  +Y+A ++ 
Sbjct: 540 ISEARGNAQAVIIATGSEVELALEAQKALAAQNIAVRVVSMPSTNVFDRQDAAYQAAVLP 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            S  +IA+EAG   GW  ++G +G+ +G+  FG S   DLL++ FG     +VD V+  L
Sbjct: 600 ESLPRIAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKEFGFTVDNVVDTVKSVL 659


>gi|241668148|ref|ZP_04755726.1| transketolase [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254876683|ref|ZP_05249393.1| transketolase I [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254842704|gb|EET21118.1| transketolase I [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 663

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 311/665 (46%), Positives = 437/665 (65%), Gaps = 25/665 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA     SGHPG+PMGMAD+ T L+T+ +  +PQ P W NRDRFVLS 
Sbjct: 7   REFSNAIRFLSIDATLKAKSGHPGMPMGMADIATVLWTKFLKHNPQNPNWINRDRFVLSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++I+DIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLSGY-DLSIDDIKNFRQLHSKTPGHPEYGYAPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L + +      +IDH+TYV +GDGCLMEGIS EA S AG LGL+KLI  WD
Sbjct: 126 VGMALGEKLLSDRYNTSDLKVIDHHTYVFLGDGCLMEGISHEACSLAGTLGLNKLIAFWD 185

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLSD-KPTMIAC 254
           +N ISIDG      + +   RF+A GWN +  V+GH+  AI   + KAQ    KPT+I C
Sbjct: 186 DNSISIDGDTKGWFTDNTVERFKAYGWNVIEDVDGHNFEAIEKAIAKAQSEQSKPTLICC 245

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSP +AGT  VHGS L ++E  +  K L+W+  PF IP+D+ K W  A  +   
Sbjct: 246 KTIIGFGSPEKAGTASVHGSPLSEQERASVAKELDWNYAPFEIPNDVYKYWD-AKEKGQA 304

Query: 315 TRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEH------SKPM-IAT 366
             A+WQ++L   KS+ + +EF+R     LP        NL+++ E       + P+ +AT
Sbjct: 305 LEANWQKQLDLYKSNPKFEEFDRVLKKQLP-------ANLEQEVEQYIASQLANPVKVAT 357

Query: 367 RKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAA 426
           RK+S++ LEV+   +PE+ GGSADLTGSN T  S    ++ +D    YL YGVRE  MAA
Sbjct: 358 RKASQMALEVLCKNMPEMFGGSADLTGSNNTNWSGSIWLNNTDKGANYLSYGVREFGMAA 417

Query: 427 AMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPV 486
            MNG++L+ GL PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDGPTHQP+
Sbjct: 418 IMNGLSLYGGLKPYGGTFLVFSDYSRNAIRMSALMKQPVVHVMSHDSIGLGEDGPTHQPI 477

Query: 487 EHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNL 545
           EH+ +LR IP+L V RPAD+IET+  W  A+K    PS++ L+RQ L P ++T+ + +++
Sbjct: 478 EHIPSLRLIPNLNVWRPADTIETMVAWNEAVKSNETPSIMVLTRQGLEPVVQTKEQVSDI 537

Query: 546 CALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSY 605
              G Y   +  +A++TI ++GSE+++A++  +    + I   V S+PC ++F  Q+  Y
Sbjct: 538 VK-GGYLVRNNKDARLTIVATGSEVELAIKVVKEYEDKAIKVNVASIPCVDVFDTQTHEY 596

Query: 606 RAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIV 664
           +  +I      I +E     GW  ++   G  + G+  FG S   + L++HFG     I 
Sbjct: 597 KKSVIRDDIPAIFVEMAQPDGWYKYMPKAGGEVKGIYSFGESAPAEDLFKHFGFTVENIS 656

Query: 665 DMVER 669
           ++V +
Sbjct: 657 NIVAK 661


>gi|153836660|ref|ZP_01989327.1| transketolase [Vibrio parahaemolyticus AQ3810]
 gi|260900435|ref|ZP_05908830.1| transketolase [Vibrio parahaemolyticus AQ4037]
 gi|149750009|gb|EDM60754.1| transketolase [Vibrio parahaemolyticus AQ3810]
 gi|308106919|gb|EFO44459.1| transketolase [Vibrio parahaemolyticus AQ4037]
          Length = 663

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 311/666 (46%), Positives = 427/666 (64%), Gaps = 15/666 (2%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D K +A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +P  P W +RDRFVL
Sbjct: 2   DRKYLANAIRALSMDGVQQANSGHPGAPMGMADIAEVLWRSHLNHNPSNPEWADRDRFVL 61

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           S GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI 
Sbjct: 62  SNGHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGIT 120

Query: 138 NAVGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVL 194
           NAVGMA+AE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  
Sbjct: 121 NAVGMAMAEKALAAQFNKEGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAF 180

Query: 195 WDNNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIA 253
           WD+NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+   +PT+I 
Sbjct: 181 WDDNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKADPRPTLIC 240

Query: 254 CETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSS 313
            +T+IGFGSPN++G++  HG+ LG EEI ATRK L W+  PF IP ++  +W  A    +
Sbjct: 241 TKTIIGFGSPNKSGSHDCHGAPLGAEEIAATRKELGWEHGPFEIPQEVYAEWS-AKETGA 299

Query: 314 QTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSS 370
              A W E+ ++ +++   +  EF+RR +  LP  ++     +    + +   IA+RK+S
Sbjct: 300 AKEAAWNEKFAAYEAAYPELAAEFKRRVNGELPAEWEEKASQIIADLQANPANIASRKAS 359

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           +  LE     LPE +GGSADL  SN T  S  K++  +DFSG Y+HYGVRE  M A MNG
Sbjct: 360 QNALEAFGALLPEFMGGSADLAPSNLTMWSGSKSLEANDFSGNYIHYGVREFGMTAIMNG 419

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           IALH G  PY  TF++F +Y+R A+R+A+LM I+ I V THDSIGLGEDGPTHQPVE +A
Sbjct: 420 IALHGGFVPYGATFLMFMEYARNAMRMAALMKIQNIQVYTHDSIGLGEDGPTHQPVEQIA 479

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
           +LR  P++   RP D +E+   W++A++ K+ P+ L  SRQNL       E     A G 
Sbjct: 480 SLRLTPNMNTWRPCDQVESAVAWKLAIERKDAPTALIFSRQNLAQQPRSAEQVADIAKGG 539

Query: 551 Y---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
           Y   D    P  ++ + ++GSE+++AV+A E L++     RVVS+P  + F +Q  +YR 
Sbjct: 540 YILKDSEGKP--ELILIATGSEVELAVKAAEQLTAEGKKVRVVSMPSTDAFDKQDAAYRE 597

Query: 608 QIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDM 666
            ++ S    +IAIEAG+   W  ++G DG  IGM  FG S   D L++ FG     +V+ 
Sbjct: 598 AVLPSDVTARIAIEAGIADFWYKYVGFDGRIIGMTTFGESAPADQLFEMFGFTVENVVNT 657

Query: 667 VERKLS 672
            +  L+
Sbjct: 658 AKELLA 663


>gi|292493425|ref|YP_003528864.1| transketolase [Nitrosococcus halophilus Nc4]
 gi|291582020|gb|ADE16477.1| transketolase [Nitrosococcus halophilus Nc4]
          Length = 665

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 308/665 (46%), Positives = 433/665 (65%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIR LSMDA++   SGHPG PMGMAD+   L+   +  +P  P W +RDRFVLS 
Sbjct: 5   RELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWNDFLRHNPNNPQWVDRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY DV++EDIK FR + SKT GHPEYG   G+E TTGPLGQG++NA
Sbjct: 65  GHGSMLLYSLLHLSGY-DVSMEDIKQFRQLHSKTPGHPEYGYAPGVETTTGPLGQGLSNA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  +F   G  ++DHYTYV +GDGCLMEGIS EA S AG  GL KLI  +D
Sbjct: 124 VGMALAEKILASQFNRDGHEIVDHYTYVFLGDGCLMEGISHEACSLAGTWGLGKLIAFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +NGISIDG +    + D   RF A GW  +  V+GHD  A+   + +A+  +DKPT+I C
Sbjct: 184 DNGISIDGDVDGWFTDDTPKRFEAYGWQVVRGVDGHDPEAVRQAIEEARSATDKPTLICC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IG+G+PN AG++  HG+ LG++EI ATR  L W   PF IP++I   W +A  +   
Sbjct: 244 KTLIGYGAPNLAGSHDCHGAPLGEDEIAATRDKLGWSHPPFEIPEEIYGGWNVA-EKGKA 302

Query: 315 TRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W E+ ++ K++   +  EF+RR  + LP+ ++     + +  +     IATRK+S+
Sbjct: 303 AEAAWDEKFAAYKAAYPELAAEFQRRLQNKLPESWEATVAEVLQAADSKAEKIATRKASQ 362

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             +E     LPEL+GGSADLTGSN T  S  K I K+   G YLHYGVRE  M+A MNG+
Sbjct: 363 NAIEAYAPVLPELLGGSADLTGSNLTHWSGSKVIGKTAADGNYLHYGVREFGMSAIMNGV 422

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY GTF++FS+Y+R A+R+++LMG++ I V THDSIGLGEDGPTHQ VE  A 
Sbjct: 423 ALHGGFIPYGGTFLMFSEYARNAVRMSALMGVQSIFVYTHDSIGLGEDGPTHQAVEQAAT 482

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR IP + V RP D++E+L  W+ A++ ++ P+ L L+RQ +P  +   +       G Y
Sbjct: 483 LRYIPRMSVWRPCDAVESLVSWRAAIERRDGPTSLLLTRQGVPHQQRTPKQMEDIRRGGY 542

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D    P+  V + ++GSE+ +A+EA E L  + I  RVVS+PC ++F  Q ++YR  
Sbjct: 543 ILRDTDGKPD--VIMIATGSEVALAMEAAETLGGKGIKARVVSMPCTDVFDAQDETYREA 600

Query: 609 IIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ S    ++A+EAG+   W  ++G +G  +G+  FG S     +Y+HFG+ A  +  + 
Sbjct: 601 VLPSEVRARVAVEAGVTDYWRKYVGLEGKVLGIDTFGESAPAPEVYKHFGLTAENLAKIA 660

Query: 668 ERKLS 672
           E  +S
Sbjct: 661 EGLIS 665


>gi|183601147|ref|ZP_02962640.1| hypothetical protein PROSTU_04777 [Providencia stuartii ATCC 25827]
 gi|188019492|gb|EDU57532.1| hypothetical protein PROSTU_04777 [Providencia stuartii ATCC 25827]
          Length = 664

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 315/653 (48%), Positives = 426/653 (65%), Gaps = 21/653 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K +A+AIRFLSMDA++   SGHPG PMGMAD+   L+   M  +P  P+W NRDRFVLS 
Sbjct: 5   KTLANAIRFLSMDAVQKAKSGHPGAPMGMADIAEVLWRDYMNHNPADPHWANRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++++++KNFR + SKT GHPEYG   G+E TTGPLGQGIANA
Sbjct: 65  GHGSMLIYSLLHLTGY-DLSMDELKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGIANA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VG AIAER L  +F   G  ++DH+TYV +GDGC+MEGIS EA S AG L L+KLI  +D
Sbjct: 124 VGFAIAERTLAAQFNRPGHDIVDHHTYVFMGDGCMMEGISHEACSLAGTLKLNKLIAFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    + D   RF + GW+ +  ++GHD   I + + +AQ  +DKPT+I C
Sbjct: 184 DNGISIDGHVQGWFTDDTAGRFESYGWHVIRDIDGHDADQIHAAITEAQRETDKPTLIMC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAGLRS 312
           +TVIGFGSPN+AGT  VHG+ LG  EI ATRKAL+W   PF IP +I K W  R AG   
Sbjct: 244 KTVIGFGSPNKAGTESVHGAPLGDAEIAATRKALDWQYGPFEIPQEIYKAWDARDAG--- 300

Query: 313 SQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            + +  W E+ ++   +   + +EF+RR +  LP  FD       +  + +   IA+RK+
Sbjct: 301 KEKQHAWNEKFAAYAKAFPELAEEFKRRMAGELPANFDAEAKKFIEHLQANPANIASRKA 360

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           S+  LE     LPE +GGSADL  SN T  S  K +++ D +G Y+HYGVRE  M+A MN
Sbjct: 361 SQNALEAFGKVLPEFLGGSADLAPSNLTMWSGSKPLNE-DKAGNYIHYGVREFGMSAIMN 419

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           GIALH G  PY  TF++F +Y+R A+R+A+LM +R I V THDSIGLGEDGPTHQPVE L
Sbjct: 420 GIALHGGFVPYGATFLMFVEYARNAVRMAALMKVRSIFVYTHDSIGLGEDGPTHQPVEQL 479

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A+LR  P++   RP D +E+   W+ A++ K+ PS L  SRQNL   +    +  L  + 
Sbjct: 480 ASLRVTPNMNTWRPCDQVESAVAWKYAIERKDGPSALIFSRQNLE--QQPRTAKQLAEIE 537

Query: 550 AYDYI---STPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYR 606
              YI   S    ++   ++GSE+++AV+A + LS      RVVS+P  E+F +Q  +YR
Sbjct: 538 KGAYILKDSEGQPELIFIATGSEVELAVKAADQLSGEGHKVRVVSMPSTEVFDKQDAAYR 597

Query: 607 AQIIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGI 658
             ++ SS  K +AIEAG+   W  + G +G+ +GM  FG S   + L++ FGI
Sbjct: 598 EAVLPSSVTKRVAIEAGIADYWFKYTGLNGAIVGMHSFGESAPAEELFKEFGI 650


>gi|116695331|ref|YP_840907.1| transketolase [Ralstonia eutropha H16]
 gi|730954|sp|P21725|TKTC_RALEH RecName: Full=Transketolase, chromosomal; Short=TK
 gi|435956|gb|AAA20196.1| transketolase [Ralstonia eutropha H16]
 gi|113529830|emb|CAJ96177.1| Transketolase [Ralstonia eutropha H16]
          Length = 670

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 317/652 (48%), Positives = 422/652 (64%), Gaps = 13/652 (1%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           D   + A+A+RFL+ DA+E   SGHPG PMGMA++   L+ + +  +P  P WP+RDRFV
Sbjct: 8   DSAARCANALRFLAADAVEQAKSGHPGAPMGMAEMAEVLWRRHLRHNPANPAWPDRDRFV 67

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GH SML YALL+L GY D+ +  ++ FR + + T GHPE G   G+E TTGPLGQG+
Sbjct: 68  LSNGHASMLQYALLHLTGY-DLPMSQLRQFRQLHAATPGHPELGVTPGVETTTGPLGQGL 126

Query: 137 ANAVGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIV 193
           ANAVGMA+AE+ L   F   G  ++DH+TYV +GDGCLMEG+S EA S AG L L KLI 
Sbjct: 127 ANAVGMALAEKLLAATFNRPGFDIVDHHTYVFLGDGCLMEGLSHEACSLAGTLRLGKLIC 186

Query: 194 LWDNNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLS-DKPTM 251
           L+D+NGISIDG ++   + D   RF A GW+ ++ V+GHD HA+ + L +A+   D+PT+
Sbjct: 187 LYDDNGISIDGEVAGWFADDTPKRFAAYGWHVIADVDGHDAHALDAALHEAKAERDRPTL 246

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLR 311
           I C TVIG G+P +AG + VHG+ LG  EI A R AL W+ +PF +P D+   W  A  +
Sbjct: 247 ICCRTVIGKGAPAKAGGHDVHGAPLGAPEIAAMRTALGWEAEPFTVPADVADAWD-ARAQ 305

Query: 312 SSQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRK 368
            +   A+W+ R  S  ++   + +EF RR +  LP+ FD   + L       +  IATRK
Sbjct: 306 GAAREAEWEARFVSYCAAHPELAEEFVRRANGRLPEGFDAELMALLDAPSPLQGKIATRK 365

Query: 369 SSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAM 428
           +S+L LE +   LPEL+GGSADLTGSN T       ++ +   G Y+ YGVRE  MAAAM
Sbjct: 366 ASQLCLEALTPALPELLGGSADLTGSNLTNVKASVWVNHAGH-GNYVSYGVREFGMAAAM 424

Query: 429 NGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEH 488
           NGIALH GL PY GTFM FSDYSR AIR+A+LM +RV+HVLTHDSIGLGEDGPTHQPVEH
Sbjct: 425 NGIALHGGLIPYGGTFMTFSDYSRNAIRMAALMRLRVVHVLTHDSIGLGEDGPTHQPVEH 484

Query: 489 LAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCA 547
            A+LR IP+  V RP D  ET   W  AL+ ++ PS L LSRQ L PF R   +   + A
Sbjct: 485 AASLRLIPNNQVWRPCDGAETAYAWLAALRREDGPSCLVLSRQALMPFERNPAQRAEI-A 543

Query: 548 LGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
            G Y     P  +V + ++GSE++IA+ A   L+   I+ RVVS+PC ELF+ Q  +YR 
Sbjct: 544 RGGYVLRDVPAPRVVLIATGSEVEIAMRAALDLADAGIAARVVSMPCVELFYAQDVAYRD 603

Query: 608 QIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
            ++     ++++EAG    W   +G  G  +G+  FG S   + LYQHFG+ 
Sbjct: 604 TVLPPGLPRVSVEAGGTWFWRGVVGEQGLALGIDTFGESAPAEALYQHFGLT 655


>gi|74316177|ref|YP_313917.1| transketolase [Thiobacillus denitrificans ATCC 25259]
 gi|74055672|gb|AAZ96112.1| transketolase [Thiobacillus denitrificans ATCC 25259]
          Length = 661

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 308/658 (46%), Positives = 419/658 (63%), Gaps = 11/658 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           +++AIR L+MDA+E   SGHPG PMGMA++   L+   M  +P  P W +RDRFVLS GH
Sbjct: 7   LSNAIRALAMDAVEKAKSGHPGAPMGMAEIAETLWNHHMRHNPVNPKWADRDRFVLSNGH 66

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L GY D++++D+K FR + SKT GHPEYG   G+E TTGPLGQGI NAVG
Sbjct: 67  GSMLIYALLHLTGY-DLSMDDLKQFRQLHSKTPGHPEYGYAPGVETTTGPLGQGITNAVG 125

Query: 142 MAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           MA+AE+ L  EF   G  ++DH+TYV +GDGC+MEGIS EA + AG   L+KLI  WD+N
Sbjct: 126 MAMAEKVLAHEFNKPGHSIVDHHTYVFLGDGCMMEGISHEACALAGTWKLNKLIAFWDDN 185

Query: 199 GISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLS-DKPTMIACET 256
           GISIDG I    + D   RF A GW  + +V+GHD  AI + ++KA+ S DKPT+I C+T
Sbjct: 186 GISIDGHIEHWYTDDTAKRFEAYGWQVIPNVDGHDVVAIEAAIQKAKASSDKPTLICCKT 245

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           +IG GSPN+AGT+ VHG+ALG +E++ATRK + W+   F +P DI   W  A  +     
Sbjct: 246 IIGKGSPNKAGTHDVHGAALGHDEVEATRKNMGWNSPAFEVPADIYAGWD-AKTKGQGLE 304

Query: 317 ADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
             W  + +  K +      EFERR    LP  +                 +ATRK+S++ 
Sbjct: 305 TLWNNKFAEYKKAFPAEAAEFERRMKGELPANWKAHVAEKLAAINAKGETVATRKASQIA 364

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           +  +   LPE +GGSADLTGSN T       +      G Y+ YGVRE  MAA MNG+AL
Sbjct: 365 INALASALPEFLGGSADLTGSNLTNWEGCHPVRHGK-PGNYISYGVREFGMAAIMNGMAL 423

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H GL P+ GTF++FS+YSR AIR+A+LM  RVIHV THDSIGLGEDGPTHQPVE  A LR
Sbjct: 424 HGGLLPFGGTFLMFSEYSRNAIRMAALMKQRVIHVFTHDSIGLGEDGPTHQPVEQTATLR 483

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY 553
            IP++ V RP D++ET+  W  +++  + P+   LSRQNLPF++    +    A G Y  
Sbjct: 484 MIPNIDVWRPCDTVETMVGWAHSVERTDGPTCHILSRQNLPFMQRDDATLASIAKGGYVL 543

Query: 554 ISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSS 613
                A+  I ++GSE+++AV+A + L++  I+ RVVS+P    F  Q  +YR  ++   
Sbjct: 544 KDAAGAKAVIIATGSEVELAVKAADTLAAEGIAVRVVSMPSTNTFDRQDAAYRESVLPKG 603

Query: 614 PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
             ++A+EAG+   W  ++G +G+ +G+  FG S     L++HFGI A A+   V+  L
Sbjct: 604 LPRVAVEAGVTDFWRKYVGLEGAVVGIDTFGESAPAPALFKHFGITAEAVAAAVKSVL 661


>gi|160872383|ref|ZP_02062515.1| transketolase [Rickettsiella grylli]
 gi|159121182|gb|EDP46520.1| transketolase [Rickettsiella grylli]
          Length = 668

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 316/671 (47%), Positives = 441/671 (65%), Gaps = 28/671 (4%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           KK ADA+RFL++DA+E  NSGHPG+PMGMAD+ T L+   +V +P  P W NRDRF+LS 
Sbjct: 5   KKYADALRFLTLDAVEKANSGHPGMPMGMADIATVLWNDFLVHNPNNPNWSNRDRFILSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML+YALL+L GY D+++ ++K FR + SKT GHPE G   GIE TTGPLGQG ANA
Sbjct: 65  GHGSMLHYALLHLTGY-DLSLHEMKRFRQLHSKTPGHPEVGLTPGIETTTGPLGQGFANA 123

Query: 140 VGMAIAERKLREEFGD---VLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L   F     ++IDH+TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 124 VGMALAEKNLAAHFNQPSHLIIDHFTYVFLGDGCLMEGISHEAASLAGCLGLGKLIAFWD 183

Query: 197 NNGISIDGPIS--LADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQ-LSDKPTMI 252
           NN ISIDG +S    D+T +  RF+A  W+ +S ++GHD   I + + KA+ ++DKP+++
Sbjct: 184 NNSISIDGHVSGWFKDNTPE--RFKAYHWHVISDIDGHDPQQIKTAIEKARDITDKPSLL 241

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
            C+T I +G+P+  G+++ HG+ALG++E+ ATR AL W+  PF IP +I   W  A  + 
Sbjct: 242 CCKTQIAWGAPHFVGSHRSHGAALGEKEVAATRIALQWNYPPFEIPQEIYHAWD-ARSKG 300

Query: 313 SQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPM-IATRK 368
           +     W+E+ +  +S    +  E++RR    +P  ++     L +K     P  IATRK
Sbjct: 301 AALEKTWEEKWNRYQSKFPELANEYQRRVDKKIPKNWNLETKKLIEKIFKDPPQKIATRK 360

Query: 369 SSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAM 428
           +S+  L      LPEL+GGSADLT SN T     + +SK + +G Y+HYGVRE  M+A M
Sbjct: 361 ASQNTLNAFAPLLPELLGGSADLTESNSTFWKGAQVLSKENPAGNYIHYGVREFGMSAMM 420

Query: 429 NGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEH 488
           NGIALH G  PY GTF+VFSDY+R AIRL++LM  +VI V THDSIGLGEDGPTHQP+EH
Sbjct: 421 NGIALHGGFIPYGGTFLVFSDYARNAIRLSALMKQKVIFVYTHDSIGLGEDGPTHQPIEH 480

Query: 489 LAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCAL 548
           L +LR IP L V RP D++ET   WQ A++ +  P+ L L+RQ++     Q +S+NL  L
Sbjct: 481 LNSLRLIPQLSVWRPCDALETAIAWQQAIQHEG-PTCLVLTRQSV-----QAQSHNLETL 534

Query: 549 -----GAYDYISTPN-AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQS 602
                GAY  + +P+  +  I ++GSE+ +A+ A + L+      RVVS+PC + F +Q 
Sbjct: 535 QSIHRGAYILLDSPSLPEAIIIATGSEVSLAINAAQTLNQNGRHIRVVSIPCADRFEQQD 594

Query: 603 DSYRAQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAI 661
            +Y+A+I+ +S  +++AIEAG    W  ++G  G  IG+  FG S     +++HFG    
Sbjct: 595 AAYKAKILPNSITLRVAIEAGNPDFWYRYVGLKGKIIGLHQFGESAPGSDVFKHFGFTTE 654

Query: 662 AIVDMVERKLS 672
            I+  + + L+
Sbjct: 655 NIIKTLNQLLA 665


>gi|88812362|ref|ZP_01127612.1| transketolase [Nitrococcus mobilis Nb-231]
 gi|88790369|gb|EAR21486.1| transketolase [Nitrococcus mobilis Nb-231]
          Length = 688

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 312/665 (46%), Positives = 429/665 (64%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIR LSMDA++  N+GHPG PMGMAD+   L+   +  +P  P W NRDRF+LS 
Sbjct: 27  RRLANAIRALSMDAVQRANAGHPGAPMGMADIAEVLWNDFLRHNPANPRWFNRDRFILSN 86

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHG+ML Y++L+L GY+ +++EDI  FR +GSKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 87  GHGAMLLYSVLHLSGYE-LSMEDIMQFRQLGSKTPGHPEYGYTPGVETTTGPLGQGLANA 145

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAER L  +F   G  L+DHYTY  +GDGCLMEG+S E  S AG L L KLI ++D
Sbjct: 146 VGMAIAERTLAAQFNRPGHTLVDHYTYCFLGDGCLMEGVSHEVCSLAGTLRLGKLICVYD 205

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKA-QLSDKPTMIAC 254
           +NGISIDG +    + D   RF A GW+ +  V+GHD  A+   + +A +++D+P++I  
Sbjct: 206 DNGISIDGKVDGWFTDDTPLRFEAYGWHVVRDVDGHDAEAVKHAIEEARKVADRPSLICA 265

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFG+PN  GT+ VHG+ LG +EI+ATR+ L W+  PF IPDDI + W  A  R ++
Sbjct: 266 KTIIGFGAPNVCGTHGVHGAPLGGDEIQATREFLGWEYPPFEIPDDIYRDWD-ARSRGAR 324

Query: 315 TRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
              +W   L   K +   + +EFERR    LP+ +         +        ATRKSS+
Sbjct: 325 WETEWDAVLGDYKRAHPDLAREFERRCRAELPEKWSQHAAEALARANERGAKEATRKSSQ 384

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             L      LPEL+GGSADLTGSN T      A++  D  G Y++YGVRE  M+A +NG+
Sbjct: 385 AALNAYGPYLPELLGGSADLTGSNNTNWDDCTALTHKDSDGNYIYYGVREFGMSAIINGL 444

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY GTF+VFSDY+R A+R+AS++G + I VLTHDSIGLGEDGPTHQPVEH+A+
Sbjct: 445 ALHGGFIPYGGTFLVFSDYARNALRMASIIGAQSIFVLTHDSIGLGEDGPTHQPVEHVAS 504

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR IP+L V RP DS+ET+  W+ A++ ++ P+ L L+RQN+       +       G Y
Sbjct: 505 LRLIPNLTVWRPCDSVETIAAWRSAIERRDGPTCLILTRQNVAHQARDAKMLQAIERGGY 564

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D  S P A   I ++GSE+++AV+A + L+ R    RVVS+P  E+F  Q  +YR  
Sbjct: 565 VLRDATSEPEA--LIIATGSEVELAVDAAQALTERGRRIRVVSLPSVEIFEAQDAAYRES 622

Query: 609 IIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ S    ++ +EAG  + W ++ G  G  +G+  FG S   + L+QHFG     +V  V
Sbjct: 623 VLPSRLTARLVLEAGATRLWASYAGPKGKVLGIDRFGESAPANALFQHFGFTVERVVAAV 682

Query: 668 ERKLS 672
           E  LS
Sbjct: 683 EALLS 687


>gi|167627581|ref|YP_001678081.1| transketolase [Francisella philomiragia subsp. philomiragia ATCC
           25017]
 gi|167597582|gb|ABZ87580.1| transketolase I [Francisella philomiragia subsp. philomiragia ATCC
           25017]
          Length = 663

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 311/665 (46%), Positives = 437/665 (65%), Gaps = 25/665 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ ++AIRFLS+DA     SGHPG+PMGMAD+ T L+T+ +  +PQ P W NRDRF+LS 
Sbjct: 7   REFSNAIRFLSIDATLKAKSGHPGMPMGMADIATVLWTKFLKHNPQNPNWINRDRFILSN 66

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++I+DIKNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 67  GHGSMLLYSLLHLSGY-DLSIDDIKNFRQLHSKTPGHPEYGYAPGVETTTGPLGQGVANA 125

Query: 140 VGMAIAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+ E+ L + +      +IDH+TYV +GDGCLMEG+S EA S AG LGL+KLI  WD
Sbjct: 126 VGMALGEKLLSDRYNTSDLKVIDHHTYVFLGDGCLMEGVSHEACSLAGTLGLNKLIAFWD 185

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLSD-KPTMIAC 254
           +N ISIDG      + +   RF+A GWN +  V+GH+  AI   + KAQ    KPT+I C
Sbjct: 186 DNSISIDGDTKGWFTDNTVERFKAYGWNVIEDVDGHNFEAIEKAIAKAQSEQSKPTLICC 245

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSP +AGT  VHGS L ++E  +  K L+W+  PF IP+D+ K W  A  +   
Sbjct: 246 KTIIGFGSPEKAGTASVHGSPLSEQERASAAKELDWNYAPFEIPNDVYKYWD-AKEKGQA 304

Query: 315 TRADWQERLSSMKSSIR-KEFERRFSDALPDCFDNAFINLKKKFEH------SKPM-IAT 366
             A+WQ++L   KS+ + +EF+R     LP        NL+++ E       + P+ +AT
Sbjct: 305 LEANWQKQLDLYKSNPKHEEFDRVLKKQLP-------ANLEQEVEQYIASQLANPVKVAT 357

Query: 367 RKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAA 426
           RK+S++ LEV+   +PE+ GGSADLTGSN T  S    ++ +D    YL YGVRE  MAA
Sbjct: 358 RKASQMALEVLCKNMPEMFGGSADLTGSNNTNWSGSIWLNNTDKGANYLSYGVREFGMAA 417

Query: 427 AMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPV 486
            MNG++L+ GL PY GTF+VFSDYSR AIR+++LM   V+HV++HDSIGLGEDGPTHQPV
Sbjct: 418 IMNGLSLYGGLKPYGGTFLVFSDYSRNAIRMSALMKQPVVHVMSHDSIGLGEDGPTHQPV 477

Query: 487 EHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNL 545
           EH+ +LR IP+L V RPAD+IET+  W  A+K    PSV+ L+RQ L P ++T+ + +++
Sbjct: 478 EHVPSLRLIPNLNVWRPADTIETMVAWNEAVKSNETPSVMVLTRQGLEPVVQTKEQVSDI 537

Query: 546 CALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSY 605
              G Y   +  +A++TI ++GSE+++A++  +    + I   V S+PC ++F  Q+  Y
Sbjct: 538 VK-GGYLVRNNKDARLTIVATGSEVELAIKVAKEYEDKGIKVNVASIPCVDVFDIQTHEY 596

Query: 606 RAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFI-GMQGFGASGSCDLLYQHFGINAIAIV 664
           +  +I      I +E     GW  ++   G  + G+  FG S   + L++HFG     I 
Sbjct: 597 KKSVIRDDIPAIFVEMAQPDGWYKYMPKAGGEVKGIYSFGESAPAEDLFKHFGFTVENIS 656

Query: 665 DMVER 669
           ++V +
Sbjct: 657 NIVAK 661


>gi|28901036|ref|NP_800691.1| transketolase [Vibrio parahaemolyticus RIMD 2210633]
 gi|260362466|ref|ZP_05775399.1| transketolase [Vibrio parahaemolyticus K5030]
 gi|260879886|ref|ZP_05892241.1| transketolase [Vibrio parahaemolyticus AN-5034]
 gi|260894561|ref|ZP_05903057.1| transketolase [Vibrio parahaemolyticus Peru-466]
 gi|81725569|sp|Q87GY4|TKT2_VIBPA RecName: Full=Transketolase 2; Short=TK 2
 gi|28809549|dbj|BAC62524.1| transketolase 1 [Vibrio parahaemolyticus RIMD 2210633]
 gi|308086501|gb|EFO36196.1| transketolase [Vibrio parahaemolyticus Peru-466]
 gi|308092506|gb|EFO42201.1| transketolase [Vibrio parahaemolyticus AN-5034]
 gi|308113346|gb|EFO50886.1| transketolase [Vibrio parahaemolyticus K5030]
          Length = 663

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 311/666 (46%), Positives = 426/666 (63%), Gaps = 15/666 (2%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D K +A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +P  P W +RDRFVL
Sbjct: 2   DRKYLANAIRALSMDGVQQANSGHPGAPMGMADIAEVLWRSHLNHNPSNPEWADRDRFVL 61

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           S GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI 
Sbjct: 62  SNGHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGIT 120

Query: 138 NAVGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVL 194
           NAVGMA+AE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  
Sbjct: 121 NAVGMAMAEKALAAQFNKEGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAF 180

Query: 195 WDNNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIA 253
           WD+NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+   +PT+I 
Sbjct: 181 WDDNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKADPRPTLIC 240

Query: 254 CETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSS 313
            +T+IGFGSPN++G++  HG+ LG EEI ATRK L W+  PF IP ++  +W  A    +
Sbjct: 241 TKTIIGFGSPNKSGSHDCHGAPLGAEEIAATRKELGWEHGPFEIPQEVYAEWS-AKETGA 299

Query: 314 QTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSS 370
              A W E+ ++ +++   +  EF+RR +  LP  ++     +    + +   IA+RK+S
Sbjct: 300 AKEAAWNEKFAAYEAAYPELAAEFKRRVNGELPAEWEEKASQIIADLQANPANIASRKAS 359

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           +  LE     LPE +GGSADL  SN T  S  K++  +DFSG Y+HYGVRE  M A MNG
Sbjct: 360 QNALEAFGALLPEFMGGSADLAPSNLTMWSGSKSLEANDFSGNYIHYGVREFGMTAIMNG 419

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           IALH G  PY  TF++F +Y+R A+R+A+LM I+ I V THDSIGLGEDGPTHQPVE +A
Sbjct: 420 IALHGGFVPYGATFLMFMEYARNAMRMAALMKIQNIQVYTHDSIGLGEDGPTHQPVEQIA 479

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
           +LR  P++   RP D +E+   W++A++ K+ P+ L  SRQNL       E     A G 
Sbjct: 480 SLRLTPNMNTWRPCDQVESAVAWKLAIERKDAPTALIFSRQNLAQQPRSAEQVADIAKGG 539

Query: 551 Y---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
           Y   D    P  ++ + ++GSE+++AV+A E L++     RVVS+P  + F +Q   YR 
Sbjct: 540 YILKDSEGKP--ELILIATGSEVELAVKAAEQLTAEGKKVRVVSMPSTDAFDKQDADYRE 597

Query: 608 QIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDM 666
            ++ S    +IAIEAG+   W  ++G DG  IGM  FG S   D L++ FG     +V+ 
Sbjct: 598 AVLPSDVTARIAIEAGIADFWYKYVGFDGRIIGMTTFGESAPADQLFEMFGFTVENVVNT 657

Query: 667 VERKLS 672
            +  L+
Sbjct: 658 AKELLA 663


>gi|221133779|ref|ZP_03560084.1| transketolase 1 (TK 1) [Glaciecola sp. HTCC2999]
          Length = 663

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 316/663 (47%), Positives = 424/663 (63%), Gaps = 20/663 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+A+R LSMDA++  NSGHPG PMGMAD+   L+T  +  +P  P W NRDRFVLS 
Sbjct: 5   QQLANAVRALSMDAVQQANSGHPGAPMGMADIAQVLWTDFLSHNPSDPAWANRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY  + IE++KNFR + SKT GHPEYG   G+E TTGPLGQGI+NA
Sbjct: 65  GHGSMLLYSLLHLSGYA-LPIEELKNFRQLHSKTPGHPEYGYAPGVETTTGPLGQGISNA 123

Query: 140 VGMAIAERKLREEFG---DVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  +F      ++DHYTY  +GDGCLMEGIS E  S AG LGL KL+  WD
Sbjct: 124 VGMALAEKTLAAQFNREEHAIVDHYTYTFLGDGCLMEGISHEVCSLAGTLGLGKLVAFWD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    S D  ARF+A GW  +  V+GH+   I S +R AQ  + KPT+I C
Sbjct: 184 DNGISIDGEVEGWFSDDTPARFKAYGWQVIDGVDGHNPEEIASAIRTAQAETQKPTLICC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAGLRS 312
           +TVIGFGSPN+ GT   HG+ LG +EI ATR AL W+   F IPDDI  +W  +  G ++
Sbjct: 244 KTVIGFGSPNKQGTESCHGAPLGADEITATRAALGWEHGAFEIPDDIYAQWDGKAKGAKA 303

Query: 313 SQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            Q    WQER ++   +   +  EF RR S  LP  +D A  +  ++ + +   IATRK+
Sbjct: 304 QQA---WQERFAAYADAYPELAAEFNRRVSGQLPASWDQAAQSYIEELQANPANIATRKA 360

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           S+  L      LPEL+GGSADL GSN T  S  K IS  D SG Y++YGVRE  M+A MN
Sbjct: 361 SQNALNAYGPLLPELLGGSADLAGSNLTIWSGCKGISADDASGNYIYYGVREFGMSAMMN 420

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G   Y  TF++F +Y+R A+R+A+LM    I V THDSIGLGEDGPTHQPVE L
Sbjct: 421 GLALHGGFKAYGATFLMFMEYARNAVRMAALMKQPAIFVYTHDSIGLGEDGPTHQPVEQL 480

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
            ALRA P+L   RP D +E+   W+ A++  + PS L  +RQ         +     A G
Sbjct: 481 VALRATPNLDNWRPCDQVESAVAWKSAIERTDGPSTLIFTRQGCEQQPRDAQQLANIAKG 540

Query: 550 AY---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYR 606
            Y   D  +TP+  V + ++GSE+++AV A + LS+   + RVVS+P  ++F  QS  Y+
Sbjct: 541 GYVLVDCTATPD--VILIATGSEVELAVAAGKELSAAGQNVRVVSMPSTDVFDAQSAEYK 598

Query: 607 AQIIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
             ++ ++  K +A+EA  +  W  ++G +G+ IGM  FG S     L++HFGI   A+V+
Sbjct: 599 ESVLPANVTKRVAVEALAKDTWYKYVGLNGAIIGMDSFGESAPAKDLFEHFGITVSAVVN 658

Query: 666 MVE 668
             +
Sbjct: 659 AAK 661


>gi|296161469|ref|ZP_06844275.1| transketolase [Burkholderia sp. Ch1-1]
 gi|295888284|gb|EFG68096.1| transketolase [Burkholderia sp. Ch1-1]
          Length = 680

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 314/664 (47%), Positives = 422/664 (63%), Gaps = 17/664 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MADA+R L++DA+E   SGHPG+P+GMA++  AL+ + +  +P+ P WP+RDRFVLS 
Sbjct: 14  RLMADALRMLAIDAVEAAKSGHPGMPLGMAEIAVALWDRHLKHNPRNPAWPDRDRFVLSN 73

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y LL+L GY D+ I++++ FR + S+T GHPE G   G+E TTGPLGQG+ANA
Sbjct: 74  GHGSMLLYGLLHLTGY-DLPIDELRRFRQLHSRTPGHPEVGVTPGVETTTGPLGQGLANA 132

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE  L  EF   G  ++DH TYV VGDGC+MEGIS EA S AG L L KL VL+D
Sbjct: 133 VGMALAEALLAREFNRPGHSIVDHRTYVFVGDGCMMEGISHEAASLAGTLKLDKLTVLYD 192

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACE 255
           +NGISIDG +S   S D  ARF A GW+ +  V+GHD  A+   L +A+ + +PT+I C 
Sbjct: 193 DNGISIDGHVSQWFSDDTPARFAAYGWHVVREVDGHDVDAVDRALSRARAAGRPTLICCR 252

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIG GSP++AGT+ VHG+ LG +E+  TR+AL W   PF +P ++   W  A  R +  
Sbjct: 253 TVIGKGSPSKAGTHDVHGAPLGADEVANTRRALGWPHAPFAMPAEVRTLWD-ASERGAAA 311

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            ADW  R  + +        EFERR    LP  + +    + +  +H+   IATRK+S+ 
Sbjct: 312 EADWNTRFEAYRKHYPHEAAEFERRTQGTLPAQWRDTVRAMVRDADHAAESIATRKASQQ 371

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFS---GRYLHYGVREHAMAAAMN 429
            + V    LPEL+GGSADLTGSN T       +   D     G YLHYGVRE  M+A MN
Sbjct: 372 AIAVAARALPELLGGSADLTGSNLTNWKMSVDVHADDSGLQGGNYLHYGVREFGMSAVMN 431

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH+G  P+ GTF+ FSDYSR A+R+A+LM IR I V THDSIGLGEDGPTHQ VEH 
Sbjct: 432 GMALHRGHIPFGGTFLTFSDYSRSALRMAALMKIRSIFVFTHDSIGLGEDGPTHQSVEHA 491

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A+LR IP L V RP D++ET   W  A+ E+  PS L LSRQNLPF     E  +    G
Sbjct: 492 ASLRLIPGLDVWRPCDTVETARAWASAV-ERYGPSCLLLSRQNLPFAARSAEQIDAIERG 550

Query: 550 AYDYISTP----NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSY 605
            Y     P      +V + ++GSE+ +A++A   L+   I+ RVVS+P   +F  Q  ++
Sbjct: 551 GYVLRDWPAERAQTRVVLIATGSEVSLALDAVAPLAQAGIAARVVSMPSTSVFDRQPAAW 610

Query: 606 RAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
           R  ++     ++A+EAG+   W  ++G +G  +G+  FG S     L++HFG+ A A+VD
Sbjct: 611 RDAVLPPRVPRVAVEAGVCAFWRQYVGLEGGVVGIDTFGESAPAAALFEHFGLTARAVVD 670

Query: 666 MVER 669
              R
Sbjct: 671 EARR 674


>gi|261400836|ref|ZP_05986961.1| transketolase [Neisseria lactamica ATCC 23970]
 gi|269209291|gb|EEZ75746.1| transketolase [Neisseria lactamica ATCC 23970]
          Length = 659

 Score =  605 bits (1559), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 312/660 (47%), Positives = 437/660 (66%), Gaps = 12/660 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIRFLS DA++  NSGHPG PMGMA++   L+T+ +  +P  P + NRDRF+LS G
Sbjct: 3   QLANAIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHNPANPKFYNRDRFILSNG 62

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML Y+LL+L GY +++IED+KNFR + SKT GHPEYG   G+E TTGPLGQGIANAV
Sbjct: 63  HASMLLYSLLHLTGY-NLSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANAV 121

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DHYTYV +GDGCLMEG+S EA S AG LGL KLIVL+D+
Sbjct: 122 GMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEACSLAGTLGLGKLIVLYDD 181

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIACE 255
           N ISIDG +    + +   RF + GW+ + +VNGHD  AI + +  A+  + KP++I C+
Sbjct: 182 NNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTAAIQTAIEAARAETGKPSIICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG GS N+ G++K HG+ LG +EI+ATRK L W    F IP +I   W  A  + ++ 
Sbjct: 242 TLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWAYPAFEIPQEIYDAWN-AKEKGAKL 300

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A+W E  +  ++       EF RR    LP+ FD       K+       +ATRK+S+ 
Sbjct: 301 EAEWNELFTQYQAKYPAEAAEFVRRMDKKLPENFDEYVQTALKEVCAKAETVATRKASQN 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E++   LPEL+GGSADLT SN T  S   ++++ D  G Y+HYGVRE  M A MNG+A
Sbjct: 361 SIEILAKELPELMGGSADLTPSNLTDWSNSISVTR-DKGGNYIHYGVREFGMGAIMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ P+  TF++FS+Y R A+R+A+LM I  + V THDSIGLGEDGPTHQP+E  A L
Sbjct: 420 LHGGVKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSIGLGEDGPTHQPIEQTATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYESNNLCALGAY 551
           R IP++ V RP D+ E+L  W  A+K  + PS L  SRQNL F +R++ + N++   G  
Sbjct: 480 RLIPNMDVWRPCDTAESLVAWAEAVKAADHPSCLIFSRQNLKFQVRSEQQLNDIKRGGYV 539

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              +  NAQ  I ++GSE+++A+EA + L+++NI+ RVVS+P   +F  Q  +Y+A ++ 
Sbjct: 540 ISEARGNAQAVIIATGSEVELALEAQKALAAQNIAVRVVSMPSTNVFDRQDTAYQAAVLP 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            S  +IA+EAG   GW  ++G +G+ +G+  FG S   DLL++ FG     +VD V+  L
Sbjct: 600 ESLPRIAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKEFGFTVDNVVDTVKSVL 659


>gi|261377445|ref|ZP_05982018.1| transketolase [Neisseria cinerea ATCC 14685]
 gi|269146166|gb|EEZ72584.1| transketolase [Neisseria cinerea ATCC 14685]
          Length = 659

 Score =  604 bits (1558), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 311/660 (47%), Positives = 435/660 (65%), Gaps = 12/660 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIRFLS DA++  NSGHPG PMGMA++   L+T+ +  +P  P + NRDRF+LS G
Sbjct: 3   QLANAIRFLSADAVQKANSGHPGAPMGMAEMAEVLWTKFLHHNPANPKFYNRDRFILSNG 62

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML Y+LL+L GY +++IED+KNFR + SKT GHPEYG   G+E TTGPLGQGIANAV
Sbjct: 63  HASMLLYSLLHLTGY-NLSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANAV 121

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DHYTYV +GDGCLMEG+S EA S AG LGL KLIVL+D+
Sbjct: 122 GMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEACSLAGTLGLGKLIVLYDD 181

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIACE 255
           N ISIDG +    + +   RF + GW+ + +VNGHD  AI + +  A+  + KP++I C+
Sbjct: 182 NNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTTAIQTAIEAARAETGKPSLICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG GS N+ G++K HG+ LG +EI+ATRK L W    F IP +I  +W  A  + ++ 
Sbjct: 242 TLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWAYPAFEIPQEIYAEWN-AKEKGAKL 300

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A+W E  +  ++       EF RR    LPD FD       K+       IATRK+S+ 
Sbjct: 301 EAEWNELFAQYQAKYPAEAAEFVRRMDKKLPDNFDAYVQAALKEVCAKAETIATRKASQN 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E++   LPEL+GGSADLT SN T  S   ++++ D  G Y+HYGVRE  M+A MNG+ 
Sbjct: 361 SIEILAKALPELVGGSADLTPSNLTDWSNSVSVTR-DKGGNYIHYGVREFGMSAIMNGLT 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ P+  TF++FS+Y R A+R+A+LM I  + V THDSIGLGEDGPTHQP+E  A L
Sbjct: 420 LHGGVKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSIGLGEDGPTHQPIEQTATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYESNNLCALGAY 551
           R IP++ V RP D+ E+L  W  A K ++ PS L  SRQNL F  R + + N++   G  
Sbjct: 480 RLIPNMDVWRPCDTAESLVAWAEAAKAEDHPSCLIFSRQNLKFQARNEQQLNDIKRGGYV 539

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              +  NAQ  I ++GSE+++A+EA + L+++NI+ RVVS+P   +F  Q  +Y+A ++ 
Sbjct: 540 ISEAQGNAQAVIIATGSEVELALEAQKALAAQNIAVRVVSMPSTNVFDRQDAAYKAAVLP 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
               ++A+EAG   GW  ++G +G+ +G+  FG S   DLL++ FG     +VD V+  L
Sbjct: 600 EGLPRVAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKEFGFTVDNVVDTVKSVL 659


>gi|255067128|ref|ZP_05318983.1| transketolase [Neisseria sicca ATCC 29256]
 gi|255048724|gb|EET44188.1| transketolase [Neisseria sicca ATCC 29256]
          Length = 659

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 313/660 (47%), Positives = 435/660 (65%), Gaps = 12/660 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIRFLS DA++  NSGHPG PMGMA++   L+T+ +  +P  P + NRDRF+LS G
Sbjct: 3   QLANAIRFLSADAVQKANSGHPGAPMGMAEMAEVLWTKFLRHNPANPKFYNRDRFILSNG 62

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML Y+LL+L GY +++IED+KNFR + SKT GHPEYG   G+E TTGPLGQGIANAV
Sbjct: 63  HASMLLYSLLHLTGY-NLSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANAV 121

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DHYTYV +GDGCLMEG+S EA S AG LGL KLIVL+D+
Sbjct: 122 GMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEACSLAGTLGLGKLIVLYDD 181

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIACE 255
           N ISIDG +    + +   RF + GW+ + +VNGHD  AI + +  A+  + KP++I C+
Sbjct: 182 NNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTAAIQTAIEAARAETGKPSLICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG GS N+ G++K HG+ LG +EI+ATRK L W    F IP +I   W  A  + ++ 
Sbjct: 242 TLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWTYPAFEIPQEIYDAWS-AKEQGAKL 300

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A+W E  +  ++       EF RR    LPD FD       K+       IATRK+S+ 
Sbjct: 301 EAEWNELFAQYQAKYPAEAAEFVRRMDKKLPDNFDAYVQAALKEVCAKAETIATRKASQN 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E++   LPEL+GGSADLT SN T  S   ++++ D  G Y+HYGVRE  M A MNG+A
Sbjct: 361 SIEILAKELPELVGGSADLTPSNLTDWSGSVSVTR-DKGGNYIHYGVREFGMGAIMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ P+  TF++FS+Y R A+R+A+LM I  + V THDSIGLGEDGPTHQP+E  A L
Sbjct: 420 LHGGVKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSIGLGEDGPTHQPIEQTATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYESNNLCALGAY 551
           R IP++ V RP D+ E+L  W  A+K K+ PS L  SRQNL F  R + + N++   G  
Sbjct: 480 RLIPNMDVWRPCDTAESLVAWAEAVKAKDHPSCLIFSRQNLKFQARNEQQLNDIKRGGYI 539

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              +  NAQ  I ++GSE+++A+EA + L+++NI+ RVVS+P   +F  Q  +Y+A ++ 
Sbjct: 540 ISEAQGNAQAVIIATGSEVELALEAQKALAAQNIAVRVVSMPSTNVFDRQDAAYQAAVLP 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
               +IA+EAG   GW  ++G +G+ +G+  FG S   +LL++ FG     +VD V+  L
Sbjct: 600 EGLPRIAVEAGHADGWYKYVGLNGAVVGINRFGESAPAELLFKEFGFTVDNVVDTVKSVL 659


>gi|86606973|ref|YP_475736.1| transketolase [Synechococcus sp. JA-3-3Ab]
 gi|86555515|gb|ABD00473.1| transketolase [Synechococcus sp. JA-3-3Ab]
          Length = 666

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 311/661 (47%), Positives = 427/661 (64%), Gaps = 21/661 (3%)

Query: 24  DAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGS 83
           + IRFL++DA++  NSGHPGLPMG A +   L+ Q + F+P+ P W +RDRFVLSAGHG 
Sbjct: 15  NTIRFLAVDAVQKANSGHPGLPMGAAPMAYVLWQQFLKFNPRNPKWVDRDRFVLSAGHGC 74

Query: 84  MLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMA 143
           ML YALL+L G+ DV++EDIK FR  GSKT GHPE     G+E TTGPLGQG+ NAVG+A
Sbjct: 75  MLQYALLHLTGF-DVSLEDIKQFRQWGSKTPGHPENFETPGVEVTTGPLGQGVGNAVGLA 133

Query: 144 IAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           IAE  L   F   G  ++DHYTYV++GDGC MEG++ EA S AGHL L KLI+L+D+N I
Sbjct: 134 IAEAHLAARFNKPGHTIVDHYTYVILGDGCNMEGVASEAASLAGHLKLGKLIMLYDSNHI 193

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVN--GHDHHAITSTLRKA-QLSDKPTMIACETV 257
           SIDG   +A + D   R+ A GW+   V    HD   I + ++KA +++DKP++I  ET 
Sbjct: 194 SIDGSTEIAFTEDVGKRYEAYGWHVQKVEDGNHDLKGIAAAIQKAKEVTDKPSLIIVETT 253

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDP-FFIPDDIMKKWRLAGLRSSQTR 316
           IG+GSPN+AGT  VHG+ LG EE+K T++ L W L+P F+IPD+++  +R A  + ++  
Sbjct: 254 IGYGSPNKAGTESVHGAPLGPEEVKLTKQNLGWPLEPEFYIPDEVLAHFRQAIDKGAKAE 313

Query: 317 ADWQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
           A+W ER ++ + +  +E   F+R  +  LP  +  A   + +  + S     TR  S+  
Sbjct: 314 AEWNERFAAYEKAYPEEAAEFKRIMAGELPAGWKEALAPIAETGKES-----TRNLSKFC 368

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           L  +   +PEL+GGSADL  SN T    +       + GR   +GVREH M A  NGIAL
Sbjct: 369 LNALAKAVPELLGGSADLAHSNMTYLKGIPEFQAGSYHGRNFRFGVREHGMGAIANGIAL 428

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H GL PY  TF+VFSDY RPAIRL++L   RV+H++THDSI LGEDGPTHQP+E LA+LR
Sbjct: 429 HGGLIPYDATFLVFSDYMRPAIRLSALSRARVLHIMTHDSIALGEDGPTHQPIETLASLR 488

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGAYD 552
           AIP+L V+RPAD+ ET+  +QVAL+  + PSVL  +RQ + P   T  E     A GAY 
Sbjct: 489 AIPNLYVIRPADARETVGAYQVALESTSTPSVLVFTRQAVNPVEGTSIEG---VAKGAYV 545

Query: 553 YISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
            + TPN ++ + ++GSEL++AV+A   L     + RVVS+PC ELF  Q  SYR +++  
Sbjct: 546 VVDTPNPELILIATGSELELAVKAAAQLQQEGRAVRVVSMPCMELFEAQPQSYRDEVLPP 605

Query: 613 SPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
              K +++EAG   GW  ++G +G  IG+  FGAS    +  + FG     +++   R L
Sbjct: 606 KVTKRVSVEAGSTFGWHKYLGFEGVAIGIDRFGASAPGPVCMEKFGFTVENVLNTARRLL 665

Query: 672 S 672
           S
Sbjct: 666 S 666


>gi|268592005|ref|ZP_06126226.1| transketolase [Providencia rettgeri DSM 1131]
 gi|291312396|gb|EFE52849.1| transketolase [Providencia rettgeri DSM 1131]
          Length = 664

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 315/666 (47%), Positives = 429/666 (64%), Gaps = 21/666 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K +A+AIRFLSMDA++   SGHPG PMGMAD+   L+   M  +P  P+W +RDRFVLS 
Sbjct: 5   KTLANAIRFLSMDAVQKAKSGHPGAPMGMADIAEVLWRDHMNHNPADPHWADRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IE++KNFR + SKT GHPEYG   G+E TTGPLGQGIANA
Sbjct: 65  GHGSMLIYSLLHLTGY-DLSIEELKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGIANA 123

Query: 140 VGMAIAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VG AIAER L  +F      ++DH+TYV +GDGC+MEGIS EA S AG L L+KLI  +D
Sbjct: 124 VGFAIAERTLAAQFNRPNHDIVDHHTYVFMGDGCMMEGISHEACSLAGTLKLNKLIAFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +NGISIDG +    + D  ARF + GW+ +  ++GHD   I + + +A+  +DKPT+I C
Sbjct: 184 DNGISIDGEVEGWFTDDTAARFESYGWHVIRDIDGHDASQINAAVNEAKSQTDKPTLIMC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAGLRS 312
           +T+IGFGSPN+AG+  VHG+ LG  EI ATR+AL W   PF IP DI + W  R AG   
Sbjct: 244 KTIIGFGSPNKAGSESVHGAPLGDAEIAATREALGWSYGPFEIPKDIYEAWDARTAG--- 300

Query: 313 SQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            + ++ W ++ ++  +    +  EF RR +  LP  FD       +  + +   IA+RK+
Sbjct: 301 KEKQSAWDKKFAAYAAQFPELAAEFTRRMNGELPANFDADAKQFVENLQQNPANIASRKA 360

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           S+  LE     LPE +GGSADL  SN T  S  KA++  D +G Y+HYGVRE  M+A MN
Sbjct: 361 SQNALEAFGKVLPEFMGGSADLAPSNLTMWSGSKALN-VDPAGNYIHYGVREFGMSAIMN 419

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           GIALH G  PY  TF++F +Y+R A+R+A+LM +R I V THDSIGLGEDGPTHQPVE L
Sbjct: 420 GIALHGGFIPYGATFLMFVEYARNAVRMAALMKVRSIFVYTHDSIGLGEDGPTHQPVEQL 479

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A+LR  P++   RP D +E+   W+ A++ K+ PS L  SRQNL       E       G
Sbjct: 480 ASLRVTPNVSTWRPCDQVESAVAWKYAIERKDGPSALIFSRQNLEQQPRTAEQLANIEKG 539

Query: 550 AY---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYR 606
           AY   D   TP  ++   ++GSE+++AV+A E L+S     RVVS+P  + F +Q  +YR
Sbjct: 540 AYILKDCAGTP--ELIFIATGSEVELAVKAAEQLTSEGRKVRVVSMPSTDAFDKQDAAYR 597

Query: 607 AQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
             ++ ++   ++AIEAG+   W  + G +G+ IGM  FG S   ++L++ FGI     V+
Sbjct: 598 EAVLPANVTARVAIEAGIADYWFKYTGLNGAIIGMHTFGESAPAEVLFKEFGITVEKAVE 657

Query: 666 MVERKL 671
             +  L
Sbjct: 658 AAKSLL 663


>gi|330999336|ref|ZP_08323053.1| transketolase [Parasutterella excrementihominis YIT 11859]
 gi|329575194|gb|EGG56745.1| transketolase [Parasutterella excrementihominis YIT 11859]
          Length = 663

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 312/661 (47%), Positives = 420/661 (63%), Gaps = 11/661 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+A+R L+MDA++  NSGHPG+PMGMAD+  AL+T+ +  +P  P W  RDRF+LS GH
Sbjct: 1   MANAVRALAMDAVQKANSGHPGMPMGMADIAVALWTKHLRHNPSDPKWLGRDRFLLSNGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L GY D+TI+D+KNFR + SKT GHPE G   G+E +TGPLGQGIANAVG
Sbjct: 61  GSMLQYALLHLAGY-DLTIDDLKNFRQLHSKTPGHPEIGVTPGVETSTGPLGQGIANAVG 119

Query: 142 MAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           MA+AE+ L  EF   G  +I++YTY  +GDGCLMEGIS E  S AG   L+KLI L+D+N
Sbjct: 120 MALAEKMLAAEFNEEGYDIINNYTYAFLGDGCLMEGISHEVCSLAGVWKLNKLIALYDDN 179

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           GISIDG I      +   RF +  WN +  ++GHD  A++  + +A+ SDKPT+I C+TV
Sbjct: 180 GISIDGKIENWFGENVRERFESYNWNVIGPIDGHDIEAVSEAIEEAKKSDKPTLIDCKTV 239

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAGLRSSQT 315
           IGFGSPNRAGT+K HGS LG EE+   +KAL W+  PF IP +I   +  R AG    + 
Sbjct: 240 IGFGSPNRAGTSKAHGSPLGDEELAEAKKALGWEYAPFEIPQEIYDAFDARKAGAEMEEA 299

Query: 316 RADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLE 375
             +   R +    +   E ERR    LP+ +D+  +            +ATRK+S++ L 
Sbjct: 300 WLEKYRRYAEAFPAKAAELERRMKGQLPENWDDVILEAIVNAAGEAKTVATRKASQMALN 359

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
                LPEL+GGSADLT SN T    ++A+    + GR+++YGVRE  M A MNGIAL+ 
Sbjct: 360 AYAPHLPELLGGSADLTSSNLTNWEGVQAMRPDTYLGRHINYGVREFGMCAIMNGIALYG 419

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
           G  PY  TF+ F+DY R A+R+A+LM +R I V THDSIG+GEDGPTHQP+E   +LR I
Sbjct: 420 GFIPYGATFLTFADYGRNALRMAALMKLRSIFVFTHDSIGVGEDGPTHQPIEQTESLRII 479

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIS 555
           P++ V RPAD+ ETL  W  A+  ++ PS L  SRQNLPF+     + +    G Y  + 
Sbjct: 480 PNMDVWRPADACETLTAWACAISRQDGPSSLIFSRQNLPFVERDEINVDDMEKGGYIMLE 539

Query: 556 TPNA----QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
            PN     +VT+ ++GSE+ +A EA + L + NI TR+VS+P   +F  Q   YR  ++G
Sbjct: 540 APNGPSSVEVTLVATGSEVALAAEARKQLLAMNIQTRLVSMPSTTVFDRQDKEYRDFVLG 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
                +AIEAG   GW  +I   G+ IG+  FG S     L++ FG     +V+ V+  L
Sbjct: 600 EGRPVVAIEAGRTDGWWKYIRGAGTVIGLDRFGESAPASELFKLFGFTVDNVVETVQHVL 659

Query: 672 S 672
           S
Sbjct: 660 S 660


>gi|110835476|ref|YP_694335.1| transketolase [Alcanivorax borkumensis SK2]
 gi|110648587|emb|CAL18063.1| transketolase [Alcanivorax borkumensis SK2]
          Length = 666

 Score =  602 bits (1553), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 313/665 (47%), Positives = 422/665 (63%), Gaps = 19/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIR LSMDA++  NSGHPG PMGMAD+   L+   M  +P  P W +RDRFVLS 
Sbjct: 8   RELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDFMRHNPADPTWADRDRFVLSN 67

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY  V+++DIKNFR +GS TAGHPEYG   GIE TTGPLGQGIANA
Sbjct: 68  GHGSMLLYSLLHLTGY-GVSLDDIKNFRQLGSPTAGHPEYGDAPGIETTTGPLGQGIANA 126

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  +F   G  ++DH TY  +GDGC+MEGIS E  S AG LGL KL+  +D
Sbjct: 127 VGMALAEKMLAGQFNRDGHTIVDHNTYCFLGDGCMMEGISHEVASLAGTLGLGKLVAFYD 186

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    + D   RFRA GW  + +V+GH+   I   +  A+  + +PT+I C
Sbjct: 187 DNGISIDGEVEGWFTDDTVERFRAYGWQVIPNVDGHNAEEIMVAVENARANTSQPTLICC 246

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+ G    HG+ALG++EI  TRKAL W+  PF IP DI   W  A    ++
Sbjct: 247 KTIIGFGSPNKQGKEDSHGAALGEDEITLTRKALGWEYGPFEIPADIKSAWD-AKEAGAK 305

Query: 315 TRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
            +++WQ+R  + +++   +  EF RR +  LP  F        ++ +     +ATRK+S+
Sbjct: 306 AQSEWQQRFDAYQAAYPELAAEFTRRMASELPADFAEQADAYIRECQEKGEKVATRKASQ 365

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             L+     LPEL GGSADL GSN T     K+++  D SG Y+HYGVRE  M A  NG+
Sbjct: 366 NTLDAFGPLLPELAGGSADLAGSNNTIWKGCKSVTADDASGNYIHYGVREFGMTAIQNGL 425

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
            LH GL PY GTF+VF +Y+R A+R+A++M    I V THDSIGLGEDGPTHQP+E LA 
Sbjct: 426 CLHGGLRPYGGTFLVFMEYARNAVRMAAIMHQPNILVYTHDSIGLGEDGPTHQPIEQLAN 485

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR  P++   RP D++E+   W+ A+  ++ PS L  SRQ LP +    E       G Y
Sbjct: 486 LRLTPNMRTWRPCDTVESAVSWKQAVLRQDGPSALIFSRQGLPCMERGSEQLAEIEKGGY 545

Query: 552 DYIS----TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
             +     TP+A   I ++GSE+++AV A   L+ +NI  RVVS+PC E F  Q  +Y+ 
Sbjct: 546 TLLQTGEDTPDA--IIIATGSEVELAVIAARALTGKNI--RVVSMPCVEEFLAQDKAYQD 601

Query: 608 QII-GSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDM 666
            ++ G    ++A+EA +   W  F+G DG  IGM  FGAS     L++HF I A A+ + 
Sbjct: 602 SVLPGDVRARVAVEAAIADYWFRFVGLDGKVIGMNSFGASAPAGDLFKHFNITAEAVQEA 661

Query: 667 VERKL 671
           VE  L
Sbjct: 662 VESLL 666


>gi|303256696|ref|ZP_07342710.1| transketolase [Burkholderiales bacterium 1_1_47]
 gi|302860187|gb|EFL83264.1| transketolase [Burkholderiales bacterium 1_1_47]
          Length = 663

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 311/661 (47%), Positives = 420/661 (63%), Gaps = 11/661 (1%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+A+R L+MDA++  NSGHPG+PMGMAD+  AL+T+ +  +P  P W  RDRF+LS GH
Sbjct: 1   MANAVRALAMDAVQKANSGHPGMPMGMADIAVALWTKHLRHNPSDPKWLGRDRFLLSNGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L GY D+TI+D+KNFR + SKT GHPE G   G+E +TGPLGQGIANAVG
Sbjct: 61  GSMLQYALLHLAGY-DLTIDDLKNFRQLHSKTPGHPEIGVTPGVETSTGPLGQGIANAVG 119

Query: 142 MAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           MA+AE+ L  EF   G  +I++YTY  +GDGCLMEGIS E  S AG   L+KLI L+D+N
Sbjct: 120 MALAEKMLAAEFNEEGYDIINNYTYAFLGDGCLMEGISHEVCSLAGVWKLNKLIALYDDN 179

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           GISIDG I      +   RF +  WN +  ++GHD  A++  + +A+ SDKPT+I C+TV
Sbjct: 180 GISIDGKIENWFGENVRERFESYNWNVIGPIDGHDIEAVSEAIEEAKKSDKPTLIDCKTV 239

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAGLRSSQT 315
           IGFGSPNRAGT+K HGS LG EE+   +KAL W+  PF IP +I   +  R AG    + 
Sbjct: 240 IGFGSPNRAGTSKAHGSPLGDEELAEAKKALGWEYAPFEIPQEIYDAFDARKAGAEMEEA 299

Query: 316 RADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLE 375
             +   R +    +   E ERR    LP+ +D+  +            +ATRK+S++ L 
Sbjct: 300 WLEKYRRYAEAFPAKAAELERRMKGQLPENWDDVILEAIVNAAGEAKTVATRKASQMALN 359

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
                LPEL+GGSADLT SN T    ++A+    + GR+++YGVRE  M A MNGIAL+ 
Sbjct: 360 AYAPHLPELLGGSADLTSSNLTNWEGVQAMRPDTYLGRHINYGVREFGMCAIMNGIALYG 419

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
           G  PY  TF+ F+DY R A+R+A+LM +R I V THDSIG+GEDGPTHQP+E   +LR I
Sbjct: 420 GFIPYGATFLTFADYGRNALRMAALMKLRSIFVFTHDSIGVGEDGPTHQPIEQTESLRII 479

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIS 555
           P++ V RPAD+ ETL  W  A+  ++ PS L  SRQNLPF+     + +    G Y  + 
Sbjct: 480 PNMDVWRPADACETLTAWACAISRQDGPSSLIFSRQNLPFVERDEINVDDMEKGGYIMLE 539

Query: 556 TPNA----QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
            PN     +VT+ ++GSE+ +A EA + L + NI TR++S+P   +F  Q   YR  ++G
Sbjct: 540 APNGPSSVEVTLVATGSEVALAAEARKQLLAMNIQTRLISMPSTTVFDRQDKEYRDFVLG 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
                +AIEAG   GW  +I   G+ IG+  FG S     L++ FG     +V+ V+  L
Sbjct: 600 EGRPVVAIEAGRTDGWWKYIRGAGTVIGLDRFGESAPASELFKLFGFTVDNVVETVQHVL 659

Query: 672 S 672
           S
Sbjct: 660 S 660


>gi|309783120|ref|ZP_07677839.1| transketolase [Ralstonia sp. 5_7_47FAA]
 gi|308918228|gb|EFP63906.1| transketolase [Ralstonia sp. 5_7_47FAA]
          Length = 671

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 318/656 (48%), Positives = 424/656 (64%), Gaps = 14/656 (2%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR L+MDA++  NSGHPG PMGMAD+  AL+++ +  +P  P WP+RDRFVLS GH
Sbjct: 17  MANAIRVLAMDAVQQANSGHPGAPMGMADIAVALWSRHLRHNPLNPRWPDRDRFVLSNGH 76

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L GY D+ + ++KNFR + SKTAGHPEYG   G+E TTGPLGQGI NAVG
Sbjct: 77  GSMLIYALLHLTGY-DLPMSELKNFRQLHSKTAGHPEYGITPGVETTTGPLGQGITNAVG 135

Query: 142 MAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           MA+AER L +EF   G  +++H+TYV +GDGCLMEGIS EA S AG L L+KLI LWD+N
Sbjct: 136 MALAERLLGQEFNRPGFDIVNHHTYVFLGDGCLMEGISHEACSLAGTLKLNKLIALWDDN 195

Query: 199 GISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           GISIDG +    + D   RF A GWN + +V+GH+  A+ + + +A+ SDKPT+I C T+
Sbjct: 196 GISIDGDVVHWFNDDTPKRFEAYGWNVIRAVDGHNVDAVDAAIAEAKKSDKPTLICCRTL 255

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IG G+PN+ G + VHG+ LG  EI A R+AL W   PF +P  +   W   G   +  +A
Sbjct: 256 IGKGAPNKEGGHDVHGAPLGGVEIAAAREALAWPHAPFEVPQAVYDAWDAKGQGQALEKA 315

Query: 318 DWQ---ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
            W    +  S    +  ++FERR    LP  F+ A     +K E     IATRK+S+  L
Sbjct: 316 -WNALFDAYSDRYPAEAEQFERRMRGELPASFEKAVDEFIEKCELKAETIATRKASQNTL 374

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           E     L EL+GGSADLTGSN T  S  KA+ + D  G +++YGVRE  M+A MNGIALH
Sbjct: 375 EAYAPVLGELLGGSADLTGSNLTNWSGSKAV-RVDAWGNHINYGVREFGMSAIMNGIALH 433

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            G  PY GTF+ FSDYSR A+R+A+LM IR I V THDSIGLGEDGPTHQ +EH+A+LR 
Sbjct: 434 GGYIPYGGTFLTFSDYSRNALRMAALMKIRSIFVFTHDSIGLGEDGPTHQSIEHVASLRL 493

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI 554
           IP++ V R AD+ ET   W  A++ +N PS L  SRQNLPF      +    A G Y   
Sbjct: 494 IPNMDVWRTADTTETAVAWAAAIERQNGPSCLIFSRQNLPFQARNPATREAIARGGYVLR 553

Query: 555 STPNAQ--VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
              N +  V I ++GSE+ +AV A + L++  I  RVVSVP   +F +Q  +Y+A ++ +
Sbjct: 554 DAANGKPDVVIIATGSEVGLAVGAADQLAAEGIHARVVSVPATTVFDKQDSAYKASVLPA 613

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
              +IA+EAG+   W  +     + +G+  FG S    +L++HFG     +V+  +
Sbjct: 614 GVPRIAVEAGVTDFWWKY--QVQAVVGIDTFGESAPAGVLFKHFGFTVENVVNTAK 667


>gi|313668196|ref|YP_004048480.1| transketolase [Neisseria lactamica ST-640]
 gi|313005658|emb|CBN87101.1| transketolase [Neisseria lactamica 020-06]
          Length = 659

 Score =  602 bits (1551), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 311/660 (47%), Positives = 434/660 (65%), Gaps = 12/660 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIRFLS DA++  NSGHPG PMGMA++   L+T+ +  +P  P + NRDRF+LS G
Sbjct: 3   QLANAIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHNPANPKFYNRDRFILSNG 62

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML Y+LL+L GY +++IED+KNFR + SKT GHPEYG   G+E TTGPLGQGIANAV
Sbjct: 63  HASMLLYSLLHLTGY-NLSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANAV 121

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DHYTYV +GDGCLMEG+S EA S AG LGL KLIVL+D+
Sbjct: 122 GMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEACSLAGTLGLGKLIVLYDD 181

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIACE 255
           N ISIDG +    + +   RF + GW+ + +VNGHD  AI + +  A+  + KP++I C+
Sbjct: 182 NNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTAAIQTAIEAARAETGKPSIICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG GS N+ G++K HG+ LG +EI+ATRK L W    F IP +I   W  A  + ++ 
Sbjct: 242 TLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWAYPAFEIPQEIYDAWN-AKEKGAKL 300

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A+W E  +  ++       EF RR    LP+ FD       K+       +ATRK+S+ 
Sbjct: 301 EAEWNELFAQYQAKYPAEAAEFVRRMDKKLPENFDEYVQTALKEVCAKAETVATRKASQN 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E++   LPEL+GGSADLT SN T  S   ++++ D  G Y+HYGVRE  M A MNG+A
Sbjct: 361 SIEILAKELPELVGGSADLTPSNLTDWSNSVSVTR-DKGGNYIHYGVREFGMGAIMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ P+  TF++FS+Y R A+R+A+LM I  + V THDSIGLGEDGPTHQP+E  A L
Sbjct: 420 LHGGVKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSIGLGEDGPTHQPIEQTATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYESNNLCALGAY 551
           R IP++ V RP D+ E+L  W  A+K  + PS L  SRQNL F  R + + N++   G  
Sbjct: 480 RLIPNMDVWRPCDTAESLVAWAEAVKASDHPSCLIFSRQNLKFQARDEQQLNDIKRGGYV 539

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              +  NAQ  I ++GSE+++A+EA + L+++NI+ RVVS+P   +F  Q  +Y+A ++ 
Sbjct: 540 ISEARGNAQAVIIATGSEVELALEAQKALAAQNIAVRVVSMPSTNVFDRQDAAYQAAVLP 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
               +IA+EAG   GW  ++G +G+ +G+  FG S   DLL++ FG     +VD V+  L
Sbjct: 600 EGLPRIAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKEFGFTVDNVVDTVKSVL 659


>gi|241664162|ref|YP_002982522.1| transketolase [Ralstonia pickettii 12D]
 gi|240866189|gb|ACS63850.1| transketolase [Ralstonia pickettii 12D]
          Length = 671

 Score =  602 bits (1551), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 318/660 (48%), Positives = 426/660 (64%), Gaps = 14/660 (2%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR L+MDA++  NSGHPG PMGMAD+  AL+++ +  +P  P WP+RDRFVLS GH
Sbjct: 17  MANAIRVLAMDAVQQANSGHPGAPMGMADIAVALWSRHLRHNPLNPRWPDRDRFVLSNGH 76

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L GY D+ + ++KNFR + SKTAGHPEYG   G+E TTGPLGQGI NAVG
Sbjct: 77  GSMLIYALLHLTGY-DLPMSELKNFRQLHSKTAGHPEYGITPGVETTTGPLGQGITNAVG 135

Query: 142 MAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           MA+AER L +EF   G  +++H+TYV +GDGCLMEGIS EA S AG L L+KLI LWD+N
Sbjct: 136 MALAERLLGQEFNRPGFDIVNHHTYVFLGDGCLMEGISHEACSLAGTLKLNKLIALWDDN 195

Query: 199 GISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           GISIDG +    + D   RF A GWN + +V+GH+  A+ + + +A+ SDKPT+I C T+
Sbjct: 196 GISIDGDVVHWFNDDTPKRFEAYGWNVIRAVDGHNVDAVDAAIAEAKKSDKPTLICCRTL 255

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IG G+PN+ G + VHG+ LG  EI A R+AL W   PF +P  +   W   G   +  +A
Sbjct: 256 IGKGAPNKEGGHDVHGAPLGGVEIAAAREALAWPHAPFEVPQAVYDAWDAKGQGQALEKA 315

Query: 318 DWQ---ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
            W    +  S    +  ++FERR    LP  F+ A     +K E     IATRK+S+  L
Sbjct: 316 -WNALFDAYSDRYPAEAEQFERRMRGELPASFEKAVDEFIEKCELKAETIATRKASQNTL 374

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           E     L EL+GGSADLTGSN T  S  KA+ + D  G +++YGVRE  M+A MNGIALH
Sbjct: 375 EAYAPVLGELLGGSADLTGSNLTNWSGSKAV-RVDAWGNHINYGVREFGMSAIMNGIALH 433

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            G  PY GTF+ FSDYSR A+R+A+LM IR I V THDSIGLGEDGPTHQ +EH+A+LR 
Sbjct: 434 GGYIPYGGTFLTFSDYSRNALRMAALMKIRSIFVFTHDSIGLGEDGPTHQSIEHVASLRL 493

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI 554
           IP++ V R AD+ ET   W  A++ +N PS L  SRQNLPF      +    A G Y   
Sbjct: 494 IPNMDVWRTADTTETAVAWAAAIERQNGPSCLIFSRQNLPFQARNPATREAIARGGYVLR 553

Query: 555 STPNAQ--VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
              N +  V I ++GSE+ +AV A + L++  I  RVVSVP   +F +Q  +Y+A ++ +
Sbjct: 554 DATNGKPDVVIIATGSEVGLAVGAADQLAAEGIHARVVSVPATTVFDKQDAAYKASVLPA 613

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLS 672
              +IA+EAG+   W  +     + +G+  FG S    +L++HFG     +V+  +  ++
Sbjct: 614 GVPRIAVEAGVTDFWWKY--QVQAVVGIDTFGESAPAGVLFKHFGFTVENVVNTAKSVIA 671


>gi|332531181|ref|ZP_08407094.1| transketolase [Hylemonella gracilis ATCC 19624]
 gi|332039288|gb|EGI75701.1| transketolase [Hylemonella gracilis ATCC 19624]
          Length = 676

 Score =  601 bits (1550), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 317/680 (46%), Positives = 434/680 (63%), Gaps = 32/680 (4%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           + ++MA+AIR L+MDA++  NSGHPG PMGMAD+  AL+ Q +  +P+ P+W +RDRFVL
Sbjct: 3   NTQQMANAIRALAMDAVQQANSGHPGAPMGMADMAVALWGQHLKHNPKNPHWADRDRFVL 62

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           S GHGSML YALL+L GY D+ I ++KNFR + SKTAGHPE G   G+E TTGPLGQG+ 
Sbjct: 63  SNGHGSMLIYALLHLTGY-DLPIGELKNFRQLHSKTAGHPEVGITPGVETTTGPLGQGVT 121

Query: 138 NAVGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVL 194
           NAVGMA+AE+ +  EF   G  ++DH+TYV +GDGC+MEG+S EA + AG   L+KLI L
Sbjct: 122 NAVGMALAEKLMAAEFNRDGHAIVDHHTYVFLGDGCMMEGVSHEAAALAGAWKLNKLIAL 181

Query: 195 WDNNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQL-SDKPTMI 252
           +D+NGISIDG +    S +   RF + GWN +  +NGHD  A+   + KA+  +++P++I
Sbjct: 182 YDDNGISIDGQVQPWFSDNTSLRFVSYGWNVIGPINGHDPQAVAEAIAKAKTQTERPSLI 241

Query: 253 ACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRS 312
            C+T IG GSPNRAGT K HG  LG +EIK TR+AL W   PF IP ++   W  A  R 
Sbjct: 242 ICKTSIGKGSPNRAGTAKAHGEPLGADEIKLTREALEWPHAPFEIPAEVYADWD-AKTRG 300

Query: 313 SQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
               + W  + ++  ++   +  EF+RR +  LP  F    ++           +ATRK+
Sbjct: 301 ESAESSWNNKFAAYAAAHPELAAEFKRRMAGDLPKAFAQVAVDAAVAAHSKADTVATRKA 360

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAI----------SKSDFSGRYLHYGV 419
           S++ LE     LPEL+GGSADLTGSN T TS   A+          S     GR+++YGV
Sbjct: 361 SQIALEAFTAALPELLGGSADLTGSNLTNTSHTPALRFDSTGAVVKSSDGKVGRHINYGV 420

Query: 420 REHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGED 479
           RE  MAA MNG+ALH G  PY GTF+ FSDYSR AIR+A+LM  RVIHV THDSIGLGED
Sbjct: 421 REFGMAAIMNGVALHGGYIPYGGTFLTFSDYSRNAIRMAALMKQRVIHVFTHDSIGLGED 480

Query: 480 GPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQ 539
           GPTHQ +EH A+LR IP+L V RPAD+ ET   W VAL+ K RP+ L LSRQNL +   +
Sbjct: 481 GPTHQSIEHAASLRFIPNLDVWRPADTAETAVAWAVALENKTRPTALLLSRQNLAYAPKR 540

Query: 540 YESNNLCALGAYDYISTP-------NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSV 592
              +   + GAY  +S P         Q  I ++GSE+ +A++A E+L+++ I+ RVVS+
Sbjct: 541 DLGD--ISRGAY-VLSEPEHVGLKKKPQALIIATGSEVALALKAQELLAAQKIAVRVVSM 597

Query: 593 PCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLL 652
           P   +F  Q  +Y+  I+ +   ++A+E G   GW  +  S  + +G+  +G S    +L
Sbjct: 598 PSATVFDRQKAAYKQAILPAGLPRVAVEMGATGGWWKYGCS--AVVGIDTYGESAPAPVL 655

Query: 653 YQHFGINAIAIVDMVERKLS 672
           ++HFG     + D V   L+
Sbjct: 656 FKHFGFTPENVADTVRAVLA 675


>gi|30248345|ref|NP_840415.1| transketolase [Nitrosomonas europaea ATCC 19718]
 gi|30138231|emb|CAD84239.1| Transketolase [Nitrosomonas europaea ATCC 19718]
          Length = 672

 Score =  601 bits (1550), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 310/661 (46%), Positives = 422/661 (63%), Gaps = 13/661 (1%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +K +  AIR L+MDA++  NSGHPG+PMGMA++   L+   M  +P  P W +RDRFVLS
Sbjct: 13  FKNLTSAIRALAMDAVQKANSGHPGMPMGMAEIAEVLWNHHMRHNPTNPDWVDRDRFVLS 72

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
            GHGSML YALL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQGI N
Sbjct: 73  NGHGSMLIYALLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGITN 131

Query: 139 AVGMAIAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLW 195
           AVGMA+AE+ L EEF      ++DHYTYV +GDGC+MEGIS EA S AG L L KL+  +
Sbjct: 132 AVGMALAEKILAEEFNRPYFPIVDHYTYVFLGDGCMMEGISHEACSLAGTLKLGKLVCFY 191

Query: 196 DNNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIA 253
           D+NGISIDG +    + +   RF + GW+ +  VNGHD  AI + +  A+ + DKPT+I 
Sbjct: 192 DDNGISIDGHVEGWFTDNTPKRFESYGWHVVPDVNGHDPVAIQAAIEAAKKVQDKPTLIC 251

Query: 254 CETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSS 313
           C+TVIG GSPN+A T+ VHG+ALG +EI A R  + W+  PF IP ++   W  A  +  
Sbjct: 252 CKTVIGMGSPNKANTSHVHGAALGNDEIAAARPHIGWNYLPFEIPQEVYDAWD-ARAKGQ 310

Query: 314 QTRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSS 370
              + W    +           EF RR +D LP  + +       +    +  IATRK+S
Sbjct: 311 ALESAWNSMFAEYGKKYPAEAAEFTRRMADELPVGWADHVEGTISQINAREETIATRKAS 370

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           +  +E +   LPELIGGSADL GSN T  S  K IS ++ +G Y+ YGVRE  M+A MNG
Sbjct: 371 QNSIEALAPVLPELIGGSADLAGSNLTMWSGSKGIS-TESTGNYVFYGVREFGMSAIMNG 429

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           ++LH G+ PY GTF++FS+Y+R A+R+A+LM IR I V THDSIGLGEDGPTHQPVE  A
Sbjct: 430 LSLHGGIIPYGGTFLMFSEYARNALRMAALMKIRNIFVFTHDSIGLGEDGPTHQPVEQTA 489

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
            LR IP++ V RP D++E++  W  A++ +  PS L  SRQNLPF +    + +L   G 
Sbjct: 490 TLRMIPNMDVWRPCDTVESIVSWVSAIERREGPSSLIFSRQNLPFQKRDAVTISLIRKGG 549

Query: 551 YDYISTPN--AQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           Y      N   Q  I ++GSE+ +A+ A + L+   I+ RVVS+PC  +F  Q  +YR  
Sbjct: 550 YILSEAANRKPQAIIIATGSEIGLAMAAQKTLAESGIAVRVVSMPCTNIFDRQDQAYRDS 609

Query: 609 IIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           ++     ++A+EAG+   W  ++G +G  IG+  FG S   + L+++FG     +V+ V+
Sbjct: 610 VLPKGIARVAVEAGVTDYWRKYVGLEGDVIGIDRFGESAPAEKLFEYFGFTVENVVNAVK 669

Query: 669 R 669
           R
Sbjct: 670 R 670


>gi|207721570|ref|YP_002252009.1| transketolase protein [Ralstonia solanacearum MolK2]
 gi|206586731|emb|CAQ17316.1| transketolase protein [Ralstonia solanacearum MolK2]
          Length = 675

 Score =  601 bits (1550), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 314/650 (48%), Positives = 422/650 (64%), Gaps = 15/650 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++MA+AIR L+MDA++  NSGHPG+PMGMAD+  AL+++ +  +P  P+WP+RDRFVLS 
Sbjct: 15  QQMANAIRVLAMDAVQQANSGHPGMPMGMADIAVALWSRHLRHNPANPHWPDRDRFVLSN 74

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY D+ + ++KNFR + SKTAGHPEYG   G+E TTGPLGQGI NA
Sbjct: 75  GHGSMLLYALLHLTGY-DLPMSELKNFRQLHSKTAGHPEYGITPGVETTTGPLGQGITNA 133

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AER L +EF   G  +++H+TYV +GDGCLMEGIS EA S AG L L+KL+ LWD
Sbjct: 134 VGMALAERLLGQEFNRPGFDIVNHHTYVFLGDGCLMEGISHEACSLAGTLRLNKLVALWD 193

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACE 255
           +NGISIDG +    + D   RF A GWN + +V+GH+  A+ + + +A++SDKPT+I C 
Sbjct: 194 DNGISIDGDVVHWFNDDTPKRFEAYGWNVIRAVDGHNVAAVEAAITQAKVSDKPTLICCR 253

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIG G+P + G + VHG+ LG  EI A R+AL W   PF +P  +   W   G   +  
Sbjct: 254 TVIGKGAPTKEGGHDVHGAPLGGAEIAAAREALAWPHAPFEVPQAVYDAWDARGQGQALE 313

Query: 316 RADWQ---ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           +A W    E  S    +  ++F+RR    LP+ F  A     +K E     IATRK+S+ 
Sbjct: 314 KA-WNALFEAYSERYPAEAEQFQRRMRGQLPEAFGKAAAEFIEKCELKAETIATRKASQN 372

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LE     L EL+GGSADLTGSN T  S  KA+ + D  G +++YGVRE  M+A MNGIA
Sbjct: 373 TLEAYGPVLSELLGGSADLTGSNLTNWSGSKAV-RVDAWGNHVNYGVREFGMSAIMNGIA 431

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G  PY GTF+ FSDYSR A+R+A+LM IR I V THDSIGLGEDGPTHQ +E +++L
Sbjct: 432 LHGGYIPYGGTFLTFSDYSRNALRMAALMKIRSIFVFTHDSIGLGEDGPTHQSIEQVSSL 491

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY- 551
           R IP++ V R AD+ ET   W  A++ ++ PS L  SRQNLPF      +    A G Y 
Sbjct: 492 RLIPNMDVWRTADTTETAVAWAAAIERQHGPSCLIFSRQNLPFQARNPATREAIARGGYV 551

Query: 552 --DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
             D        V I ++GSE+ +AV A E L++  I  RVVSVP   +F +Q  +Y+A +
Sbjct: 552 LRDTAEGRRPDVVIIATGSEVGLAVGAAEHLAAEGIQARVVSVPSTTVFDKQDAAYKASV 611

Query: 610 IGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           + +   +IA+EAG+   W  +     + +G+  FG S    +L++HFG  
Sbjct: 612 LPAGVPRIAVEAGVTDFWWKY--QVQAVVGIDTFGESAPAGVLFKHFGFT 659


>gi|220936054|ref|YP_002514953.1| transketolase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997364|gb|ACL73966.1| transketolase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 665

 Score =  601 bits (1549), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 314/666 (47%), Positives = 427/666 (64%), Gaps = 18/666 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIR LSMDA++  NSGHPG PMGMAD+   L+   M  +P  P W +RDRFV+S 
Sbjct: 5   RELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDYMKHNPANPKWADRDRFVMSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D+ ++++KNFR + SKT GHPEYG   G+E TTGPLGQGI NA
Sbjct: 65  GHGSMLVYSLLHLTGY-DLPMDELKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGITNA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L   F   G  ++DH TYV +GDGCLMEGIS EA S AG LGL KLI  +D
Sbjct: 124 VGMAIAEKALAAHFNRDGHTVVDHNTYVFLGDGCLMEGISHEACSLAGTLGLGKLIAFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKA-QLSDKPTMIAC 254
           +NGISIDG +    + D   RF + GW+ +  V+GHD  A+   +  A +++DKP++I C
Sbjct: 184 DNGISIDGEVEGWFTDDTPKRFESYGWHVVPGVDGHDGEAVKKAIEAARKVTDKPSIICC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +TVIGFGSPN+ G  + HG+ LG +EIK  R+ L W  +PF IPD+I   W  A  + +Q
Sbjct: 244 KTVIGFGSPNKQGKEECHGAPLGNDEIKLARETLGWKHEPFVIPDEIYAGWN-ARDKGAQ 302

Query: 315 TRADWQERLSSMKSS---IRKEFERRFSDALP-DCFDNAFINLKKKFEHSKPMIATRKSS 370
             A W +  +  + +   +  EF+RR S  LP D  + A   +K   + ++  IA+RK+S
Sbjct: 303 AEAAWNKTFAEYEKAHPQLAAEFKRRMSGELPADWQEKAGAYIKATIDKAE-TIASRKAS 361

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           +  +      LPEL+GGSADL GSN T     K +SK D  G Y+ YGVRE  MAA MNG
Sbjct: 362 QNAIGGYAPALPELLGGSADLAGSNLTLWKGSKGVSKEDGDGNYVFYGVREFGMAAIMNG 421

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           IALH G  PY GTF++FSDY+R  +R+++L   RVI+VLTHDSIGLGEDGPTHQP+E ++
Sbjct: 422 IALHGGFIPYGGTFLIFSDYARNGMRMSALTKQRVIYVLTHDSIGLGEDGPTHQPIEQVS 481

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
           +LR IP++ + RP D++ET   W+  ++  + P+ L LSRQNLP      E     A G 
Sbjct: 482 SLRIIPNMSLWRPCDAVETAVAWKAGIERTSGPTSLILSRQNLPHQARSAEQVASIAKGG 541

Query: 551 Y---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
           Y   D   TP+A   I ++GSE+ IA+EA E L+ +    RVVS+PC +LF  Q  +YR 
Sbjct: 542 YILKDTDGTPDA--IIIATGSEVGIAMEAAESLAGKGRKVRVVSMPCADLFDAQDAAYRE 599

Query: 608 QIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDM 666
            ++  +   ++A+EAG+   W  ++G DG  +G+  FG S     L + FG  A  +   
Sbjct: 600 AVLPKAVRARVAVEAGVTGFWLKYVGLDGRVVGIDRFGESAPGGALMKEFGFTAENVARA 659

Query: 667 VERKLS 672
           VE  L+
Sbjct: 660 VEEVLA 665


>gi|254428193|ref|ZP_05041900.1| transketolase [Alcanivorax sp. DG881]
 gi|196194362|gb|EDX89321.1| transketolase [Alcanivorax sp. DG881]
          Length = 666

 Score =  601 bits (1549), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 312/662 (47%), Positives = 425/662 (64%), Gaps = 19/662 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + +A+AIR LSMDA++  NSGHPG PMGMAD+   L+   M  +P  P W +RDRFVLS 
Sbjct: 8   RDLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRGFMQHNPADPTWADRDRFVLSN 67

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY  V+++DIKNFR +GS TAGHPEYG   GIE TTGPLGQG+ANA
Sbjct: 68  GHGSMLLYSLLHLTGY-GVSLDDIKNFRQLGSATAGHPEYGDAPGIETTTGPLGQGLANA 126

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  +F   G  +++H TY  +GDGC+MEGIS E  S AG LGL KL+  +D
Sbjct: 127 VGMALAEKMLAGQFNREGHTVVNHNTYCFLGDGCMMEGISHEVASLAGTLGLGKLVAFYD 186

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    + D   RFRA GW  + +V+GH+   IT  +  A+  +D+PT+I C
Sbjct: 187 DNGISIDGEVEGWFTDDTVERFRAYGWQVIPNVDGHNPEEITVAVENARANTDQPTLICC 246

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+ G    HG+ALG++EI  TRK L W+  PF IP DI   W  A    ++
Sbjct: 247 KTIIGFGSPNKQGKEDSHGAALGEDEIALTRKELGWEHGPFEIPADIKDAWD-AKEAGAK 305

Query: 315 TRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
            +++WQ+R  + +++   +  EF RR +  LP  F +      ++ +     +ATRK+S+
Sbjct: 306 AQSEWQQRFDAYQAAYPELAAEFLRRQAGELPADFADKADAYIRECQEKGDKVATRKASQ 365

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             L+     LPEL GGSADL GSN T     K+I+  D SG Y+HYGVRE  M A  NG+
Sbjct: 366 NTLDAFGPLLPELAGGSADLAGSNNTIWKGCKSITAEDASGNYIHYGVREFGMTAIQNGL 425

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
            LH GL PY GTF+VF +Y+R A+R+A+LM    I V THDSIGLGEDGPTHQP+E LA 
Sbjct: 426 CLHGGLRPYGGTFLVFMEYARNAVRMAALMHQPNILVYTHDSIGLGEDGPTHQPIEQLAN 485

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR  P++   RP D++E+   W+ A++ ++ PS L  SRQ LP +    +       G Y
Sbjct: 486 LRLTPNMRTWRPCDTVESAVSWKKAVQRQDGPSSLIFSRQGLPCMERGNDQLADVEKGGY 545

Query: 552 DYIS----TPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
             +     TP+A   I ++GSE+++AV+A + LS +NI  RVVS+PC E F  Q  +Y+ 
Sbjct: 546 TLLQTGEGTPDA--IIIATGSEVELAVKAAQALSGKNI--RVVSMPCVEEFLAQDKAYQD 601

Query: 608 QIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDM 666
            ++ S    ++A+EA +   W  F+G DG  +GM  FGAS     L++HF I A A+ + 
Sbjct: 602 SVLPSDVRARVAVEAAIADYWYRFVGLDGKVVGMTSFGASAPAGDLFKHFNITAEAVQEA 661

Query: 667 VE 668
           VE
Sbjct: 662 VE 663


>gi|73542526|ref|YP_297046.1| transketolase [Ralstonia eutropha JMP134]
 gi|72119939|gb|AAZ62202.1| transketolase [Ralstonia eutropha JMP134]
          Length = 677

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 317/663 (47%), Positives = 419/663 (63%), Gaps = 15/663 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K MADAIR L+MDA++  NSGHPG PMGMAD+  AL+ + +  +P  P+W +RDRFVLS 
Sbjct: 18  KLMADAIRVLAMDAVQQANSGHPGAPMGMADIAVALWGRHLKHNPANPHWADRDRFVLSN 77

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY D+ IE++KNFR + SKTAGHPEYG   G+E TTGPLGQGI NA
Sbjct: 78  GHGSMLIYALLHLTGY-DLPIEELKNFRQLHSKTAGHPEYGITPGVETTTGPLGQGITNA 136

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AER L EEF   G  +++HYTYV +GDGCLMEGIS EA S AG L L+KLI LWD
Sbjct: 137 VGMALAERLLGEEFNRPGFNIVNHYTYVFLGDGCLMEGISHEACSLAGTLKLNKLIALWD 196

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACE 255
           +NGISIDG +    + D   RF A GWN +  ++GHD  A+   + +A+ SDKPT+I C 
Sbjct: 197 DNGISIDGDVVHWFNDDTPKRFEAYGWNVIRGIDGHDVTAVDLAISQAKASDKPTLICCR 256

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAGLRSS 313
           T IG G+PN+ G + VHG+ LG  E+ ATR+AL W   PF +P D+   W  +  GL   
Sbjct: 257 TKIGKGAPNKEGGHDVHGAPLGGAEVLATREALGWAHAPFEVPADVYDAWDAKATGLALE 316

Query: 314 QTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
           +      E  +        EF+RR    LP  FD A      K E     IATRK+S+  
Sbjct: 317 KAWNALFEGYADRHPYEAGEFQRRMRGELPGSFDAAVDAFIAKCEEKAETIATRKASQNT 376

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           +E     LPE +GGSADLTGSN T  S  +A+ + D  G +++YGVRE  M+A +NGI L
Sbjct: 377 IEAFGPVLPEFLGGSADLTGSNLTNWSGSQAV-RVDAWGNHINYGVREFGMSAILNGITL 435

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H G  PY  TF+ FSDYSR A+R+A+LM IR + V THDSIGLGEDGPTHQ +EH+A+LR
Sbjct: 436 HGGYIPYGATFLTFSDYSRNALRMAALMKIRSLFVFTHDSIGLGEDGPTHQSIEHVASLR 495

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDY 553
            IP++ V R AD+ ET   W  A++ +N PS L  SRQNLPF +    +    A G Y  
Sbjct: 496 LIPNMDVWRTADTTETAVAWAEAIRRENGPSCLIFSRQNLPFQQRDDATRANIARGGYVL 555

Query: 554 ISTPNAQV-----TIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
               NA        I ++GSE+ +AV A + L++  +  RVVS+P   +F +Q  +Y+A 
Sbjct: 556 RDGTNANTGRPDAVILATGSEVGLAVGAADQLAAEGVHVRVVSIPATTVFDKQDSAYKAS 615

Query: 609 IIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           ++ +   ++A+EAG+   W  +     + +G+  FG S    +L++HFG     +V  V+
Sbjct: 616 VLPAGVPRVAVEAGVTDFWWKY--QVQAVVGIDTFGQSAPAGVLFKHFGFTVENVVRTVK 673

Query: 669 RKL 671
             L
Sbjct: 674 DTL 676


>gi|261250721|ref|ZP_05943295.1| transketolase [Vibrio orientalis CIP 102891]
 gi|260937594|gb|EEX93582.1| transketolase [Vibrio orientalis CIP 102891]
          Length = 664

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 314/656 (47%), Positives = 425/656 (64%), Gaps = 18/656 (2%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           K+AD IR LSMDA++   SGHPG PMGMAD+   L+   +  +P  P W +RDRF+LS G
Sbjct: 6   KLADTIRVLSMDAVQKAGSGHPGAPMGMADIAEVLWRDFLKHNPTDPTWSDRDRFILSNG 65

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y+LL+L GY D+T+EDIK+FR + +KTAGHPEYG   GIE TTGPLGQGI N V
Sbjct: 66  HGSMLIYSLLHLTGY-DLTMEDIKSFRQLHAKTAGHPEYGYAPGIETTTGPLGQGITNGV 124

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L E+F   G  ++DH+TYV +GDGC+MEGIS EA S AG LGL KL+  WD+
Sbjct: 125 GMALAEKVLGEQFNRPGHDIVDHFTYVFMGDGCMMEGISHEACSLAGTLGLGKLVAFWDD 184

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQL-SDKPTMIACE 255
           NGISIDG +    S D   RF A GW+ ++ V+GH+  AI   + +A+  +DKPT+I C+
Sbjct: 185 NGISIDGEVEGWFSDDTPKRFEAYGWHVIADVDGHNAEAIRKAILEAKAETDKPTLICCK 244

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAGLRSS 313
           T+IGFGSPN++ ++  HG+ LG++E+   R+ L WD  PF IP DI  +W  + AG    
Sbjct: 245 TIIGFGSPNKSASHDCHGAPLGEDEVALVRENLGWDYAPFEIPADIYSEWDGKDAG---K 301

Query: 314 QTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSS 370
             +A WQ R  + + +   +  E++RR    LP+ +     ++    + +   IATRK+S
Sbjct: 302 DAQAQWQNRFDAYQQAFPELAAEYKRRVEGELPENWQQISQDVIATLQANPATIATRKAS 361

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           +  +E     LPE +GGSADLT SN T  S  KAIS  D SG YL YGVRE AM+A MNG
Sbjct: 362 QNAIEAFGAHLPEFLGGSADLTPSNLTNWSGSKAISAQDASGNYLSYGVREFAMSAMMNG 421

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           IALH G  PY GTF++F +Y+R A+R+A+LM  R I V THDSIGLGEDGPTHQPVE +A
Sbjct: 422 IALHGGFIPYGGTFLMFMEYARNALRMAALMKQRSIFVYTHDSIGLGEDGPTHQPVEQIA 481

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALG 549
           +LR  P++   RP D +ET   W+ A++ K+ P+ L  SRQNL  F R Q   N++   G
Sbjct: 482 SLRLTPNMSTWRPCDQVETAVAWKSAVERKDGPTSLIFSRQNLVQFERDQATLNDVAKGG 541

Query: 550 AYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
                     ++ + ++GSE+ +A++A E LS  N+  RVVS+P  +LF  Q+  YR Q+
Sbjct: 542 YILSDCDGQPELILIATGSEVALAMQAKEQLS--NVRCRVVSMPSTDLFEAQTPEYREQV 599

Query: 610 IGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIV 664
           + +S  K IAIEAG+   W  + G +G  IGM  FG S   + L++ +G     +V
Sbjct: 600 LPASVSKRIAIEAGIADYWFKYTGLNGDIIGMTTFGESAPAEQLFEMYGFTVENVV 655


>gi|187930057|ref|YP_001900544.1| transketolase [Ralstonia pickettii 12J]
 gi|187726947|gb|ACD28112.1| transketolase [Ralstonia pickettii 12J]
          Length = 671

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 317/656 (48%), Positives = 424/656 (64%), Gaps = 14/656 (2%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA+AIR L+MDA++  NSGHPG PMGMAD+  AL+++ +  +P  P WP+RDRFVLS GH
Sbjct: 17  MANAIRVLAMDAVQQANSGHPGAPMGMADIAVALWSRHLRHNPLNPRWPDRDRFVLSNGH 76

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L GY D+ + ++KNFR + SKTAGHPEYG   G+E TTGPLGQGI NAVG
Sbjct: 77  GSMLIYALLHLTGY-DLPMSELKNFRQLHSKTAGHPEYGITPGVETTTGPLGQGITNAVG 135

Query: 142 MAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           MA+AER L +EF   G  +++H+TYV +GDGCLMEGIS EA S AG L L+KLI LWD+N
Sbjct: 136 MALAERLLGQEFNRPGFDIVNHHTYVFLGDGCLMEGISHEACSLAGTLKLNKLIALWDDN 195

Query: 199 GISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           GISIDG +    + D   RF A GWN + +V+GH+  A+ + + +A+ SDKPT+I C T+
Sbjct: 196 GISIDGDVVHWFNDDTPKRFEAYGWNVIRAVDGHNVDAVDAAIAEAKKSDKPTLICCRTL 255

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IG G+PN+ G + VHG+ LG  EI A R+AL W   PF +P  +   W   G   +  +A
Sbjct: 256 IGKGAPNKEGGHDVHGAPLGGVEIAAAREALAWPHAPFEVPQAVYDAWDAKGQGQALEKA 315

Query: 318 DWQ---ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
            W    +  S    +  ++FERR    LP  F+ A     +K E     IATRK+S+  L
Sbjct: 316 -WNALFDAYSDRYPAEAEQFERRMRGELPASFEKAVDEFIEKCELKAETIATRKASQNTL 374

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           E     L EL+GGSADLTGSN T  S  KA+ + +  G +++YGVRE  M+A MNGIALH
Sbjct: 375 EAYAPVLGELLGGSADLTGSNLTNWSGSKAV-RVEAWGNHINYGVREFGMSAIMNGIALH 433

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            G  PY GTF+ FSDYSR A+R+A+LM IR I V THDSIGLGEDGPTHQ +EH+A+LR 
Sbjct: 434 GGYIPYGGTFLTFSDYSRNALRMAALMKIRSIFVFTHDSIGLGEDGPTHQSIEHVASLRL 493

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI 554
           IP++ V R AD+ ET   W  A++ +N PS L  SRQNLPF      +    A G Y   
Sbjct: 494 IPNMDVWRTADTTETAVAWAAAIERQNGPSCLIFSRQNLPFQARNPATREAIARGGYVLR 553

Query: 555 STPNAQ--VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
              N +  V I ++GSE+ +AV A + L++  I  RVVSVP   +F +Q  +Y+A ++ +
Sbjct: 554 DAANGKPDVVIIATGSEVGLAVGAADQLAAEGIHARVVSVPATTVFDKQDSAYKASVLPA 613

Query: 613 SPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
              +IA+EAG+   W  +     + +G+  FG S    +L++HFG     +V+  +
Sbjct: 614 GVPRIAVEAGVTDFWWKY--QVQAVVGIDTFGESAPAGVLFKHFGFTVENVVNTAK 667


>gi|241766047|ref|ZP_04763964.1| transketolase [Acidovorax delafieldii 2AN]
 gi|241363953|gb|EER59234.1| transketolase [Acidovorax delafieldii 2AN]
          Length = 684

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 315/682 (46%), Positives = 429/682 (62%), Gaps = 39/682 (5%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           +MA+AIR L+MDA++  NSGHPG PMGMAD+  AL+ + +  +P  P+W +RDRFVLS G
Sbjct: 9   QMANAIRALAMDAVQQANSGHPGAPMGMADMAVALWGRHLKHNPANPHWFDRDRFVLSNG 68

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YALL+L GY D+ I ++KNFR + SKTAGHPE G   G+E TTGPLGQGI NAV
Sbjct: 69  HGSMLLYALLHLTGY-DLPISELKNFRQLHSKTAGHPEVGVTPGVETTTGPLGQGITNAV 127

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           G A+AE+ L  EF   G  ++DH+TY  +GDGCLMEGIS EA+S AG   L+KLI L+D+
Sbjct: 128 GFALAEKLLASEFNREGHAVVDHHTYTFLGDGCLMEGISHEAVSLAGAWKLNKLIALYDD 187

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQ-LSDKPTMIACE 255
           NGISIDG ++   + +   RF A GWN +  ++GHD   +   + +A+  +++PT+I C+
Sbjct: 188 NGISIDGQVAPWFADNTPLRFVACGWNVIGPIDGHDADKVAEAIAEAKKQTERPTLIVCK 247

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T IG GSPNRA T K HG  LG +EIK TR+AL W  +PF +P+D+   W  A       
Sbjct: 248 THIGKGSPNRANTAKAHGEPLGADEIKLTREALGWTSEPFVVPEDVYASWN-AKANGQSA 306

Query: 316 RADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A W ER ++  ++   +  EF RR +  LP  F    ++           +A+RK+S+L
Sbjct: 307 EAAWNERFAAYSAAFPELAAEFTRRMNGDLPANFAQVAVDTVVAAHTKGETVASRKASQL 366

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTS--------------QMKAISKSDFSGRYLHYG 418
            LE     LPEL+GGSADLTGSN T T               Q +        GR+++YG
Sbjct: 367 ALEAFTAALPELLGGSADLTGSNLTNTKSTPNLRFDLQGNVVQTELEGGKKIGGRHINYG 426

Query: 419 VREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGE 478
           VRE  MAA MNGIALH G  PY GTF+ FSDYSR AIR+A+LM  RVIHV THDSIGLGE
Sbjct: 427 VREFGMAAVMNGIALHGGFIPYGGTFLTFSDYSRNAIRMAALMKQRVIHVFTHDSIGLGE 486

Query: 479 DGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRT 538
           DGPTHQ +EH+A+LR IP+L V RPAD+ ET   W VAL  +N+P+VL+LSRQNLP+   
Sbjct: 487 DGPTHQSIEHVASLRLIPNLDVWRPADTAETAVAWSVALSNRNKPTVLALSRQNLPYAPK 546

Query: 539 QYESNNLCALGAYDYISTP-------NAQVTIFSSGSELKIAVEACEILSSRNISTRVVS 591
           +   +   + GAY  +S P        A   I ++GSE+++A++A  +L+ + I  RVVS
Sbjct: 547 RDLGD--ISRGAY-VLSEPADVGLKKKAVAVIIATGSEVQLALKAQRLLADKKIPVRVVS 603

Query: 592 VPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDL 651
           +P    F  +   Y+  ++ +   ++A+E G+  GW  +     + +G+  +G S    +
Sbjct: 604 MPSTTTFDREDTKYKKAVLPAGLPRVAVEMGVTDGWWKY--GCAAVVGIDTYGESAPAPV 661

Query: 652 LYQHFGI---NAIAIVDMVERK 670
           L++HFG    N  A V  V ++
Sbjct: 662 LFKHFGFTEENVAATVQAVLKR 683


>gi|154245482|ref|YP_001416440.1| transketolase [Xanthobacter autotrophicus Py2]
 gi|154159567|gb|ABS66783.1| transketolase [Xanthobacter autotrophicus Py2]
          Length = 692

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 295/655 (45%), Positives = 424/655 (64%), Gaps = 5/655 (0%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++MADAIRFL++DAI     GHPG P+G A++ TALFT+    +P  P W +RDRFVLS 
Sbjct: 40  RRMADAIRFLALDAIAKAEDGHPGAPLGGAELATALFTRHFKCNPADPAWFDRDRFVLSN 99

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YA+L+L GY  + +E+I+ FR +G+ T GHPE     GIE TTGPLGQGIANA
Sbjct: 100 GHGSMLIYAVLHLAGYAGMPMEEIRRFRELGAHTHGHPERDVALGIEVTTGPLGQGIANA 159

Query: 140 VGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNG 199
           VGMA+AE  L   +G  L+DH TY +VGDGCLMEGI+ E IS AGHL L KL  LWD+N 
Sbjct: 160 VGMAVAEAFLSATYGPELVDHRTYAVVGDGCLMEGIAHEVISLAGHLKLGKLTFLWDDNR 219

Query: 200 ISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIG 259
           ++ DG    A S D  ARFR +GW  +  +GHD  A+++ L  A    +PTMIAC TV+G
Sbjct: 220 MTDDGGTHFAISEDVRARFRIAGWQVIDADGHDVEAVSAALILAHQDPRPTMIACTTVLG 279

Query: 260 FGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLA-GLRSSQTRAD 318
            G P   G    HG  +  E++   R A  W   PF +P D+   W+   G R+  +   
Sbjct: 280 KGLPRLEGKRGAHGGRVFPEDVVEARAAAGWTHGPFEVPQDVAAAWQAGTGERNRPSYEA 339

Query: 319 WQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVN 378
           WQ R++++ +  R EFER     LP    +A     +    + P  ++ +S+  +++++ 
Sbjct: 340 WQARVAALPADKRAEFERLVRGELPAGVLSALSAHAEALAAAAPAQSSNQSTADIVDLLA 399

Query: 379 DCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLA 438
             +PEL+ G+ DL G    K   + A +  + +GRY+HYG+REHAM + MNG+  H G+ 
Sbjct: 400 GLVPELLPGAPDLEGPTNCKRG-LDAFTAENPAGRYIHYGIREHAMGSMMNGMVAHGGVL 458

Query: 439 PYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDL 498
           P   T++VFSDY RP++R+++LM + VI + +HDSIG+G++GPTHQPVE LA+LRA+P++
Sbjct: 459 PLGATYLVFSDYMRPSLRMSALMELPVITLYSHDSIGIGKNGPTHQPVEFLASLRAMPNM 518

Query: 499 LVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPN 558
            V RPAD++ET ECWQ+AL  ++ PS +  SRQ LP  R+     N  A GAY   +   
Sbjct: 519 AVFRPADAVETAECWQLALARRDGPSSIICSRQALPAQRSD-AGENRSARGAYVLRAAEG 577

Query: 559 A--QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
              +VT+ ++GSE+ +AV+A ++L +  I T VVS+PC+E+F EQ ++Y  +++G   ++
Sbjct: 578 GPRRVTLIATGSEVDVAVKARDLLQAEGIPTAVVSMPCWEIFGEQDEAYVWEVLGPGTVR 637

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +A+EA ++ GW+ +IG+DG+F+GM  FGASG  D L++HFGI   A+ D    +L
Sbjct: 638 VAVEAAVKLGWERWIGADGAFVGMNSFGASGPADELFRHFGITPAAVGDAARARL 692


>gi|297566431|ref|YP_003685403.1| transketolase [Meiothermus silvanus DSM 9946]
 gi|296850880|gb|ADH63895.1| transketolase [Meiothermus silvanus DSM 9946]
          Length = 655

 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 317/656 (48%), Positives = 426/656 (64%), Gaps = 21/656 (3%)

Query: 24  DAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGS 83
           +A+R L++DA+E   SGHPG+PMGMA     L+T+ +  DP+ P WP+RDRFVLSAGHGS
Sbjct: 15  NALRILALDAVEQAKSGHPGMPMGMAPTAYVLWTEFLKHDPRDPQWPDRDRFVLSAGHGS 74

Query: 84  MLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMA 143
           ML Y LL+L GY D+ +E+++ FR  GSKT GHPEYG   G+E TTGPLGQG++ AVGMA
Sbjct: 75  MLLYGLLHLSGY-DLPLEELRRFRQWGSKTPGHPEYGHTPGVETTTGPLGQGLSTAVGMA 133

Query: 144 IAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISID 203
           IAERKL  EFG  ++DHYTYV+  DG LMEG++ EA S AGHLGL KLIV +D+N +SID
Sbjct: 134 IAERKLAAEFGSEIVDHYTYVIASDGDLMEGVTGEASSLAGHLGLGKLIVFYDDNEVSID 193

Query: 204 GPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGS 262
           G  +LA S D+  R+ A GW  +  V+G D  AI S +R AQ   +P++I+  ++IGFGS
Sbjct: 194 GSTALAFSEDRLLRYEAYGWQVIREVHGEDLAAIRSAIRAAQADPRPSIISVRSIIGFGS 253

Query: 263 PNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQER 322
           P  AG +K H  A+G E + ATR AL W+  PF IP+++   +R +  R  Q  A WQ R
Sbjct: 254 P-LAGNHKAHSDAMGPERVAATRAALGWEYPPFVIPEEVYADYRRSLERGQQAHAQWQAR 312

Query: 323 LSSMKSSIRK---EFERRFSDALPDCFDNAFINLKKKFEH--SKPMIATRKSSELVLEVV 377
             ++  +  +   EF RR    LPD        L     H  +   +ATR +S   LE +
Sbjct: 313 FEALAQAQPERAAEFRRRLEGKLPD--------LTSALPHFAAGERLATRAASGKTLERL 364

Query: 378 NDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGL 437
              LPEL+GGSADLT SN T+T  M+  S+++  GRY+HYGVREHAMAAAMNGI LH G 
Sbjct: 365 VPALPELVGGSADLTPSNNTRTPDMEDFSRTNPRGRYIHYGVREHAMAAAMNGITLHGGY 424

Query: 438 APYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPD 497
             Y GTF+VFSDY RP++RLA+LMG+  + V THDSI LGEDGPTHQP+EHL +LRAIP+
Sbjct: 425 RAYGGTFLVFSDYLRPSLRLAALMGVPTVFVFTHDSIALGEDGPTHQPIEHLMSLRAIPN 484

Query: 498 LLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTP 557
           L V+RPAD+ ET   W++AL+ +  P+ L L+RQ +P L ++ E   +   G Y     P
Sbjct: 485 LWVIRPADANETAVAWKMALQRREGPTALVLTRQAVPVL-SEVERAGV-ERGGYVISEVP 542

Query: 558 NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKI 617
             Q  I ++GSE+ +A+EA  +L  + I+ RVVS+PC+E F  Q  +YR  ++  S   +
Sbjct: 543 QPQGCIVATGSEVSLALEAQALLLQQGIAVRVVSLPCWEAFEGQPQAYRDSVLPPSLPTL 602

Query: 618 AIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
           A+EAG   GW+ +     + +G+  FGAS     +Y + G     + D V+  L V
Sbjct: 603 AVEAGASLGWERYA---DAVLGIDHFGASAPYPAVYHNLGFTKERVADKVKALLGV 655


>gi|262189792|ref|ZP_06048139.1| transketolase [Vibrio cholerae CT 5369-93]
 gi|262034327|gb|EEY52720.1| transketolase [Vibrio cholerae CT 5369-93]
          Length = 665

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 312/665 (46%), Positives = 424/665 (63%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +PQ P W +RDRFVLS 
Sbjct: 5   KQLANAIRALSMDGVQKANSGHPGAPMGMADIAEVLWRSHLNHNPQNPNWADRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI NA
Sbjct: 65  GHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGITNA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 124 VGMAIAEKALAAQFNKPGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+  + +PT+I  
Sbjct: 184 DNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKAETSRPTLICT 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+AG++  HG+ LG +EIKA R+ L W+  PF IP DI   W  A    + 
Sbjct: 244 KTIIGFGSPNKAGSHDCHGAPLGNDEIKAAREFLGWEHAPFEIPADIYAAWD-AKQAGAS 302

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W E+ ++   +      E++RR +  LP  ++ A   +    + +   IA+RK+S+
Sbjct: 303 KEAAWNEKFAAYAKAYPAEAAEYKRRVAGELPANWEAATSEIIANLQANPANIASRKASQ 362

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE     LPE +GGSADL  SN T  S  K+++  DFSG Y+HYGVRE  M A +NGI
Sbjct: 363 NALEAFGKLLPEFMGGSADLAPSNLTMWSGSKSLTAEDFSGNYIHYGVREFGMTAIINGI 422

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY  TF++F +Y+R A+R+A+LM ++ I V THDSIGLGEDGPTHQPVE +A+
Sbjct: 423 ALHGGFVPYGATFLMFMEYARNAMRMAALMKVQNIQVYTHDSIGLGEDGPTHQPVEQIAS 482

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR  P++   RP D +E+   W++A++ KN PS L  SRQNL       E     A G Y
Sbjct: 483 LRMTPNMSTWRPCDQVESAVAWKLAIERKNAPSALIFSRQNLAQQPRSAEQVANIAKGGY 542

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D    P  ++ + ++GSE+++AV A E LS+   + RVVS+P  + F +Q  +YR  
Sbjct: 543 ILKDCAGQP--ELILIATGSEVELAVAAYEQLSAEGKAVRVVSMPSTDTFDKQDAAYREA 600

Query: 609 IIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ ++  K IAIEAG+   W  ++G  G  IGM  FG S     L++ FG     +V   
Sbjct: 601 VLPAAVTKRIAIEAGIADFWYKYVGFGGRIIGMTSFGESAPAGELFKLFGFTTENVVKQA 660

Query: 668 ERKLS 672
           +  L+
Sbjct: 661 KELLA 665


>gi|225075505|ref|ZP_03718704.1| hypothetical protein NEIFLAOT_00518 [Neisseria flavescens
           NRL30031/H210]
 gi|224953140|gb|EEG34349.1| hypothetical protein NEIFLAOT_00518 [Neisseria flavescens
           NRL30031/H210]
          Length = 692

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 311/670 (46%), Positives = 436/670 (65%), Gaps = 12/670 (1%)

Query: 11  VLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWP 70
           +L K      ++A+AIRFLS DA++  NSGHPG PMGMA++   L+T+ +  +P  P + 
Sbjct: 26  ILSKEGQTMSQLANAIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHNPANPKFY 85

Query: 71  NRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTG 130
           NRDRFVLS GH SML Y+LL+L GY+ + I+D+KNFR + SKT GHPEYG   G+E TTG
Sbjct: 86  NRDRFVLSNGHASMLLYSLLHLTGYK-LGIDDLKNFRQLHSKTPGHPEYGYTDGVETTTG 144

Query: 131 PLGQGIANAVGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLG 187
           PLGQGIANAVGMA+AE+ L  EF   G  ++DH+TYV +GDGCLMEG+S EA S AG LG
Sbjct: 145 PLGQGIANAVGMALAEKILAAEFNKDGLNIVDHHTYVFMGDGCLMEGVSHEACSLAGTLG 204

Query: 188 LSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL- 245
           L KLIVL+D+N ISIDG +    + +   RF + GW+ + +VNGHD  AI + +  A+  
Sbjct: 205 LGKLIVLYDDNNISIDGKVDGWFTENIPQRFESYGWHVIPNVNGHDTDAIQTAIEAAKAE 264

Query: 246 SDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW 305
           + KP++I C+T+IG GS N+ G++K HG+ LG +EI+ATRK L WD   F IP +I   W
Sbjct: 265 TGKPSLICCKTLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWDYPAFEIPQEIYAAW 324

Query: 306 RLAGLRSSQTRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKP 362
             A  + ++  A+W E  +  ++       EF RR    LP+ FD       K+      
Sbjct: 325 D-AKEKGAKLEAEWNELFAQYQAKYPAEAAEFVRRMDKKLPENFDAYVQAALKEVCVKAE 383

Query: 363 MIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREH 422
            IATRK+S+  +E++   LPEL+GGSADLT SN T  S   ++++ +  G Y+HYGVRE 
Sbjct: 384 TIATRKASQNSIEILAKELPELVGGSADLTPSNLTDWSNSVSVTR-EHGGNYIHYGVREF 442

Query: 423 AMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPT 482
            M A MNG+ LH G+ P+  TF++FS+Y R A+R+ASLM I  + V THDSIGLGEDGPT
Sbjct: 443 GMGAIMNGLTLHGGVKPFGATFLMFSEYERNALRMASLMKINPVFVFTHDSIGLGEDGPT 502

Query: 483 HQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYE 541
           HQP+E  A LR IP++ V RP D++E+L  W  A+K  + PS L  SRQNL F  R + +
Sbjct: 503 HQPIEQTATLRLIPNMDVWRPCDTVESLVAWSEAVKAADHPSSLIFSRQNLKFQARDEQQ 562

Query: 542 SNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQ 601
            N++   G     +  NAQ  I ++GSE+ +A+EA + L+++NI+ RVVS+P   +F  Q
Sbjct: 563 LNDIKRGGYVISEAQGNAQAVIIATGSEVGLALEAQKALAAQNIAVRVVSMPSTNVFDRQ 622

Query: 602 SDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAI 661
             +Y+A ++    +++A+EAG   GW  ++G +G+ +G+  FG S   DLL++ FG    
Sbjct: 623 DTAYKAAVLPEGLLRVAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKEFGFTVD 682

Query: 662 AIVDMVERKL 671
            +V  V+  L
Sbjct: 683 NVVATVKSVL 692


>gi|83746772|ref|ZP_00943820.1| Transketolase [Ralstonia solanacearum UW551]
 gi|207744318|ref|YP_002260710.1| transketolase protein [Ralstonia solanacearum IPO1609]
 gi|83726541|gb|EAP73671.1| Transketolase [Ralstonia solanacearum UW551]
 gi|206595723|emb|CAQ62650.1| transketolase protein [Ralstonia solanacearum IPO1609]
          Length = 675

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 313/650 (48%), Positives = 421/650 (64%), Gaps = 15/650 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++MA+AIR L+MDA++  NSGHPG+PMGMAD+  AL+++ +  +P  P+WP+RDRFVLS 
Sbjct: 15  QQMANAIRVLAMDAVQQANSGHPGMPMGMADIAVALWSRHLRHNPANPHWPDRDRFVLSN 74

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY D+ + ++KNFR + SKTAGHPEYG   G+E TTGPLGQGI NA
Sbjct: 75  GHGSMLLYALLHLTGY-DLPMSELKNFRQLHSKTAGHPEYGITPGVETTTGPLGQGITNA 133

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AER L +EF   G  +++H+TYV +GDGCLMEGIS EA S AG L L+KL+ LWD
Sbjct: 134 VGMALAERLLGQEFNRPGFDIVNHHTYVFLGDGCLMEGISHEACSLAGTLRLNKLVALWD 193

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACE 255
           +NGISIDG +    + D   RF A GWN + +V+GH+  A+ + + +A++SDKPT+I C 
Sbjct: 194 DNGISIDGDVVHWFNDDTPKRFEAYGWNVIRTVDGHNVAAVEAAITQAKVSDKPTLICCR 253

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIG G+P + G + VHG+ LG  EI A R+AL W   PF +P  +   W   G   +  
Sbjct: 254 TVIGKGAPTKEGGHDVHGAPLGGAEIAAAREALAWPHAPFEVPQAVYDAWDARGQGQALE 313

Query: 316 RADWQ---ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           +A W    E  S    +  ++ +RR    LP+ F  A     +K E     IATRK+S+ 
Sbjct: 314 KA-WNALFEAYSERYPAEAEQLQRRMRGQLPEAFGKAAAEFIEKCELKAETIATRKASQN 372

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LE     L EL+GGSADLTGSN T  S  KA+ + D  G +++YGVRE  M+A MNGIA
Sbjct: 373 TLEAYGPVLSELLGGSADLTGSNLTNWSGSKAV-RVDAWGNHVNYGVREFGMSAIMNGIA 431

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G  PY GTF+ FSDYSR A+R+A+LM IR I V THDSIGLGEDGPTHQ +E +++L
Sbjct: 432 LHGGYIPYGGTFLTFSDYSRNALRMAALMKIRSIFVFTHDSIGLGEDGPTHQSIEQVSSL 491

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY- 551
           R IP++ V R AD+ ET   W  A++ ++ PS L  SRQNLPF      +    A G Y 
Sbjct: 492 RLIPNMDVWRTADTTETAVAWAAAIERQHGPSCLIFSRQNLPFQARNPATREAIARGGYV 551

Query: 552 --DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
             D        V I ++GSE+ +AV A E L++  I  RVVSVP   +F +Q  +Y+A +
Sbjct: 552 LRDAAEGKRPDVVIIATGSEVGLAVGAAEHLAAEGIQARVVSVPSTTVFDKQDAAYKASV 611

Query: 610 IGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           + +   +IA+EAG+   W  +     + +G+  FG S    +L++HFG  
Sbjct: 612 LPAGVPRIAVEAGVTDFWWKY--QVQAVVGIDTFGESAPAGVLFKHFGFT 659


>gi|323497170|ref|ZP_08102190.1| transketolase [Vibrio sinaloensis DSM 21326]
 gi|323317745|gb|EGA70736.1| transketolase [Vibrio sinaloensis DSM 21326]
          Length = 663

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 308/666 (46%), Positives = 424/666 (63%), Gaps = 15/666 (2%)

Query: 18  DYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVL 77
           D K +A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +P  P W +RDRFVL
Sbjct: 2   DRKNLANAIRALSMDGVQQANSGHPGAPMGMADIAEVLWRDHLNHNPSNPEWADRDRFVL 61

Query: 78  SAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIA 137
           S GHGSML Y+LL+L GY+ ++IED+KNFR + SKT GHPEYG   GIE TTGPLGQGI 
Sbjct: 62  SNGHGSMLIYSLLHLAGYE-LSIEDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGIT 120

Query: 138 NAVGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVL 194
           NAVGMA+AE+ L  +F   G  ++DH+TY  +GDGCLMEGIS EA S AG LGL KLI  
Sbjct: 121 NAVGMALAEKTLAAQFNKEGHDIVDHFTYAFMGDGCLMEGISHEACSLAGTLGLGKLIAF 180

Query: 195 WDNNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIA 253
           WD+NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+   +PT+I 
Sbjct: 181 WDDNGISIDGEVEGWFSDDTPKRFEAYGWHVIPAVDGHDSEAINAAIVAAKADPRPTLIC 240

Query: 254 CETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSS 313
            +T+IGFGSPN++G++  HG+ LG EEI ATRK L W+  PF IP D+  +W       +
Sbjct: 241 TKTIIGFGSPNKSGSHDCHGAPLGAEEIAATRKELGWEHGPFEIPQDVYAQWDAK-EAGA 299

Query: 314 QTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSS 370
              A W E+L++ +++   +  EF+RR +  LP  ++     +    + +   IA+RK+S
Sbjct: 300 AKEAAWNEKLAAYEAAYPELAAEFKRRVNGELPAQWEEKANAIIADLQANPANIASRKAS 359

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           +  LE     LPE +GGSADL  SN T  S  K++S  D +G Y+HYGVRE  M A MNG
Sbjct: 360 QNALEAFGAMLPEFLGGSADLAPSNLTMWSGSKSVSAEDPAGNYIHYGVREFGMTAIMNG 419

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           IALH G  PY  TF++F +Y+R A+R+A+LM ++ I V THDSIGLGEDGPTHQPVE +A
Sbjct: 420 IALHGGFVPYGATFLMFMEYARNAMRMAALMKVQNIQVYTHDSIGLGEDGPTHQPVEQMA 479

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
           +LR  P++   RP D +E+   W++A++ K+ P+ L  SRQNL       E     A G 
Sbjct: 480 SLRLTPNMSTWRPCDQVESAVAWKLAIERKDGPTSLIFSRQNLAQQERSEEQVANIAKGG 539

Query: 551 Y---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
           Y   D    P  ++ + ++GSE+++AVEA   L++     RVVS+P  + F +Q  +YR 
Sbjct: 540 YILKDCEGKP--ELILIATGSEVELAVEAAAQLTAEGKKVRVVSMPATDAFDKQDAAYRE 597

Query: 608 QIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDM 666
           +++ S    ++AIEAG+   W  ++G DG  IGM  FG S     L++ FG     +V+ 
Sbjct: 598 EVLPSDVTARVAIEAGIADFWYKYVGFDGRIIGMTTFGESAPAGELFKMFGFTTENVVNT 657

Query: 667 VERKLS 672
            +  L+
Sbjct: 658 AKELLA 663


>gi|86608597|ref|YP_477359.1| transketolase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557139|gb|ABD02096.1| transketolase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 666

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 308/660 (46%), Positives = 425/660 (64%), Gaps = 21/660 (3%)

Query: 24  DAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGS 83
           + IRFL++DA++  NSGHPGLPMG A +   L+ Q M F+P+ P W +RDRFVLSAGHG 
Sbjct: 15  NTIRFLAVDAVQKANSGHPGLPMGAAPMAYVLWQQFMKFNPRNPKWVDRDRFVLSAGHGC 74

Query: 84  MLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMA 143
           ML YALL+L G+ DV++EDIK FR  GSKT GHPE     G+E TTGPLGQG+ NAVG+A
Sbjct: 75  MLQYALLHLTGF-DVSLEDIKQFRQWGSKTPGHPENFETPGVEVTTGPLGQGVGNAVGLA 133

Query: 144 IAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           IAE  L   F   G  ++DHYTYV++GDGC MEG++ EA S AGHL L KLI+L+D+N I
Sbjct: 134 IAEAHLAARFNKPGHTIVDHYTYVILGDGCNMEGVASEAASLAGHLQLGKLIMLYDSNHI 193

Query: 201 SIDGPISLADSTDQYARFRASGWNTLSVN--GHDHHAITSTLRKA-QLSDKPTMIACETV 257
           SIDG   +A + D   R+ A GW+   V+   HD   I   +++A ++++KP++I  ET 
Sbjct: 194 SIDGRTEIAFTEDVGKRYEAYGWHVQKVDDGNHDLKGIAEAIQRAKEVTNKPSLIIVETT 253

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDP-FFIPDDIMKKWRLAGLRSSQTR 316
           IG+GSPN+AG+  VHG+ LG EE+K T++ L W L+P F+IPD+++  +R A  + ++  
Sbjct: 254 IGYGSPNKAGSESVHGAPLGPEEVKLTKQNLGWPLEPEFYIPDEVLAHFRQAIEKGAKAE 313

Query: 317 ADWQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
           A+W ER ++ + +  +E   F+R  +  LP  +  A   + +    S     TR  S+  
Sbjct: 314 AEWNERFAAYEKAYPEEAAEFKRIMAGELPVGWKEALAPIAETGRES-----TRNLSKFC 368

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIAL 433
           L  +   +PEL+GGSADL  SN T    +       + GR   +GVREH M A  NG+AL
Sbjct: 369 LNALAKAVPELLGGSADLAHSNMTYLKGIPEFQAGSYEGRNFRFGVREHGMGAIANGMAL 428

Query: 434 HKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALR 493
           H GL PY  TF++F+DY RPAIRL++L  +RV+HV+THDS+ LGEDGPTHQPVE LA+LR
Sbjct: 429 HGGLIPYDATFLIFTDYMRPAIRLSALSQVRVLHVMTHDSVALGEDGPTHQPVETLASLR 488

Query: 494 AIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCALGAYD 552
           AIP+L VLRPAD+ ET+  +QVAL+ K  PSVL  +RQ + P   T  E     A GAY 
Sbjct: 489 AIPNLYVLRPADARETVGSYQVALEAKTTPSVLVFTRQAVNPVEGTSVEG---VAKGAYV 545

Query: 553 YISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGS 612
            +  PN ++ + ++GSEL++AV+A   L     + RVVS+PC ELF  Q  SYR  ++  
Sbjct: 546 VVDAPNPELILIATGSELELAVKAAAQLKQEGRAVRVVSMPCMELFEAQPQSYRDSVLPP 605

Query: 613 SPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           +  K +++EAG   GW  ++G +G  IG+  FGAS    +  + FG     +V+   R L
Sbjct: 606 NVTKRVSVEAGCTFGWHKYLGFEGVAIGIDRFGASAPGPVCMEKFGFTVENVVNTARRLL 665


>gi|326571479|gb|EGE21494.1| transketolase [Moraxella catarrhalis BC7]
          Length = 662

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 318/672 (47%), Positives = 421/672 (62%), Gaps = 23/672 (3%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M  + + +  A+AIR L+MDA++  NSGHPG PMGMAD+   L+ + +  +P+   W NR
Sbjct: 1   MPIELNQRHNANAIRILAMDAVQQANSGHPGAPMGMADIAEVLWREFLRHNPKNAKWVNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLS GHGSML YALL+L GY D++I+D+KNFR + SKTAGHPEYG   GIE TTGPL
Sbjct: 61  DRFVLSNGHGSMLLYALLHLTGY-DLSIDDLKNFRQLHSKTAGHPEYGYADGIETTTGPL 119

Query: 133 GQGIANAVGMAIAERKLREEFG---DVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GQGIANAVG A+AE+ L  +F    + +IDH+TY  +GDGCLMEG+S EA S AG LGL 
Sbjct: 120 GQGIANAVGFALAEKTLAAQFNKPDNAIIDHFTYAFLGDGCLMEGVSHEACSLAGTLGLG 179

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDK 248
           KLI  +D+NGISIDG +    S D   RF A GW  L ++GHD  AI     +A+  S K
Sbjct: 180 KLIAYYDDNGISIDGEVEGWFSDDTAKRFEAYGWQVLKIDGHDADAIRDATNQAKAESAK 239

Query: 249 PTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNW-DLDPFFIPDDIMKKWRL 307
           PT+I C+T+IG GSPN+ G    HG+ LG +EI  TR  + W D  PF I D++ + W  
Sbjct: 240 PTLIICKTIIGLGSPNKQGKEISHGAPLGLDEIALTRTQMGWADTTPFIITDEMYRAWD- 298

Query: 308 AGLRSSQTRADWQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMI 364
           A  + S   A W ++ +  +    KE     RRFS  LP+ FD       +        I
Sbjct: 299 ATAKGSTDEAAWNKQFAEYQDKYPKEAAELLRRFSGDLPENFDQLADEFIQTCIQKAESI 358

Query: 365 ATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAM 424
           ATRK+S+  +  +   LPE++GGSADL GSN T  S  K + +    G Y+HYGVRE  M
Sbjct: 359 ATRKASQNAIAALAPHLPEILGGSADLAGSNLTLWSGAKGVQEYA-DGNYVHYGVREFGM 417

Query: 425 AAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQ 484
            A  NG+ALH G  PY+ TF++F +Y+R A+R++SLM  RVI+V THDSIGLGEDGPTHQ
Sbjct: 418 TAIANGVALHGGFIPYTATFLIFMEYARNAVRMSSLMKQRVINVYTHDSIGLGEDGPTHQ 477

Query: 485 PVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESN 543
           PVE +A LR  P+  V RP D++ET   W++ALK K  PS L LSRQNL F  R+  +  
Sbjct: 478 PVEQIANLRMTPNHYVWRPCDTVETAVAWKMALKTKTAPSSLILSRQNLAFQSRSDEQIQ 537

Query: 544 NLCALGAYDYISTPNA---QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFE 600
           N+   G   YI  P     +  I ++GSE+++A++A E L       RVVS+PC E+F +
Sbjct: 538 NIEKGG---YILAPEKGTLKAIIIATGSEVELAMQAYEQLE----GVRVVSMPCAEIFVK 590

Query: 601 QSDSYRAQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           Q   Y   ++ S   +++A+EA +   W  F+G DG  +GM  FG S    +L++HFGI 
Sbjct: 591 QDSGYIESVLPSDVRVRVAVEAAITDYWYKFVGLDGKVVGMTTFGESAPAKVLFEHFGIT 650

Query: 660 AIAIVDMVERKL 671
             A+VD V   L
Sbjct: 651 TQAVVDAVNSLL 662


>gi|326564384|gb|EGE14612.1| transketolase [Moraxella catarrhalis 12P80B1]
          Length = 662

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 319/672 (47%), Positives = 421/672 (62%), Gaps = 23/672 (3%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M  + + +  A+AIR L+MDA++  NSGHPG PMGMAD+   L+ + +  +P+   W NR
Sbjct: 1   MPIELNQRHNANAIRILTMDAVQQANSGHPGAPMGMADIAEVLWREFLRHNPKNAKWVNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLS GHGSML YALL+L GY D++I+D+KNFR + SKTAGHPEYG   GIE TTGPL
Sbjct: 61  DRFVLSNGHGSMLLYALLHLTGY-DLSIDDLKNFRQLHSKTAGHPEYGYADGIETTTGPL 119

Query: 133 GQGIANAVGMAIAERKLREEFG---DVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GQGIANAVG A+AE+ L  +F    + +IDH+TY  +GDGCLMEGIS EA S AG LGL 
Sbjct: 120 GQGIANAVGFALAEKTLAAQFNKPDNAIIDHFTYAFLGDGCLMEGISHEACSLAGTLGLG 179

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDK 248
           KLI  +D+NGISIDG +    S D   RF A GW  L ++GHD  AI     +A+  S K
Sbjct: 180 KLIAYYDDNGISIDGEVEGWFSDDTAKRFEAYGWQVLKIDGHDADAIRDATNQAKAESAK 239

Query: 249 PTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNW-DLDPFFIPDDIMKKWRL 307
           PT+I C+T+IG GSPN+ G    HG+ LG +EI  TR  + W D  PF I D++ + W  
Sbjct: 240 PTLIICKTIIGLGSPNKQGKEISHGAPLGLDEIALTRTQMGWADTTPFIITDEMYRAWD- 298

Query: 308 AGLRSSQTRADWQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMI 364
           A  + S   A W ++ +  +    KE     RRFS  LP+ FD       +        I
Sbjct: 299 ATAKGSTDEAAWNKQFAEYQDKYPKEAAELLRRFSGDLPENFDQLADEFIQTCVQKAESI 358

Query: 365 ATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAM 424
           ATRK+S+  +  +   LPE++GGSADL GSN T  S  K + +    G Y+HYGVRE  M
Sbjct: 359 ATRKASQNAIAALAPHLPEILGGSADLAGSNLTLWSGAKGVQEYA-DGNYVHYGVREFGM 417

Query: 425 AAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQ 484
            A  NG+ALH G  PY+ TF++F +Y+R A+R++SLM  RVI+V THDSIGLGEDGPTHQ
Sbjct: 418 TAIANGVALHGGFIPYTATFLMFMEYARNAVRMSSLMKQRVINVYTHDSIGLGEDGPTHQ 477

Query: 485 PVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESN 543
           PVE +A LR  P+  V RP D++ET   W++ALK K  PS L LSRQNL F  R+  +  
Sbjct: 478 PVEQIANLRMTPNHYVWRPCDTVETAVAWKMALKTKTAPSSLILSRQNLAFQSRSDEQIQ 537

Query: 544 NLCALGAYDYISTPNA---QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFE 600
           N+   G   YI  P     +  I ++GSE+++A++A E L       RVVS+PC E+F +
Sbjct: 538 NIEKGG---YILAPEKGTLKAIIIATGSEVELAMQAYEQLE----GVRVVSMPCAEIFVK 590

Query: 601 QSDSYRAQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           Q   Y   ++ S   +++A+EA +   W  F+G DG  +GM  FG S    +L++HFGI 
Sbjct: 591 QDSGYIESVLPSDVRVRVAVEAAITDYWYKFVGLDGKVVGMTTFGESAPAKVLFEHFGIT 650

Query: 660 AIAIVDMVERKL 671
             A+VD V   L
Sbjct: 651 TQAVVDAVNSLL 662


>gi|94311912|ref|YP_585122.1| transketolase [Cupriavidus metallidurans CH34]
 gi|93355764|gb|ABF09853.1| transketolase 1, thiamin-binding protein [Cupriavidus metallidurans
           CH34]
          Length = 659

 Score =  598 bits (1542), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 320/663 (48%), Positives = 423/663 (63%), Gaps = 17/663 (2%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MADAIR L+MDA++  NSGHPG PMGMAD+  AL+ + +  +P  P+WP+RDRFVLS GH
Sbjct: 1   MADAIRVLAMDAVQQANSGHPGAPMGMADMAVALWGRHLKHNPVNPHWPDRDRFVLSNGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L GY D+ IE++KNFR + SKTAGHPEYG   G+E TTGPLGQGI NAVG
Sbjct: 61  GSMLIYALLHLTGY-DLPIEELKNFRQLHSKTAGHPEYGITPGVETTTGPLGQGITNAVG 119

Query: 142 MAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           MA+AER L EEF   G  +++H+TYV +GDGCLMEGIS EA S AG L L+KLI  WD+N
Sbjct: 120 MALAERLLGEEFNRPGFDIVNHHTYVFMGDGCLMEGISHEACSLAGTLKLNKLIGFWDDN 179

Query: 199 GISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACETV 257
           GISIDG +    + D   RF A GWN + +V+GHD  A+ + +  A+ SDKPT+I C TV
Sbjct: 180 GISIDGDVVHWFADDTPKRFEAYGWNVIRAVDGHDVAAVDNAIALAKASDKPTLICCRTV 239

Query: 258 IGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRA 317
           IG G+PN+AG + VHG+ LG  E+ ATR+AL W   PF +P D    W       +  +A
Sbjct: 240 IGKGAPNKAGGHDVHGAPLGGAEVLATREALGWTHAPFEVPQDAYLAWDAKPNGHALEKA 299

Query: 318 DWQ---ERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVL 374
            W    +  + +      EF+RR    LP  FD A      K E     IATRK+S+  +
Sbjct: 300 -WDALFDAYAEVHPYEAGEFKRRVRGELPGAFDAAVDAYIAKCEEKAETIATRKASQNSI 358

Query: 375 EVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALH 434
           E +   LPEL+GGSADLTGSN T  S  +A+ + D  G +++YGVRE  M+A MNGIALH
Sbjct: 359 EALAPVLPELLGGSADLTGSNLTNWSGTQAV-RFDSWGNHINYGVREFGMSAIMNGIALH 417

Query: 435 KGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRA 494
            G  PY  TF+ FSDYSR A+R+A+LM IR + V THDSIGLGEDGPTHQ +EH+A+LR 
Sbjct: 418 GGYIPYGATFLTFSDYSRNALRMAALMKIRSLFVFTHDSIGLGEDGPTHQSIEHVASLRL 477

Query: 495 IPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYI 554
           IP++ V R AD+ ET   W  +++ +N PS L  SRQNLPF +    +    A G Y   
Sbjct: 478 IPNMDVWRTADTTETAVAWAQSIRRENGPSCLIFSRQNLPFQKRDDVTRANIARGGYVLR 537

Query: 555 STPNAQ-----VTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
              N +       I ++GSE+ +AV A + L+   +  RVVSVP   +F +Q  +Y+A +
Sbjct: 538 DGTNPRKKRPDAVIIATGSEVGLAVGAADALAVEGVHVRVVSVPSTSVFDKQDAAYKASV 597

Query: 610 IGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVER 669
           + +   +IA+EAG+   W  +     + +G+  FG S    +L++HFG     + D V  
Sbjct: 598 LPAGVPRIAVEAGVTDFWWKY--QVQAVVGIDTFGESAPAGVLFKHFGFTVENVADTVRA 655

Query: 670 KLS 672
            L+
Sbjct: 656 TLA 658


>gi|38638081|ref|NP_943055.1| transketolase [Ralstonia eutropha H16]
 gi|730955|sp|P21726|TKTP_RALEH RecName: Full=Transketolase, plasmid; Short=TK
 gi|435959|gb|AAA20194.1| transketolase [Ralstonia eutropha H16]
 gi|32527419|gb|AAP86169.1| transketolase [Ralstonia eutropha H16]
          Length = 670

 Score =  598 bits (1542), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 316/652 (48%), Positives = 421/652 (64%), Gaps = 13/652 (1%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           D   + A+A+RFL+ DA+E   SGHPG PMGMA++   ++ + +  +P  P WP+RDRFV
Sbjct: 8   DPAARCANALRFLAADAVELARSGHPGAPMGMAEMAEVVWRRHLRHNPANPAWPDRDRFV 67

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LS GH SML YALL+L GY D+ +  ++ FR + + T GHPE     G+E TTGPLGQG+
Sbjct: 68  LSNGHASMLQYALLHLTGY-DLPMSQLRQFRQLHAVTPGHPEVDVTPGVETTTGPLGQGL 126

Query: 137 ANAVGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIV 193
           ANAVGMA+AE+ L   F   G  ++DH+TYV +GDGCLMEG+S EA S AG LGL KLI 
Sbjct: 127 ANAVGMALAEKLLAATFNRPGFDIVDHHTYVFLGDGCLMEGLSHEACSLAGTLGLGKLIC 186

Query: 194 LWDNNGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLS-DKPTM 251
           L+D+NGISIDG ++   + D   RF A GW+ ++ V+GHD HA+ + L +A+   D+PT+
Sbjct: 187 LYDDNGISIDGEVAGWFADDTPKRFAAYGWHVIADVDGHDAHALDAALHEAKAERDRPTL 246

Query: 252 IACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLR 311
           I C TVIG G+P +AG + VHG+ LG  EI A R AL W+ +PF +P D+   W  A  +
Sbjct: 247 ICCRTVIGKGAPAKAGGHDVHGAPLGAPEIAAMRTALGWEAEPFTVPADVADAWD-ARAQ 305

Query: 312 SSQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRK 368
            +   A+W+ R  S  ++   + +EF RR +  LP+ FD   + L       +  IATRK
Sbjct: 306 GAAREAEWEARFVSYCAAHPELAEEFVRRANGRLPEGFDAELMALLDAPSPLQGKIATRK 365

Query: 369 SSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAM 428
           +S+L LE +   LPEL+GGSADLTGSN T       ++ +   G Y+ YGVRE  MAA M
Sbjct: 366 ASQLCLEALTPALPELLGGSADLTGSNLTNVKASVWVNHAGH-GNYVSYGVREFGMAAVM 424

Query: 429 NGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEH 488
           NGIALH GL PY GTFM FSDYSR AIR+A+LM +RV+HVLTHDSIGLGEDGPTHQPVEH
Sbjct: 425 NGIALHGGLIPYGGTFMTFSDYSRNAIRMAALMRLRVVHVLTHDSIGLGEDGPTHQPVEH 484

Query: 489 LAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNL-PFLRTQYESNNLCA 547
            A+LR IP+  V RP D  ET   W  AL+ +N P+ L LSRQ L PF R   +  ++ A
Sbjct: 485 AASLRLIPNNQVWRPCDGAETAYAWLAALQRENGPTCLVLSRQALMPFERDAAQRADI-A 543

Query: 548 LGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRA 607
            G Y     P  +V + ++GSE++IA  A   L+   I+ RVVS+PC ELF+ Q  +YR 
Sbjct: 544 RGGYVLRDVPAPRVVLIATGSEVEIAARAALDLADAGIAARVVSMPCVELFYAQDAAYRD 603

Query: 608 QIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
            ++     +I++EAG    W   +G  G  +G+  FG S   + LYQHFG+ 
Sbjct: 604 SVLPPGLPRISVEAGATWYWRGVVGEQGLALGIDSFGESAPAEALYQHFGLT 655


>gi|296112764|ref|YP_003626702.1| transketolase [Moraxella catarrhalis RH4]
 gi|295920458|gb|ADG60809.1| transketolase [Moraxella catarrhalis RH4]
 gi|326566763|gb|EGE16902.1| transketolase [Moraxella catarrhalis 103P14B1]
 gi|326575238|gb|EGE25166.1| transketolase [Moraxella catarrhalis CO72]
 gi|326576675|gb|EGE26582.1| transketolase [Moraxella catarrhalis 101P30B1]
          Length = 662

 Score =  598 bits (1542), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 318/672 (47%), Positives = 421/672 (62%), Gaps = 23/672 (3%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M  + + +  A+AIR L+MDA++  NSGHPG PMGMAD+   L+ + +  +P+   W NR
Sbjct: 1   MPIELNQRHNANAIRILAMDAVQQANSGHPGAPMGMADIAEVLWREFLRHNPKNAKWVNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLS GHGSML YALL+L GY D++I+D+KNFR + SKTAGHPEYG   GIE TTGPL
Sbjct: 61  DRFVLSNGHGSMLLYALLHLTGY-DLSIDDLKNFRQLHSKTAGHPEYGYADGIETTTGPL 119

Query: 133 GQGIANAVGMAIAERKLREEFG---DVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GQGIANAVG A+AE+ L  +F    + +IDH+TY  +GDGCLMEG+S EA S AG LGL 
Sbjct: 120 GQGIANAVGFALAEKTLAAQFNKPDNAIIDHFTYAFLGDGCLMEGVSHEACSLAGTLGLG 179

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDK 248
           KLI  +D+NGISIDG +    S D   RF A GW  L ++GHD  AI     +A+  S K
Sbjct: 180 KLIAYYDDNGISIDGEVEGWFSDDTAKRFEAYGWQVLKIDGHDADAIRDATNQAKAESAK 239

Query: 249 PTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNW-DLDPFFIPDDIMKKWRL 307
           PT+I C+T+IG GSPN+ G    HG+ LG +EI  TR  + W D  PF I D++ + W  
Sbjct: 240 PTLIICKTIIGLGSPNKQGKEISHGAPLGLDEIALTRTQMGWADTTPFIITDEMYRAWD- 298

Query: 308 AGLRSSQTRADWQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMI 364
           A  + S   A W ++ +  +    KE     RRFS  LP+ FD       +        I
Sbjct: 299 ATAKGSTDEAAWNKQFAEYQDKYPKEAAELLRRFSGDLPENFDQLADEFIQTCVQKAESI 358

Query: 365 ATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAM 424
           ATRK+S+  +  +   LPE++GGSADL GSN T  S  K + +    G Y+HYGVRE  M
Sbjct: 359 ATRKASQNAIAALAPHLPEILGGSADLAGSNLTLWSGAKGVQEYA-DGNYVHYGVREFGM 417

Query: 425 AAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQ 484
            A  NG+ALH G  PY+ TF++F +Y+R A+R++SLM  RVI+V THDSIGLGEDGPTHQ
Sbjct: 418 TAIANGVALHGGFIPYTATFLMFMEYARNAVRMSSLMKQRVINVYTHDSIGLGEDGPTHQ 477

Query: 485 PVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESN 543
           PVE +A LR  P+  V RP D++ET   W++ALK K  PS L LSRQNL F  R+  +  
Sbjct: 478 PVEQIANLRMTPNHYVWRPCDTVETAVAWKMALKTKTAPSSLILSRQNLAFQSRSDEQIQ 537

Query: 544 NLCALGAYDYISTPNA---QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFE 600
           N+   G   YI  P     +  I ++GSE+++A++A E L       RVVS+PC E+F +
Sbjct: 538 NIEKGG---YILAPEKGTLKAIIIATGSEVELAMQAYEQLE----GVRVVSMPCAEIFVK 590

Query: 601 QSDSYRAQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           Q   Y   ++ S   +++A+EA +   W  F+G DG  +GM  FG S    +L++HFGI 
Sbjct: 591 QDSGYIESVLPSDVRVRVAVEAAITDYWYKFVGLDGKVVGMTTFGESAPAKVLFEHFGIT 650

Query: 660 AIAIVDMVERKL 671
             A+VD V   L
Sbjct: 651 TQAVVDAVNSLL 662


>gi|319637939|ref|ZP_07992705.1| transketolase [Neisseria mucosa C102]
 gi|317401094|gb|EFV81749.1| transketolase [Neisseria mucosa C102]
          Length = 659

 Score =  598 bits (1542), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 308/660 (46%), Positives = 433/660 (65%), Gaps = 12/660 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIRFLS+DA++  NSGHPG PMGMA++   L+T+ +  +P  P + NRDRF+LS G
Sbjct: 3   QLANAIRFLSVDAVQKANSGHPGAPMGMAEMAEVLWTKFLNHNPANPKFYNRDRFILSNG 62

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML Y+LL+L GY +V+IED+KNFR + SKT GHPEYG   G+E TTGPLGQGIANAV
Sbjct: 63  HASMLLYSLLHLTGY-NVSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANAV 121

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DH+TYV +GDGC+MEG+S EA S AG LGL KLIVL+D+
Sbjct: 122 GMALAEKILAAEFNKDGLNIVDHHTYVFMGDGCMMEGVSHEACSLAGTLGLGKLIVLYDD 181

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIACE 255
           N ISIDG +    + +   RF + GW+ + +VNGHD  AI + +  A+  + KP++I C+
Sbjct: 182 NNISIDGKVDGWFTENIPQRFESYGWHVIPNVNGHDTDAIQTAIEAAKAETGKPSLICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG GS N+ G++K HG+ LG +EI+ATRK L W    F IP +I   W  A  + ++ 
Sbjct: 242 TLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWTYPVFEIPQEIYAAWN-AKEKGAKL 300

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A+W E  +  ++       EF RR    LPD FD       K+       IATRK+S+ 
Sbjct: 301 EAEWNELFAQYQAKYPAEAAEFVRRMDKKLPDNFDAYVQAALKEVCAKAETIATRKASQN 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E++   LPEL+GGSADLT SN T  S   ++++ +  G Y+HYGVRE  M A MNG+A
Sbjct: 361 SIEILAKELPELVGGSADLTPSNLTDWSNSVSVTR-EHGGNYIHYGVREFGMGAIMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ P+  TF++FS+Y R A+R+A+LM I  + V THDSIGLGEDGPTHQPVE  A L
Sbjct: 420 LHGGVKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSIGLGEDGPTHQPVEQTATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYESNNLCALGAY 551
           R IP++ V RP D++E+L  W  A+K  + PS L  SRQNL F  R + + N++   G  
Sbjct: 480 RLIPNMDVWRPCDTVESLVAWSEAVKAADHPSSLIFSRQNLKFQARNEQQLNDIKRGGYV 539

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              +  NAQ  I ++GSE+++A+E  ++L+ + ++ RVVS+P   +F  Q  +Y+A ++ 
Sbjct: 540 ISEAQGNAQAVIIATGSEVELALEVQKVLAEQGVAVRVVSMPSTNVFDRQDAAYKAAVLP 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
               +IA+EAG   GW  ++G +G+ +G+  FG S   DLL++ FG     +V  V+  L
Sbjct: 600 EGLPRIAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKEFGFTVDNVVATVKSVL 659


>gi|300717890|ref|YP_003742693.1| transketolase 1 [Erwinia billingiae Eb661]
 gi|299063726|emb|CAX60846.1| Transketolase 1 [Erwinia billingiae Eb661]
          Length = 666

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 315/666 (47%), Positives = 428/666 (64%), Gaps = 21/666 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           +++A+AIR LSMDA++  NSGHPG PMGMAD+   L+ + M  +P  P W +RDRF+LS 
Sbjct: 5   RELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWREFMHHNPTNPLWADRDRFILSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D+ IE++KNFR + SKT GHPEYG   G+E TTGPLGQG+ANA
Sbjct: 65  GHGSMLLYSLLHLTGY-DLPIEELKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGLANA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAER L  +F   G  ++DH TYV +GDGCLMEGIS E  S AG LGL KLI  +D
Sbjct: 124 VGMAIAERTLGAQFNRPGHDIVDHNTYVFMGDGCLMEGISHEVSSLAGTLGLGKLIGFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIAC 254
           +NGISIDG +    S D   RF A  W+ +  ++GHD  AI + +++AQ ++DKP++I C
Sbjct: 184 HNGISIDGEVEGWFSDDTAKRFEAYNWHVIHEIDGHDADAIKNAIKEAQSVTDKPSLIIC 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKW--RLAGLRS 312
            TVIGFGSPN+ G  + HG+ALG EE+  TRK L W+   F IP DI  +W  + AG + 
Sbjct: 244 RTVIGFGSPNKGGKEEAHGAALGPEEVALTRKQLGWNYPAFEIPKDIYAQWDGKEAGAKY 303

Query: 313 SQTRADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKS 369
            ++   W E+ ++ +++   + KEF RR +  LPD ++        + + +   IA+RK+
Sbjct: 304 EKS---WNEKFAAYQAAHPELAKEFLRRMAGDLPDVWEQETQKFITELQANPQKIASRKA 360

Query: 370 SELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMN 429
           S+  LE     LPE +GGSADL  SN T  S  K+I K D +G Y+HYGVRE  M A  N
Sbjct: 361 SQNTLEAYGKLLPEYLGGSADLAPSNLTIWSGSKSI-KEDHAGNYIHYGVREFGMTAIAN 419

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           G+ALH G  PY+ TF++F +Y+R A+R+A+LM  R I V THDSIGLGEDGPTHQPVE L
Sbjct: 420 GLALHGGFIPYTATFLMFVEYARNAVRMAALMKARQIMVYTHDSIGLGEDGPTHQPVEQL 479

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A+LR  P++ V RP D +ET   W+ A++  + P+ L LSRQNL       E  +  + G
Sbjct: 480 ASLRVTPNMSVWRPCDQVETAVAWKHAVERHHGPTALILSRQNLLQPERSKEQVDNISRG 539

Query: 550 AY---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYR 606
           AY   D   TP  +V + ++GSE++I + A   L++     RVVS+P  ELF +Q   YR
Sbjct: 540 AYVLKDCEGTP--EVILIATGSEVEITLGAAAKLTASGHKVRVVSMPSTELFDKQEVGYR 597

Query: 607 AQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
             ++ S+   ++A+EAG+   W  ++G +G+ +GM  FG S   D L+  FG     IV 
Sbjct: 598 ESVLPSNVTARVAVEAGIADYWFKYVGLNGAIVGMTTFGESAPADKLFNEFGFTVENIVS 657

Query: 666 MVERKL 671
             E  L
Sbjct: 658 HAEALL 663


>gi|229530315|ref|ZP_04419703.1| transketolase [Vibrio cholerae 12129(1)]
 gi|229332088|gb|EEN97576.1| transketolase [Vibrio cholerae 12129(1)]
          Length = 665

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 311/665 (46%), Positives = 424/665 (63%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +PQ P W +RDRFVLS 
Sbjct: 5   KQLANAIRALSMDGVQKANSGHPGAPMGMADIAEVLWRSHLNHNPQNPNWADRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI NA
Sbjct: 65  GHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGITNA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 124 VGMAIAEKALAAQFNKPGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+  + +PT+I  
Sbjct: 184 DNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKAETSRPTLICT 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+AG++  HG+ LG +EIKA R+ L W+  PF IP DI   W  A    + 
Sbjct: 244 KTIIGFGSPNKAGSHDCHGAPLGNDEIKAAREFLGWEYAPFEIPADIYAAWD-AKQAGAS 302

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W E+ ++   +      E++RR +  LP  ++ A   +    + +   IA+RK+S+
Sbjct: 303 KEAAWDEKFAAYAKAYPAEAAEYKRRVAGELPANWEAATSEIIANLQANPANIASRKASQ 362

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE     LPE +GGSADL  SN T  S  K+++  DFSG Y+HYGVRE  M A +NGI
Sbjct: 363 NALEAFGKLLPEFMGGSADLAPSNLTMWSGSKSLTAEDFSGNYIHYGVREFGMTAIINGI 422

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY  TF++F +Y+R A+R+A+LM ++ I V THDSIGLGEDGPTHQPVE +A+
Sbjct: 423 ALHGGFVPYGATFLMFMEYARNAMRMAALMKVQNIQVYTHDSIGLGEDGPTHQPVEQIAS 482

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR  P++   RP D +E+   W++A++ K+ PS L  SRQNL       E     A G Y
Sbjct: 483 LRMTPNMSTWRPCDQVESAVAWKLAIERKDAPSALIFSRQNLAQQPRSAEQVANIAKGGY 542

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D    P  ++ + ++GSE+++AV A E LS+   + RVVS+P  + F +Q  +YR  
Sbjct: 543 ILKDCAGQP--ELILIATGSEVELAVAAYEQLSAEGKAVRVVSMPSTDAFDKQDAAYREA 600

Query: 609 IIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ ++  K IAIEAG+   W  ++G  G  IGM  FG S     L++ FG     +V   
Sbjct: 601 VLPAAVTKRIAIEAGIADFWYKYVGFGGRIIGMTSFGESAPAGELFKLFGFTTENVVKQA 660

Query: 668 ERKLS 672
           +  L+
Sbjct: 661 KELLA 665


>gi|254672117|emb|CBA04845.1| transketolase 1 [Neisseria meningitidis alpha275]
          Length = 659

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 312/660 (47%), Positives = 431/660 (65%), Gaps = 12/660 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIRFLS DA++  NSGHPG PMGMA++   L+T+ +  +P  P + NRDRFVLS G
Sbjct: 3   QLANAIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHNPANPKFYNRDRFVLSNG 62

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML Y+LL+L GY +++IED+KNFR + SKT GHPEYG   G+E TTGPLGQGIANAV
Sbjct: 63  HASMLLYSLLHLTGY-NLSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANAV 121

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DHYTYV +GDGCLMEG+S EA S AG LGL KLIVL+D+
Sbjct: 122 GMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEACSLAGTLGLGKLIVLYDD 181

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHD-HHAITSTLRKAQLSDKPTMIACE 255
           N ISIDG +    + +   RF + GW+ + +VNGHD      +       + KP++I C+
Sbjct: 182 NNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTAAIQAAIEAARAETGKPSIICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG GS N+ G++K HG+ LG +EI+ATRK L W    F IP +I   W  A  + ++ 
Sbjct: 242 TLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWTYPAFEIPQEIYDAWN-AKEQGAKL 300

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            ADW E  +  ++       EF RR    LPD FD       K+       IATRK+S+ 
Sbjct: 301 EADWNELFAQYQAKYPAEAAEFVRRMDKKLPDNFDEYVQTALKEVCAKAETIATRKASQN 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E++   LPEL+GGSADLT SN T  S   ++++ D  G Y+HYGVRE  M A MNG+A
Sbjct: 361 SIEILAKELPELVGGSADLTPSNLTDWSNSVSVTR-DKGGNYIHYGVREFGMGAIMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ P+  TF++FS+Y R A+R+A+LM I  + V THDSIGLGEDGPTHQP+E  A L
Sbjct: 420 LHGGIKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSIGLGEDGPTHQPIEQTATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYESNNLCALGAY 551
           R IP++ V RP D+ E+L  W  A+K  + PS L  SRQNL F  R++ + +++   G  
Sbjct: 480 RLIPNMDVWRPCDTAESLVAWAEAVKAADHPSCLIFSRQNLKFQARSEQQLDDIKRGGYI 539

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              +  NAQ  I ++GSE+++A+EA + L+++NI+ RVVS+P   +F  Q  +Y+A ++ 
Sbjct: 540 ISEAQGNAQAVIIATGSEVELALEAQKALAAQNIAVRVVSMPSTNVFDRQDAAYQAAVLP 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            S  +IA+EAG   GW  ++G +G+ +G+  FG S   DLL++ FG     +VD V+  L
Sbjct: 600 ESLPRIAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKAFGFTVDNVVDTVKSVL 659


>gi|171056911|ref|YP_001789260.1| transketolase [Leptothrix cholodnii SP-6]
 gi|170774356|gb|ACB32495.1| transketolase [Leptothrix cholodnii SP-6]
          Length = 681

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 320/677 (47%), Positives = 429/677 (63%), Gaps = 32/677 (4%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIR L+MDA++  NSGHPG PMGMAD+  AL+ + +  +P  P W +RDRFVLS G
Sbjct: 11  QLANAIRALAMDAVQQANSGHPGAPMGMADIAVALWKRHLKHNPSDPQWTDRDRFVLSNG 70

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML YALL+L GY  + IE ++NFR + S+T GHPE G   G+E TTGPLGQGI+NAV
Sbjct: 71  HGSMLLYALLHLTGYA-LPIEQLRNFRQMHSQTPGHPEVGVTPGVETTTGPLGQGISNAV 129

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DH+TY  +GDGCLMEGIS EA + AG   L+KLI L+D+
Sbjct: 130 GMALAEKLLAAEFNRPGHAIVDHHTYTFLGDGCLMEGISHEACALAGAWKLNKLIALYDD 189

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLS-DKPTMIACE 255
           NGISIDG ++     D   RF A GWN +  V+GHD  A+ + + +A+ S DKPT++ C+
Sbjct: 190 NGISIDGKVAPWFVDDTALRFAAYGWNVVGPVDGHDIDAVDAAITEARKSTDKPTLVICK 249

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T IG GSPNRAGT K HG  LG EEI  TR+++ WD +PF IP+DI   W    +  +  
Sbjct: 250 TAIGKGSPNRAGTAKAHGEPLGAEEIALTRESIGWDAEPFVIPEDICAAWDCR-VAGAAA 308

Query: 316 RADWQERLSSMK---SSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           +A W++R S+       +   FERR +  LPD F    +            +A+RK+S++
Sbjct: 309 QAAWEDRYSAYVLEFPELAVAFERRMAGDLPDNFAEIAVTAVADAHEKGETVASRKASQI 368

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAI----------SKSDFSGRYLHYGVREH 422
            LE     LPEL+GGSADLTGSN T T    A+          +++   GR+++YGVRE 
Sbjct: 369 ALEHFTAALPELLGGSADLTGSNLTNTKSTPALRIAADGAVVKTEAGQIGRHINYGVREF 428

Query: 423 AMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPT 482
            MAA MNG+ALH G  PY GTF+ FSDYSR AIR+A+LM  RVIHV THDSIGLGEDGPT
Sbjct: 429 GMAAIMNGVALHGGFIPYGGTFLTFSDYSRNAIRMAALMKTRVIHVFTHDSIGLGEDGPT 488

Query: 483 HQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYES 542
           HQ VEH A+LR IP+L V RPAD+ ET   W +AL  ++RPS L LSRQNL +       
Sbjct: 489 HQSVEHAASLRLIPNLDVWRPADTAETAVAWTMALANRHRPSALLLSRQNLAY--APKSD 546

Query: 543 NNLCALGAYDYISTP-------NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCF 595
            ++   GAY  +S P        A+  I ++GSE+++A++A + L+   I+ RVVS+P  
Sbjct: 547 ADVITKGAY-ILSEPRDIGLNKKAKAVIIATGSEVQLALQAQKALAEAKIAVRVVSMPST 605

Query: 596 ELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQH 655
            +F  Q   Y+  ++     +IA+EAG+   W  +     + IG+  FG S    +L++H
Sbjct: 606 TVFDRQDVKYKKDVLPKDLPRIAVEAGVTDFWWKY--RCDAVIGLDTFGESAPAPVLFKH 663

Query: 656 FGINAIAIVDMVERKLS 672
           FG     IV  V + LS
Sbjct: 664 FGFTVENIVATVRKVLS 680


>gi|326561008|gb|EGE11373.1| transketolase [Moraxella catarrhalis 7169]
          Length = 662

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 319/672 (47%), Positives = 421/672 (62%), Gaps = 23/672 (3%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M  + + +  A+AIR L+MDA++  NSGHPG PMGMAD+   L+ + +  +P+   W NR
Sbjct: 1   MPIELNQRHNANAIRILAMDAVQQANSGHPGAPMGMADIAEVLWREFLRHNPKNAKWVNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLS GHGSML YALL+L GY D++I+D+KNFR + SKTAGHPEYG   GIE TTGPL
Sbjct: 61  DRFVLSNGHGSMLLYALLHLTGY-DLSIDDLKNFRQLHSKTAGHPEYGYADGIETTTGPL 119

Query: 133 GQGIANAVGMAIAERKLREEFG---DVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GQGIANAVG A+AE+ L  +F    + +IDH+TY  +GDGCLMEGIS EA S AG LGL 
Sbjct: 120 GQGIANAVGFALAEKTLAAQFNKPDNAIIDHFTYAFLGDGCLMEGISHEACSLAGTLGLG 179

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDK 248
           KLI  +D+NGISIDG +    S D   RF A GW  L ++GHD  AI     +A+  S K
Sbjct: 180 KLIAYYDDNGISIDGEVEGWFSDDTAKRFEAYGWQVLKIDGHDADAIRDATNQAKAESAK 239

Query: 249 PTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNW-DLDPFFIPDDIMKKWRL 307
           PT+I C+T+IG GSPN+ G    HG+ LG +EI  TR  + W D  PF I D++ + W  
Sbjct: 240 PTLIICKTIIGLGSPNKQGKEISHGAPLGLDEIALTRTQMGWADTTPFIITDEMYRAWD- 298

Query: 308 AGLRSSQTRADWQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMI 364
           A  + S   A W ++ +  +    KE     RRFS  LP+ FD       +        I
Sbjct: 299 ATAKGSTDEAAWNKQFAEYQDKYPKEAAELLRRFSGDLPENFDQLADEFIQTCIQKAESI 358

Query: 365 ATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAM 424
           ATRK+S+  +  +   LPE++GGSADL GSN T  S  K + +    G Y+HYGVRE  M
Sbjct: 359 ATRKASQNAIAALAPHLPEILGGSADLAGSNLTLWSGAKGVQEYA-DGNYVHYGVREFGM 417

Query: 425 AAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQ 484
            A  NG+ALH G  PY+ TF++F +Y+R A+R++SLM  RVI+V THDSIGLGEDGPTHQ
Sbjct: 418 TAIANGVALHGGFIPYTATFLMFMEYARNAVRMSSLMKQRVINVYTHDSIGLGEDGPTHQ 477

Query: 485 PVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESN 543
           PVE +A LR  P+  V RP D++ET   W++ALK K  PS L LSRQNL F  R+  +  
Sbjct: 478 PVEQIANLRMTPNHYVWRPCDTVETAVAWKMALKTKTAPSSLILSRQNLAFQSRSDEQIQ 537

Query: 544 NLCALGAYDYISTPNA---QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFE 600
           N+   G   YI  P     +  I ++GSE+++A++A E L       RVVS+PC E+F +
Sbjct: 538 NIEKGG---YILAPEKGTLKAIIIATGSEVELAMQAYEQLE----GVRVVSMPCAEIFVK 590

Query: 601 QSDSYRAQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           Q   Y   ++ S   +++A+EA +   W  F+G DG  +GM  FG S    +L++HFGI 
Sbjct: 591 QDSGYIESVLPSDVRVRVAVEAAITDYWYKFVGLDGKVVGMTTFGESAPAKVLFEHFGIT 650

Query: 660 AIAIVDMVERKL 671
             A+VD V   L
Sbjct: 651 TQAVVDAVNSLL 662


>gi|326563743|gb|EGE13994.1| transketolase [Moraxella catarrhalis 46P47B1]
          Length = 662

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 319/672 (47%), Positives = 421/672 (62%), Gaps = 23/672 (3%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M  + + +  A+AIR L+MDA++  NSGHPG PMGMAD+   L+ + +  +P+   W NR
Sbjct: 1   MPIELNQRHNANAIRILAMDAVQQANSGHPGAPMGMADIAEVLWREFLRHNPKNAKWVNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLS GHGSML YALL+L GY D++I+D+KNFR + SKTAGHPEYG   GIE TTGPL
Sbjct: 61  DRFVLSNGHGSMLLYALLHLTGY-DLSIDDLKNFRQLHSKTAGHPEYGYADGIETTTGPL 119

Query: 133 GQGIANAVGMAIAERKLREEFG---DVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GQGIANAVG A+AE+ L  +F    + +IDH+TY  +GDGCLMEGIS EA S AG LGL 
Sbjct: 120 GQGIANAVGFALAEKTLAAQFNKPDNAIIDHFTYAFLGDGCLMEGISHEACSLAGTLGLG 179

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDK 248
           KLI  +D+NGISIDG +    S D   RF A GW  L ++GHD  AI     +A+  S K
Sbjct: 180 KLIAYYDDNGISIDGEVEGWFSDDTAKRFEAYGWQVLKIDGHDADAIRDATNQAKAESAK 239

Query: 249 PTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNW-DLDPFFIPDDIMKKWRL 307
           PT+I C+T+IG GSPN+ G    HG+ LG +EI  TR  + W D  PF I D++ + W  
Sbjct: 240 PTLIICKTIIGLGSPNKQGKEISHGAPLGLDEIALTRTQMGWADTTPFIITDEMYRAWD- 298

Query: 308 AGLRSSQTRADWQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMI 364
           A  + S   A W ++ +  +    KE     RRFS  LP+ FD       +        I
Sbjct: 299 ATAKGSTDEAAWNKQFAEYQDKYPKEAAELLRRFSGDLPENFDQLADEFIQTCIQKAESI 358

Query: 365 ATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAM 424
           ATRK+S+  +  +   LPE++GGSADL GSN T  S  K + +    G Y+HYGVRE  M
Sbjct: 359 ATRKASQNAIAALAPHLPEILGGSADLAGSNLTLWSGAKGVQEYA-DGNYVHYGVREFGM 417

Query: 425 AAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQ 484
            A  NG+ALH G  PY+ TF++F +Y+R A+R++SLM  RVI+V THDSIGLGEDGPTHQ
Sbjct: 418 TAIANGVALHGGFIPYTATFLMFMEYARNAVRMSSLMKQRVINVYTHDSIGLGEDGPTHQ 477

Query: 485 PVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESN 543
           PVE +A LR  P+  V RP D++ET   W++ALK K  PS L LSRQNL F  R+  +  
Sbjct: 478 PVEQIANLRMTPNHYVWRPCDTVETAVAWKMALKTKTAPSSLILSRQNLTFQSRSDEQIQ 537

Query: 544 NLCALGAYDYISTPNA---QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFE 600
           N+   G   YI  P     +  I ++GSE+++A++A E L       RVVS+PC E+F +
Sbjct: 538 NIEKGG---YILAPEKGTLKAIIIATGSEVELAMQAYEQLE----GVRVVSMPCAEIFVK 590

Query: 601 QSDSYRAQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           Q   Y   ++ S   +++A+EA +   W  F+G DG  +GM  FG S    +L++HFGI 
Sbjct: 591 QDSGYIESVLPSDVRVRVAVEAAITDYWYKFVGLDGKVVGMTTFGESAPAKVLFEHFGIT 650

Query: 660 AIAIVDMVERKL 671
             A+VD V   L
Sbjct: 651 TQAVVDAVNSLL 662


>gi|114331564|ref|YP_747786.1| transketolase [Nitrosomonas eutropha C91]
 gi|114308578|gb|ABI59821.1| transketolase [Nitrosomonas eutropha C91]
          Length = 672

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 303/661 (45%), Positives = 427/661 (64%), Gaps = 13/661 (1%)

Query: 19  YKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLS 78
           +  +  AIR L+MDA++  NSGHPG+PMGMA++   L+   M  +P  P W +RDRFVLS
Sbjct: 13  FNNLTSAIRALAMDAVQKANSGHPGMPMGMAEIAEVLWIHHMRHNPANPEWADRDRFVLS 72

Query: 79  AGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIAN 138
            GHGSML YALL+L GY D++IEDIKNFR + SKT GHPEYG   G+E TTGPLGQG+ N
Sbjct: 73  NGHGSMLIYALLHLTGY-DLSIEDIKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGLTN 131

Query: 139 AVGMAIAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLW 195
           AVGMA+AE+ L EEF      ++DH+TYV +GDGCLMEGIS EA S AG L L KLI  +
Sbjct: 132 AVGMALAEKILAEEFNRPYFPIMDHHTYVFLGDGCLMEGISHEACSLAGTLQLGKLICFY 191

Query: 196 DNNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQ-LSDKPTMIA 253
           D+NGISIDG +    + +   RF + GW+ + +VNGHD  AI + +  A+ + DKPT+I 
Sbjct: 192 DDNGISIDGHVEGWFTDNTPKRFESYGWHVVPNVNGHDPVAIQAAIETAKKVQDKPTLIC 251

Query: 254 CETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSS 313
           C+TVIG GSPN+A T+ +HG+ALG++EI A R  + W+  PF IP ++   W  A  +  
Sbjct: 252 CKTVIGMGSPNKANTSSIHGAALGKDEIAAARPHIGWNYLPFEIPQEVYDAWD-ARTKGQ 310

Query: 314 QTRADWQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSS 370
              + W    +        E   F RR +  LP  + +    +  +    +  IATRK+S
Sbjct: 311 ALESAWNTMFAEYSKKYPAEAVEFTRRMAGELPIKWVDHVEGIISQINAREESIATRKAS 370

Query: 371 ELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNG 430
           +  +E +   LPELIGGSADLTGSN T  S  K ++  + +G Y+HYGVRE  M+A MNG
Sbjct: 371 QNSIEALAPVLPELIGGSADLTGSNLTMWSGSK-VTSGNTTGNYIHYGVREFGMSAIMNG 429

Query: 431 IALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLA 490
           ++LH G+ PY GTF++FS+Y+R A+R+A+LM IR I V THDSIGLGEDGPTHQPVE  A
Sbjct: 430 LSLHGGIIPYGGTFLMFSEYARNALRMAALMKIRNIFVFTHDSIGLGEDGPTHQPVEQTA 489

Query: 491 ALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGA 550
            LR  P++ V RP D++E++  W  A++ +  P+ L  SRQNLPF +    + +L   G 
Sbjct: 490 TLRMAPNMDVWRPCDTVESIVSWVAAIERREGPTSLIFSRQNLPFQKRDAATISLIKKGG 549

Query: 551 Y--DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
           Y     +  N +V I ++GSE+ +A+ A ++L+   ++ RVVS+PC  +F +Q  +YR  
Sbjct: 550 YILSEAANGNPRVIIIATGSEVGLAMGAQKVLAENGVAVRVVSMPCTNIFDKQDLAYRDS 609

Query: 609 IIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           ++     ++A+EAG+   W  ++G +G  +G+  FG S   + L+++FG     +V+ V+
Sbjct: 610 VLPKGIRRVAVEAGVTDFWRKYVGLEGEVVGIDKFGESAPAEELFEYFGFTVENVVNAVK 669

Query: 669 R 669
           R
Sbjct: 670 R 670


>gi|153826580|ref|ZP_01979247.1| transketolase 1 [Vibrio cholerae MZO-2]
 gi|149739672|gb|EDM53886.1| transketolase 1 [Vibrio cholerae MZO-2]
          Length = 694

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 311/665 (46%), Positives = 424/665 (63%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +PQ P W +RDRFVLS 
Sbjct: 34  KQLANAIRALSMDGVQKANSGHPGAPMGMADIAEVLWRSHLNHNPQNPNWADRDRFVLSN 93

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI NA
Sbjct: 94  GHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGITNA 152

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 153 VGMAIAEKALAAQFNKPGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 212

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+  + +PT+I  
Sbjct: 213 DNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKAETSRPTLICT 272

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+AG++  HG+ LG +EIKA R+ L W+  PF IP DI   W  A    + 
Sbjct: 273 KTIIGFGSPNKAGSHDCHGAPLGNDEIKAAREFLGWEYAPFEIPADIYAAWD-AKQAGAS 331

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W E+ ++   +      E++RR +  LP  ++ A   +    + +   IA+RK+S+
Sbjct: 332 KEAAWDEKFAAYAKAYPAEAAEYKRRVAGELPANWEAATSEIIANLQANPANIASRKASQ 391

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE     LPE +GGSADL  SN T  S  K+++  DFSG Y+HYGVRE  M A +NGI
Sbjct: 392 NALEAFGKLLPEFMGGSADLAPSNLTMWSGSKSLTAEDFSGNYIHYGVREFGMTAIINGI 451

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY  TF++F +Y+R A+R+A+LM ++ I V THDSIGLGEDGPTHQPVE +A+
Sbjct: 452 ALHGGFVPYGATFLMFMEYARNAMRMAALMKVQNIQVYTHDSIGLGEDGPTHQPVEQIAS 511

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR  P++   RP D +E+   W++A++ K+ PS L  SRQNL       E     A G Y
Sbjct: 512 LRMTPNMSTWRPCDQVESAVAWKLAIERKDAPSALIFSRQNLAQQPRSAEQVANIAKGGY 571

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D    P  ++ + ++GSE+++AV A E LS+   + RVVS+P  + F +Q  +YR  
Sbjct: 572 ILKDCAGQP--ELILIATGSEVELAVAAYEQLSAEGKAVRVVSMPSTDAFDKQDAAYREA 629

Query: 609 IIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ ++  K IAIEAG+   W  ++G  G  IGM  FG S     L++ FG     +V   
Sbjct: 630 VLPAAVTKRIAIEAGIADFWYKYVGFGGRIIGMTSFGESAPAGELFKLFGFTTENVVKQA 689

Query: 668 ERKLS 672
           +  L+
Sbjct: 690 KELLA 694


>gi|153802613|ref|ZP_01957199.1| transketolase 1 [Vibrio cholerae MZO-3]
 gi|254226306|ref|ZP_04919897.1| transketolase 1 [Vibrio cholerae V51]
 gi|124121876|gb|EAY40619.1| transketolase 1 [Vibrio cholerae MZO-3]
 gi|125621168|gb|EAZ49511.1| transketolase 1 [Vibrio cholerae V51]
          Length = 694

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 311/665 (46%), Positives = 424/665 (63%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +PQ P W +RDRFVLS 
Sbjct: 34  KQLANAIRALSMDGVQKANSGHPGAPMGMADIAEVLWRSHLNHNPQNPNWADRDRFVLSN 93

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI NA
Sbjct: 94  GHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGITNA 152

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 153 VGMAIAEKALAAQFNKPGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 212

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+  + +PT+I  
Sbjct: 213 DNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKAETSRPTLICT 272

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+AG++  HG+ LG +EIKA R+ L W+  PF IP DI   W  A    + 
Sbjct: 273 KTIIGFGSPNKAGSHDCHGAPLGNDEIKAAREFLGWEYAPFEIPADIYAAWD-AKQAGAS 331

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W E+ ++   +      E++RR +  LP  ++ A   +    + +   IA+RK+S+
Sbjct: 332 KEAAWDEKFAAYAKAYPAEAAEYKRRVAGELPANWEAATSEIIANLQANPANIASRKASQ 391

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE     LPE +GGSADL  SN T  S  K+++  DFSG Y+HYGVRE  M A +NGI
Sbjct: 392 NALEAFGKLLPEFMGGSADLAPSNLTMWSGSKSLTAEDFSGNYIHYGVREFGMTAIINGI 451

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY  TF++F +Y+R A+R+A+LM ++ I V THDSIGLGEDGPTHQPVE +A+
Sbjct: 452 ALHGGFVPYGATFLMFMEYARNAMRMAALMKVQNIQVYTHDSIGLGEDGPTHQPVEQIAS 511

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR  P++   RP D +E+   W++A++ K+ PS L  SRQNL       E     A G Y
Sbjct: 512 LRMTPNMSTWRPCDQVESAVAWKLAIERKDAPSALIFSRQNLAQQPRSAEQVANIAKGGY 571

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D    P  ++ + ++GSE+++AV A E LS+   + RVVS+P  + F +Q  +YR  
Sbjct: 572 ILKDCAGQP--ELILIATGSEVELAVAAYEQLSAEGKAVRVVSMPSTDAFDKQDAAYREA 629

Query: 609 IIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ ++  K IAIEAG+   W  ++G  G  IGM  FG S     L++ FG     +V   
Sbjct: 630 VLPAAVTKRIAIEAGIADFWYKYVGFGGRIIGMTSFGESAPAGELFKLFGFTTENVVKQA 689

Query: 668 ERKLS 672
           +  L+
Sbjct: 690 KELLA 694


>gi|307727440|ref|YP_003910653.1| transketolase [Burkholderia sp. CCGE1003]
 gi|307587965|gb|ADN61362.1| transketolase [Burkholderia sp. CCGE1003]
          Length = 691

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 317/671 (47%), Positives = 425/671 (63%), Gaps = 24/671 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           + MADA+R L++DA+E   SGHPG+P+GMA++  AL+ + +  +P+ P WP+RDRFVLS 
Sbjct: 18  RLMADALRMLAIDAVEAAKSGHPGMPLGMAEIAVALWDRHLKHNPRNPAWPDRDRFVLSN 77

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML YALL+L GY D+ I+++K FR + SKT GHPE G   G+E TTGPLGQG+ANA
Sbjct: 78  GHGSMLLYALLHLTGY-DLPIDELKRFRQLHSKTPGHPEVGVTPGVETTTGPLGQGLANA 136

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE  L  EF   G  ++DH TYV  GDGCLMEGIS EA S AG L L KL VL+D
Sbjct: 137 VGMALAEALLAREFNRPGHTIVDHRTYVFAGDGCLMEGISHEAASLAGTLKLDKLTVLYD 196

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACE 255
           +NGISIDG ++   + D  ARF A GW+ +  V+GHD  A+   L++A+ + +PT+I C 
Sbjct: 197 DNGISIDGHVAQWFNDDTPARFTAYGWHVVRDVDGHDVDALDRALQEARSAGRPTLICCR 256

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIG GSP +AGT+ VHG+ LG +EI  TR+AL W   PF +PDD+ K+W  A  R    
Sbjct: 257 TVIGKGSPGKAGTHDVHGAPLGADEIANTRRALGWTHAPFVVPDDVRKQWD-ASARGEAA 315

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A+W+ R  + +        EFERR   ALP  + +    + +  + +   IATRK+S+ 
Sbjct: 316 EAEWKRRFEAYRRHYPHEAAEFERRTQGALPAHWRDTVHAMLRDADSAAQSIATRKASQQ 375

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFS---GRYLHYGVREHAMAAAMN 429
            + V+   LPEL+GGSADLTGSN T       +   D     G YLHYGVRE  M+A +N
Sbjct: 376 TIAVLARALPELLGGSADLTGSNLTDWQAAIDVHADDTGLRGGNYLHYGVREFGMSAMIN 435

Query: 430 GIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHL 489
           GIALH+G   + GTF+ FSDYSR A+R+A+LM  R I V THDSIGLGEDGPTHQ VEH 
Sbjct: 436 GIALHRGHIAFGGTFLTFSDYSRNALRMAALMKTRSIFVFTHDSIGLGEDGPTHQSVEHA 495

Query: 490 AALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALG 549
           A+LR IP L V RP D++ET   W  A+ E+  PS L LSRQ LPF+            G
Sbjct: 496 ASLRLIPGLDVWRPCDTVETARAWASAV-ERAGPSCLLLSRQTLPFVTRGSAQIEAIERG 554

Query: 550 AYDYISTP-----------NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELF 598
            Y     P            A+V + ++GSE+ +A+EA  +L+   I+ RVVS+P   +F
Sbjct: 555 GYVLRDWPPEAAQGPDADVRARVVLIATGSEVSLALEALPLLAEAGIAARVVSMPSTSVF 614

Query: 599 FEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGI 658
             Q D++RA ++     ++A+EAG+R  W  ++G +G  +G+  FG S     L++HF +
Sbjct: 615 DRQPDAWRAAVLPPGVPRVAVEAGVRAFWRQYVGLEGGVVGIDTFGESAPAAALFEHFAL 674

Query: 659 NAIAIVDMVER 669
            A A+ D   R
Sbjct: 675 TAQAVADEARR 685


>gi|91790650|ref|YP_551602.1| transketolase [Polaromonas sp. JS666]
 gi|91699875|gb|ABE46704.1| transketolase [Polaromonas sp. JS666]
          Length = 674

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 316/681 (46%), Positives = 430/681 (63%), Gaps = 40/681 (5%)

Query: 22  MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGH 81
           MA++IR L+MDA++  NSGHPG PMGMAD+  AL+ + +   P  P W +RDRFVLS GH
Sbjct: 1   MANSIRALAMDAVQQANSGHPGAPMGMADIAVALWGRHLKHSPHNPQWFDRDRFVLSNGH 60

Query: 82  GSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVG 141
           GSML YALL+L GY+ + + ++KNFR + SKT GHPE+G   G+E TTGPLGQG+ NAVG
Sbjct: 61  GSMLLYALLHLTGYK-LPMSELKNFRQLHSKTPGHPEHGYTPGVETTTGPLGQGLTNAVG 119

Query: 142 MAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNN 198
           MA+AE+ L +EF   G  ++DH+TYV +GDGCLMEGIS EA + AG   L KLI L+D+N
Sbjct: 120 MALAEKLLAKEFNRDGHSVVDHHTYVFMGDGCLMEGISHEAAALAGAWKLGKLIALYDDN 179

Query: 199 GISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLS-DKPTMIACET 256
           GISIDGP++     +   RF A GWN +  ++GHD  A+++ + +A+ S DKPT+I C+T
Sbjct: 180 GISIDGPVTPWFIDNTPLRFAAYGWNVIGPLDGHDAQAVSAAIAEAKESTDKPTLIVCKT 239

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
            IG GSPNRA T K HG  LG EEIK TR  LNW   PF +P +    W           
Sbjct: 240 HIGKGSPNRANTAKAHGEPLGAEEIKLTRDELNWPHTPFEVPKESYDAWDAK-AAGLAAE 298

Query: 317 ADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELV 373
           A W  + ++ K++   +  EF RR    LP  F    ++           +A+RK+S++ 
Sbjct: 299 AAWDVKFTAYKAAHPELAAEFTRRMKGELPKRFSQLAVDTVIGAHTRAETVASRKASQIA 358

Query: 374 LEVVNDCLPELIGGSADLTGSNGTKTS--------------QMKAISKSDFSGRYLHYGV 419
           LE     LPE++GGSADLTGSN T T               Q +A + S   GR+++YGV
Sbjct: 359 LESFTAGLPEMLGGSADLTGSNLTNTKSTPNLRFDPNGEVVQTEAANGSLVGGRHINYGV 418

Query: 420 REHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGED 479
           RE  MAA MNG+ALH G  PY GTF+ FSDYSR AIR+A+LM +RV+HV THDSIGLGED
Sbjct: 419 REFGMAAIMNGVALHGGFIPYGGTFLTFSDYSRNAIRMAALMKLRVVHVFTHDSIGLGED 478

Query: 480 GPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQ 539
           GPTHQ +EH A+LR IP+L V RP D+ ET   W VAL+ KN+P+ L LSRQNLP+    
Sbjct: 479 GPTHQSIEHAASLRLIPNLDVWRPGDTAETAVAWAVALQNKNKPTALLLSRQNLPYA--- 535

Query: 540 YESNNLCAL--GAYDYISTP-------NAQVTIFSSGSELKIAVEACEILSSRNISTRVV 590
              N+L  +  GAY  ++ P        AQ  I ++GSE+++A++A E+L+ + I+ RVV
Sbjct: 536 -PKNDLGEISKGAY-VLAEPAEVGLNKKAQAVIIATGSEVQLALKAQELLAGKKIAVRVV 593

Query: 591 SVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCD 650
           S+P    F +QS +Y+  ++ +   +IA+E G+  GW  +     + +G+  +G S    
Sbjct: 594 SMPSTTTFDKQSTAYKTSVLPAGIPRIAVEMGVTDGWWKY--GCAAVVGIDTYGESAPAA 651

Query: 651 LLYQHFGINAIAIVDMVERKL 671
            L++HFG     + D V + L
Sbjct: 652 ALFKHFGFTPENVADTVRKVL 672


>gi|325134564|gb|EGC57208.1| transketolase [Neisseria meningitidis M13399]
 gi|325136499|gb|EGC59103.1| transketolase [Neisseria meningitidis M0579]
          Length = 659

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 311/660 (47%), Positives = 430/660 (65%), Gaps = 12/660 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIRFLS DA++  NSGHPG PMGMA++   L+T+ +  +P  P + NRDRFVLS G
Sbjct: 3   QLANAIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHNPANPKFYNRDRFVLSNG 62

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML Y+LL+L GY +++IED+KNFR + SKT GHPEYG   G+E TTGPLGQGIANAV
Sbjct: 63  HASMLLYSLLHLTGY-NLSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANAV 121

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DHYTYV +GDGCLMEG+S EA S AG LGL KLIVL+D+
Sbjct: 122 GMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEACSLAGTLGLGKLIVLYDD 181

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHD-HHAITSTLRKAQLSDKPTMIACE 255
           N ISIDG +    + +   RF + GW+ + +VNGHD      +       + KP++I C+
Sbjct: 182 NNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTAAIQAAIEAARAETGKPSIICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG GS N+ G++K HG+ LG +EI+ATRK L W    F IP +I   W  A  + ++ 
Sbjct: 242 TLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWTYPAFEIPQEIYDAWN-AKEQGAKL 300

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            ADW E  +  ++       EF RR    LPD FD       K+       IATRK+S+ 
Sbjct: 301 EADWNELFAQYQAKYPAEAAEFVRRMDKKLPDNFDEYVQTALKEVCAKAETIATRKASQN 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E++   LPEL+GGSADLT SN T  S   ++++ D  G Y+HYGVRE  M A MNG+A
Sbjct: 361 SIEILAKELPELVGGSADLTPSNLTDWSNSVSVTR-DKGGNYIHYGVREFGMGAIMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ P+  TF++FS+Y R A+R+A+LM I  + V THDSIGLGEDGPTHQP+E  A L
Sbjct: 420 LHGGVKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSIGLGEDGPTHQPIEQTATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYESNNLCALGAY 551
           R IP++ V RP D+ E+L  W  A+K  + PS L  SRQNL F  R++ + N++   G  
Sbjct: 480 RLIPNMDVWRPCDTAESLVAWAEAVKAADHPSCLIFSRQNLKFQARSEQQLNDIKRGGYI 539

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              +  NAQ  I ++GSE+++A+EA + L+++NI+ RVVS+P   +F  Q  +Y+A ++ 
Sbjct: 540 ISEAQGNAQAVIIATGSEVELALEAQKALAAQNIAVRVVSMPSTNVFDRQDAAYQATVLP 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
               ++A+EAG   GW  ++G +G+ +G+  FG S   DLL++ FG     +VD V+  L
Sbjct: 600 EGLPRVAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKAFGFTVDNVVDTVKSVL 659


>gi|147669261|ref|YP_001214079.1| transketolase [Dehalococcoides sp. BAV1]
 gi|146270209|gb|ABQ17201.1| transketolase [Dehalococcoides sp. BAV1]
          Length = 666

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 310/660 (46%), Positives = 432/660 (65%), Gaps = 21/660 (3%)

Query: 24  DAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGS 83
           +A+RFLS+DA++  NSGHPG PMGMA +  AL+   +  +PQ P WPNRDRF+LSAGH S
Sbjct: 12  NALRFLSVDAVQKANSGHPGAPMGMAAMAYALWQNFLKHNPQDPAWPNRDRFILSAGHAS 71

Query: 84  MLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMA 143
            L Y+LL+L GY D+ ++++KNFR  GSKT GHPEYG   G+E TTGPLGQG A+ VGMA
Sbjct: 72  ALLYSLLHLTGY-DLPLDELKNFRQWGSKTPGHPEYGLTPGVEMTTGPLGQGFASGVGMA 130

Query: 144 IAERKLREEFGDV---LIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGI 200
           +AE  L   F      +IDHYTY +V DG LMEG++ EA S AGHL L KLI L+D+N I
Sbjct: 131 MAEAHLAAVFNQPDCKIIDHYTYGIVSDGDLMEGVASEAASLAGHLALGKLIYLYDDNDI 190

Query: 201 SIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQL-SDKPTMIACETVI 258
           SI+G   LA + +   RF + GW  +  V+G D  A++  +++AQ  + +P++I C+T+I
Sbjct: 191 SIEGSTELAFTENAALRFESYGWQVIDHVDGLDPEAVSQAIKQAQSDTTRPSLIICKTII 250

Query: 259 GFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRAD 318
           GFGSPN+AG    HG  LG +E+  +RK+L WD +PF IP + + ++R A  +    +  
Sbjct: 251 GFGSPNKAGKASAHGEPLGTDEVSKSRKSLGWDYEPFVIPVEALTEFREALGKGKTAQQV 310

Query: 319 WQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLE 375
           W  +L    S   ++    +   S  LP+ +D    +L + F+ +   +A+R++S L++ 
Sbjct: 311 WLSKLDYYLSHYPEKASLLQDMLSGNLPEDWDK---DLDRLFDKA---MASREASGLLIN 364

Query: 376 VVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHK 435
            +   LP L+GGSADL+ SN T            + GR +H+GVREHAM A  NG+ALH 
Sbjct: 365 ALASRLPSLMGGSADLSPSNKTVIKDGGEYEPHYYEGRNIHFGVREHAMGAIANGLALHG 424

Query: 436 GLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAI 495
           G+ PY  TF++F DY RPA+RLASLMG RVI++ THDSIGLGEDGPTHQP+E LA LR++
Sbjct: 425 GIIPYVATFLIFYDYMRPAVRLASLMGQRVIYIFTHDSIGLGEDGPTHQPIEQLAGLRSV 484

Query: 496 PDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESNNLCALGAYDYI 554
           P L+ +RPADS ET + W+ A+  KN P+ ++LSRQ LP L  +Q +S NL   GAY   
Sbjct: 485 PGLVTIRPADSYETAQAWKTAILRKNGPTAIALSRQKLPLLDNSQTKSLNLPK-GAYILQ 543

Query: 555 ST-PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSS 613
            T  + QV + +SGSE+ IAVEA EIL  + IS+RVVS P ++LF  Q  +YR  ++ SS
Sbjct: 544 ETDSHPQVALVASGSEVTIAVEAAEILKGKGISSRVVSFPSWQLFDNQPQTYRQSVLPSS 603

Query: 614 PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV 673
             ++ +EAG  QGW  ++G++G+ I +  FGAS    LLY+ FG+      +M E+ L +
Sbjct: 604 LPRVIMEAGNSQGWCKYLGTNGTVISIDHFGASAPAPLLYKKFGLTP---ENMAEKALKL 660


>gi|325144725|gb|EGC67020.1| transketolase [Neisseria meningitidis M01-240013]
 gi|325205791|gb|ADZ01244.1| transketolase [Neisseria meningitidis M04-240196]
          Length = 659

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 311/660 (47%), Positives = 430/660 (65%), Gaps = 12/660 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIRFLS DA++  NSGHPG PMGMA++   L+T+ +  +P  P + NRDRFVLS G
Sbjct: 3   QLANAIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHNPANPKFYNRDRFVLSNG 62

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML Y+LL+L GY +++IED+KNFR + SKT GHPEYG   G+E TTGPLGQGIANAV
Sbjct: 63  HASMLLYSLLHLTGY-NLSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANAV 121

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DHYTYV +GDGCLMEG+S EA S AG LGL KLIVL+D+
Sbjct: 122 GMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEACSLAGTLGLGKLIVLYDD 181

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHD-HHAITSTLRKAQLSDKPTMIACE 255
           N ISIDG +    + +   RF + GW+ + +VNGHD      +       + KP++I C+
Sbjct: 182 NNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTAAIQAAIEAARAETGKPSIICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG GS N+ G++K HG+ LG +EI+ATRK L W    F IP +I   W  A  + ++ 
Sbjct: 242 TLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWTYPAFEIPQEIYDAWN-AKEQGAKL 300

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            ADW E  +  ++       EF RR    LP+ FD       K+       IATRK+S+ 
Sbjct: 301 EADWNELFAQYQAKYPAEAAEFVRRMDKKLPENFDEYVQTALKEVCAKAETIATRKASQN 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E++   LPEL+GGSADLT SN T  S   ++++ D  G Y+HYGVRE  M A MNG+A
Sbjct: 361 SIEILAKELPELVGGSADLTPSNLTDWSNSVSVTR-DKGGNYIHYGVREFGMGAIMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ P+  TF++FS+Y R A+R+A+LM I  + V THDSIGLGEDGPTHQP+E  A L
Sbjct: 420 LHGGVKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSIGLGEDGPTHQPIEQTATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYESNNLCALGAY 551
           R IP++ V RP D+ E+L  W  A+K  + PS L  SRQNL F  R++ + N++   G  
Sbjct: 480 RLIPNMDVWRPCDTAESLVAWAEAVKAADHPSCLIFSRQNLKFQARSEQQLNDIKRGGYI 539

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              +  NAQ  I ++GSE+++A+EA + L+++NI+ RVVS+P   +F  Q  +Y+A ++ 
Sbjct: 540 ISEAQGNAQAVIIATGSEVELALEAQKALAAQNIAVRVVSMPSTNVFDRQDAAYQATVLP 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
               +IA+EAG   GW  ++G +G+ +G+  FG S   DLL++ FG     +VD V+  L
Sbjct: 600 EGLPRIAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKEFGFTVDNVVDTVKSVL 659


>gi|254225133|ref|ZP_04918746.1| transketolase 1 [Vibrio cholerae V51]
 gi|125622232|gb|EAZ50553.1| transketolase 1 [Vibrio cholerae V51]
          Length = 668

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 311/665 (46%), Positives = 424/665 (63%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +PQ P W +RDRFVLS 
Sbjct: 8   KQLANAIRALSMDGVQKANSGHPGAPMGMADIAEVLWRSHLNHNPQNPNWADRDRFVLSN 67

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI NA
Sbjct: 68  GHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGITNA 126

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 127 VGMAIAEKALAAQFNKPGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 186

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+  + +PT+I  
Sbjct: 187 DNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKAETSRPTLICT 246

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+AG++  HG+ LG +EIKA R+ L W+  PF IP DI   W  A    + 
Sbjct: 247 KTIIGFGSPNKAGSHDCHGAPLGNDEIKAAREFLGWEYAPFEIPADIYAAWD-AKQAGAS 305

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W E+ ++   +      E++RR +  LP  ++ A   +    + +   IA+RK+S+
Sbjct: 306 KEAAWDEKFAAYAKAYPAEAAEYKRRVAGELPANWEAATSEIIADLQANPANIASRKASQ 365

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE     LPE +GGSADL  SN T  S  K+++  DFSG Y+HYGVRE  M A +NGI
Sbjct: 366 NALEAFGKLLPEFMGGSADLAPSNLTMWSGSKSLTAEDFSGNYIHYGVREFGMTAIINGI 425

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY  TF++F +Y+R A+R+A+LM ++ I V THDSIGLGEDGPTHQPVE +A+
Sbjct: 426 ALHGGFVPYGATFLMFMEYARNAMRMAALMKVQNIQVYTHDSIGLGEDGPTHQPVEQIAS 485

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR  P++   RP D +E+   W++A++ K+ PS L  SRQNL       E     A G Y
Sbjct: 486 LRMTPNMSTWRPCDQVESAVAWKLAIERKDAPSALIFSRQNLAQQPRSAEQVANIAKGGY 545

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D    P  ++ + ++GSE+++AV A E LS+   + RVVS+P  + F +Q  +YR  
Sbjct: 546 ILKDCAGQP--ELILIATGSEVELAVAAYEQLSAEGKAVRVVSMPSTDAFDKQDAAYREA 603

Query: 609 IIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ ++  K IAIEAG+   W  ++G  G  IGM  FG S     L++ FG     +V   
Sbjct: 604 VLPAAVTKRIAIEAGIADFWYKYVGFGGRIIGMTSFGESAPAGELFKLFGFTTENVVKQA 663

Query: 668 ERKLS 672
           +  L+
Sbjct: 664 KELLA 668


>gi|326567395|gb|EGE17510.1| transketolase [Moraxella catarrhalis BC1]
 gi|326577650|gb|EGE27527.1| transketolase [Moraxella catarrhalis O35E]
          Length = 662

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 318/672 (47%), Positives = 421/672 (62%), Gaps = 23/672 (3%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M  + + +  A+AIR L+MDA++  NSGHPG PMGMAD+   L+ + +  +P+   W NR
Sbjct: 1   MPIELNQRHNANAIRILAMDAVQQANSGHPGAPMGMADIAEVLWREFLRHNPKNAKWVNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLS GHGSML YALL+L GY D++I+D+KNFR + SKTAGHPEYG   GIE TTGPL
Sbjct: 61  DRFVLSNGHGSMLLYALLHLTGY-DLSIDDLKNFRQLHSKTAGHPEYGYADGIETTTGPL 119

Query: 133 GQGIANAVGMAIAERKLREEFG---DVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GQGIANAVG A+AE+ L  +F    + +IDH+TY  +GDGCLMEG+S EA S AG LGL 
Sbjct: 120 GQGIANAVGFALAEKTLAAQFNKPDNAIIDHFTYAFLGDGCLMEGVSHEACSLAGTLGLG 179

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDK 248
           KLI  +D+NGISIDG +    S D   RF A GW  L ++GHD  AI     +A+  S K
Sbjct: 180 KLIAYYDDNGISIDGEVEGWFSDDTAKRFEAYGWQVLKIDGHDADAIRDATNQAKAESAK 239

Query: 249 PTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNW-DLDPFFIPDDIMKKWRL 307
           PT+I C+T+IG GSPN+ G    HG+ LG +EI  TR  + W D  PF I D++ + W  
Sbjct: 240 PTLIICKTIIGLGSPNKQGKEISHGAPLGLDEIALTRTQMGWADTTPFIITDEMYRAWD- 298

Query: 308 AGLRSSQTRADWQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMI 364
           A  + S   A W ++ +  +    KE     RRFS  LP+ FD       +        I
Sbjct: 299 ATAKGSTDEAAWNKQFAEYQDKYPKEAAELLRRFSGDLPENFDQLADEFIQTCIQKAESI 358

Query: 365 ATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAM 424
           ATRK+S+  +  +   LPE++GGSADL GSN T  S  K + +    G Y+HYGVRE  M
Sbjct: 359 ATRKASQNAIAALAPHLPEILGGSADLAGSNLTLWSGAKGVQEYA-DGNYVHYGVREFGM 417

Query: 425 AAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQ 484
            A  NG+ALH G  PY+ TF++F +Y+R A+R++SLM  RVI+V THDSIGLGEDGPTHQ
Sbjct: 418 TAIANGVALHGGFIPYTATFLMFMEYARNAVRMSSLMKQRVINVYTHDSIGLGEDGPTHQ 477

Query: 485 PVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESN 543
           PVE +A LR  P+  V RP D++ET   W++ALK K  PS L LSRQNL F  R+  +  
Sbjct: 478 PVEQIANLRMTPNHYVWRPCDTVETAVAWKMALKTKTAPSSLILSRQNLTFQSRSDEQIQ 537

Query: 544 NLCALGAYDYISTPNA---QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFE 600
           N+   G   YI  P     +  I ++GSE+++A++A E L       RVVS+PC E+F +
Sbjct: 538 NIEKGG---YILAPEKGTLKAIIIATGSEVELAMQAYEQLE----GVRVVSMPCAEIFVK 590

Query: 601 QSDSYRAQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           Q   Y   ++ S   +++A+EA +   W  F+G DG  +GM  FG S    +L++HFGI 
Sbjct: 591 QDSGYIESVLPSDVRVRVAVEAAITDYWYKFVGLDGKVVGMTTFGESAPAKVLFEHFGIT 650

Query: 660 AIAIVDMVERKL 671
             A+VD V   L
Sbjct: 651 TQAVVDAVNSLL 662


>gi|325201846|gb|ADY97300.1| transketolase [Neisseria meningitidis M01-240149]
 gi|325208402|gb|ADZ03854.1| transketolase [Neisseria meningitidis NZ-05/33]
          Length = 659

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 311/660 (47%), Positives = 430/660 (65%), Gaps = 12/660 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIRFLS DA++  NSGHPG PMGMA++   L+T+ +  +P  P + NRDRFVLS G
Sbjct: 3   QLANAIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHNPANPKFYNRDRFVLSNG 62

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML Y+LL+L GY +++IED+KNFR + SKT GHPEYG   G+E TTGPLGQGIANAV
Sbjct: 63  HASMLLYSLLHLTGY-NLSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANAV 121

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DHYTYV +GDGCLMEG+S EA S AG LGL KLIVL+D+
Sbjct: 122 GMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEACSLAGTLGLGKLIVLYDD 181

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHD-HHAITSTLRKAQLSDKPTMIACE 255
           N ISIDG +    + +   RF + GW+ + +VNGHD      +       + KP++I C+
Sbjct: 182 NNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTAAIQAAIEAARAETGKPSIICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG GS N+ G++K HG+ LG +EI+ATRK L W    F IP +I   W  A  + ++ 
Sbjct: 242 TLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWTYPAFEIPQEIYDAWN-AKEQGAKL 300

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            ADW E  +  ++       EF RR    LP+ FD       K+       IATRK+S+ 
Sbjct: 301 EADWNELFAQYQAKYPAEAAEFVRRMDKKLPENFDGYVQTALKEVCAKAETIATRKASQN 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E++   LPEL+GGSADLT SN T  S   ++++ D  G Y+HYGVRE  M A MNG+A
Sbjct: 361 SIEILAKELPELVGGSADLTPSNLTDWSNSVSVTR-DKGGNYIHYGVREFGMGAIMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ P+  TF++FS+Y R A+R+A+LM I  + V THDSIGLGEDGPTHQP+E  A L
Sbjct: 420 LHGGVKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSIGLGEDGPTHQPIEQTATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYESNNLCALGAY 551
           R IP++ V RP D+ E+L  W  A+K  + PS L  SRQNL F  R++ + N++   G  
Sbjct: 480 RLIPNMDVWRPCDTAESLVAWAEAVKAADHPSCLIFSRQNLKFQARSEQQLNDIKRGGYI 539

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              +  NAQ  I ++GSE+++A+EA + L+++NI+ RVVS+P   +F  Q  +Y+A ++ 
Sbjct: 540 ISEAQGNAQAVIIATGSEVELALEAQKALAAQNIAVRVVSMPSTNVFDRQDAAYQATVLP 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
               +IA+EAG   GW  ++G +G+ +G+  FG S   DLL++ FG     +VD V+  L
Sbjct: 600 EGLPRIAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKEFGFTVDNVVDTVKSVL 659


>gi|229512534|ref|ZP_04402005.1| transketolase [Vibrio cholerae TMA 21]
 gi|229350427|gb|EEO15376.1| transketolase [Vibrio cholerae TMA 21]
          Length = 665

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 311/665 (46%), Positives = 424/665 (63%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +PQ P W +RDRFVLS 
Sbjct: 5   KQLANAIRALSMDGVQKANSGHPGAPMGMADIAEVLWRSHLNHNPQNPNWADRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI NA
Sbjct: 65  GHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGITNA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 124 VGMAIAEKALAAQFNKPGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+  + +PT+I  
Sbjct: 184 DNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKAETSRPTLICT 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+AG++  HG+ LG +EIKA R+ L W+  PF IP DI   W  A    + 
Sbjct: 244 KTIIGFGSPNKAGSHDCHGAPLGNDEIKAAREFLGWEHAPFEIPADIYAAWD-AKQAGAS 302

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W E+ ++   +      E++RR +  LP  ++ A   +    + +   IA+RK+S+
Sbjct: 303 KEAAWDEKFAAYAKAYPAEAAEYKRRVAGELPANWEAATSEIIANLQANPANIASRKASQ 362

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE     LPE +GGSADL  SN T  S  K+++  DFSG Y+HYGVRE  M A +NGI
Sbjct: 363 NALEAFGKLLPEFMGGSADLAPSNLTMWSGSKSLTAEDFSGNYIHYGVREFGMTAIINGI 422

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY  TF++F +Y+R A+R+A+LM ++ I V THDSIGLGEDGPTHQPVE +A+
Sbjct: 423 ALHGGFVPYGATFLMFMEYARNAMRMAALMKVQNIQVYTHDSIGLGEDGPTHQPVEQIAS 482

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR  P++   RP D +E+   W++A++ K+ PS L  SRQNL       E     A G Y
Sbjct: 483 LRMTPNMSTWRPCDQVESAVAWKLAIERKDAPSALIFSRQNLAQQPRSAEQVANIAKGGY 542

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D    P  ++ + ++GSE+++AV A E LS+   + RVVS+P  + F +Q  +YR  
Sbjct: 543 ILKDCAGQP--ELILIATGSEVELAVAAYEQLSAEGKAVRVVSMPSTDAFDKQDAAYREA 600

Query: 609 IIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ ++  K IAIEAG+   W  ++G  G  IGM  FG S     L++ FG     +V   
Sbjct: 601 VLPAAVTKRIAIEAGIADFWYKYVGFGGRIIGMTSFGESAPAGELFKLFGFTTENVVKQA 660

Query: 668 ERKLS 672
           +  L+
Sbjct: 661 KELLA 665


>gi|153211909|ref|ZP_01947756.1| transketolase 1 [Vibrio cholerae 1587]
 gi|124116985|gb|EAY35805.1| transketolase 1 [Vibrio cholerae 1587]
          Length = 680

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 310/665 (46%), Positives = 424/665 (63%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +PQ P W +RDRFVLS 
Sbjct: 20  KQLANAIRALSMDGVQKANSGHPGAPMGMADIAEVLWRSHLNHNPQNPNWADRDRFVLSN 79

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI NA
Sbjct: 80  GHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGITNA 138

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 139 VGMAIAEKALAAQFNKPGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 198

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+  + +PT+I  
Sbjct: 199 DNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKAETSRPTLICT 258

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+AG++  HG+ LG +EIKA R+ L W+  PF IP DI   W  A    + 
Sbjct: 259 KTIIGFGSPNKAGSHDCHGAPLGNDEIKAAREFLGWEYAPFEIPADIYAAWD-AKQAGAS 317

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W E+ ++   +      E++RR +  LP  ++ A   +    + +   IA+RK+S+
Sbjct: 318 KEAAWDEKFAAYAKAYPAEAAEYKRRVAGELPANWEAATSEIIANLQANPANIASRKASQ 377

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE     LPE +GGSADL  SN T  S  ++++  DFSG Y+HYGVRE  M A +NGI
Sbjct: 378 NALEAFGKLLPEFMGGSADLAPSNLTMWSGSQSLTAEDFSGNYIHYGVREFGMTAIINGI 437

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY  TF++F +Y+R A+R+A+LM ++ I V THDSIGLGEDGPTHQPVE +A+
Sbjct: 438 ALHGGFVPYGATFLMFMEYARNAMRMAALMKVQNIQVYTHDSIGLGEDGPTHQPVEQIAS 497

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR  P++   RP D +E+   W++A++ K+ PS L  SRQNL       E     A G Y
Sbjct: 498 LRMTPNMSTWRPCDQVESAVAWKLAIERKDAPSALIFSRQNLAQQPRSAEQVANIAKGGY 557

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D    P  ++ + ++GSE+++AV A E LS+   + RVVS+P  + F +Q  +YR  
Sbjct: 558 ILKDCAGQP--ELILIATGSEVELAVAAYEQLSAEGKAVRVVSMPSTDAFDKQDAAYREA 615

Query: 609 IIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ ++  K IAIEAG+   W  ++G  G  IGM  FG S     L++ FG     +V   
Sbjct: 616 VLPAAVTKRIAIEAGIADFWYKYVGFGGRIIGMTSFGESAPAGELFKLFGFTTENVVKQA 675

Query: 668 ERKLS 672
           +  L+
Sbjct: 676 KELLA 680


>gi|326569920|gb|EGE19970.1| transketolase [Moraxella catarrhalis BC8]
          Length = 662

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 318/672 (47%), Positives = 420/672 (62%), Gaps = 23/672 (3%)

Query: 13  MKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNR 72
           M  + + +  A+AIR L+MDA++  NSGHPG PMGMAD+   L+ + +  +P+   W NR
Sbjct: 1   MPIELNQRHNANAIRILTMDAVQQANSGHPGAPMGMADIAEVLWREFLRHNPKNAKWVNR 60

Query: 73  DRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPL 132
           DRFVLS GHGSML YALL+L GY D++I+D+KNFR + SKTAGHPEYG   GIE TTGPL
Sbjct: 61  DRFVLSNGHGSMLLYALLHLTGY-DLSIDDLKNFRQLHSKTAGHPEYGYADGIETTTGPL 119

Query: 133 GQGIANAVGMAIAERKLREEFG---DVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLS 189
           GQGIANAVG A+AE+ L  +F    + +IDH+TY  +GDGCLMEGIS EA S AG LGL 
Sbjct: 120 GQGIANAVGFALAEKTLAAQFNKPDNAIIDHFTYAFLGDGCLMEGISHEACSLAGTLGLG 179

Query: 190 KLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQL-SDK 248
           KLI  +D+NGISIDG +    S D   RF A GW  L ++GHD  AI     +A+  S K
Sbjct: 180 KLIAYYDDNGISIDGEVEGWFSDDTAKRFEAYGWQVLKIDGHDADAIRDATNQAKAESAK 239

Query: 249 PTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNW-DLDPFFIPDDIMKKWRL 307
           PT+I C+T+IG GSPN+ G    HG+ LG +EI  TR  + W D  PF I D++ + W  
Sbjct: 240 PTLIICKTIIGLGSPNKQGKEISHGAPLGLDEIALTRTQMGWADTTPFIITDEMYRAWD- 298

Query: 308 AGLRSSQTRADWQERLSSMKSSIRKE---FERRFSDALPDCFDNAFINLKKKFEHSKPMI 364
           A  + S   A W ++ +  +    KE     RRFS  LP+ FD       +        I
Sbjct: 299 ATAKGSTDEAAWNKQFAEYQDKYPKEAAELLRRFSGDLPENFDQLADEFIQTCVQKAESI 358

Query: 365 ATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAM 424
           ATRK+S+  +  +   LPE++GGSADL GSN T  S  K + +    G Y+HYGVRE  M
Sbjct: 359 ATRKASQNAIAALAPHLPEILGGSADLAGSNLTLWSGAKGVQEYA-DGNYVHYGVREFGM 417

Query: 425 AAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQ 484
            A  NG+ALH G  PY+ TF++F +Y+R A+R++SLM  RVI+V THDSIGLGEDGPTHQ
Sbjct: 418 TAIANGVALHGGFIPYTATFLMFMEYARNAVRMSSLMKQRVINVYTHDSIGLGEDGPTHQ 477

Query: 485 PVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFL-RTQYESN 543
           PVE +A LR  P+  V RP D++ET   W++ALK K  PS L LSRQNL F  R+  +  
Sbjct: 478 PVEQIANLRMTPNHYVWRPCDTVETAVAWKMALKTKTAPSSLILSRQNLAFQSRSDEQIQ 537

Query: 544 NLCALGAYDYISTPNA---QVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFE 600
           N+   G   YI  P     +  I ++GSE+++ ++A E L       RVVS+PC E+F +
Sbjct: 538 NIEKGG---YILAPEKGTLKAIIIATGSEVELVMQAYEQLE----GVRVVSMPCAEIFVK 590

Query: 601 QSDSYRAQIIGSS-PIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGIN 659
           Q   Y   ++ S   +++A+EA +   W  F+G DG  +GM  FG S    +L++HFGI 
Sbjct: 591 QDSGYIESVLPSDVRVRVAVEAAITDYWYKFVGLDGKVVGMTTFGESAPAKVLFEHFGIT 650

Query: 660 AIAIVDMVERKL 671
             A+VD V   L
Sbjct: 651 TQAVVDAVNSLL 662


>gi|313111818|ref|ZP_07797611.1| transketolase [Pseudomonas aeruginosa 39016]
 gi|310884113|gb|EFQ42707.1| transketolase [Pseudomonas aeruginosa 39016]
          Length = 665

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 309/666 (46%), Positives = 419/666 (62%), Gaps = 21/666 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ A+AIR LSMDA++  NSGHPG PMGMAD+   L+   M  +P  P W NRDRFVLS 
Sbjct: 5   RERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYMQHNPSNPQWANRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D+ IED+KNFR + S+T GHPEYG  AG+E TTGPLGQGIANA
Sbjct: 65  GHGSMLIYSLLHLTGY-DLGIEDLKNFRQLNSRTPGHPEYGYTAGVETTTGPLGQGIANA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  +F   G  ++DHYTY  +GDGC+MEGIS E  S AG L L+KLI  +D
Sbjct: 124 VGMALAEKVLAAQFNRDGHAVVDHYTYAFLGDGCMMEGISHEVASLAGTLRLNKLIAFYD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACE 255
           +NGISIDG ++   + D   RF A GW  + +V+GHD   I + +  A+ SD+PT+I C+
Sbjct: 184 DNGISIDGEVNGWFTDDTPKRFEAYGWQVIRNVDGHDADEIKTAIDTARKSDQPTLICCK 243

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIGFGSPN+ G  + HG+ LG +EI ATR AL W+  PF IP  I  +W      ++Q 
Sbjct: 244 TVIGFGSPNKQGKEECHGAPLGADEIAATRAALGWEHAPFEIPAQIYAEWDAKETGAAQ- 302

Query: 316 RADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A+W +R ++ +++   +  E  RR    LP  F            +    IA+RK+S+ 
Sbjct: 303 EAEWNKRFAAYQAAHPELAAELLRRLKGELPADFAEKAAAYVADVANKGETIASRKASQN 362

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            L      LPEL+GGSADL GSN T     K +S  D +G Y+ YGVRE  M+A MNG+A
Sbjct: 363 ALNAFGPLLPELLGGSADLAGSNLTLWKGCKGVSADDAAGNYVFYGVREFGMSAIMNGVA 422

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G  PY  TF++F +Y+R A+R+++LM  RV++V THDSIGLGEDGPTHQP+E LA+L
Sbjct: 423 LHGGFIPYGATFLIFMEYARNAVRMSALMKQRVLYVFTHDSIGLGEDGPTHQPIEQLASL 482

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY- 551
           R  P+L   RPAD++E+   W+ A++  + PS L  SRQNLP            A G Y 
Sbjct: 483 RLTPNLDTWRPADAVESAVAWKHAIERADGPSALIFSRQNLPHQARDVAQVADIARGGYV 542

Query: 552 --DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
             D    P  ++ + ++GSE+ +AV+A + LS +    RVVS+PC  ++ +Q +SY+  +
Sbjct: 543 LKDCAGEP--ELILIATGSEVGLAVQAYDKLSEQGRKVRVVSMPCTSVYEQQDESYKQSV 600

Query: 610 IGSSPI----KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
           +   P+    +IAIEA     W  ++G DG  IGM  FG S     L++HFG     ++ 
Sbjct: 601 L---PVEVGARIAIEAAHADYWYKYVGLDGRIIGMTSFGESAPAPALFEHFGFTLDNVLA 657

Query: 666 MVERKL 671
           + E  L
Sbjct: 658 VAEELL 663


>gi|59801404|ref|YP_208116.1| transketolase [Neisseria gonorrhoeae FA 1090]
 gi|194098326|ref|YP_002001384.1| transketolase [Neisseria gonorrhoeae NCCP11945]
 gi|239998738|ref|ZP_04718662.1| transketolase [Neisseria gonorrhoeae 35/02]
 gi|240014343|ref|ZP_04721256.1| transketolase [Neisseria gonorrhoeae DGI18]
 gi|240016777|ref|ZP_04723317.1| transketolase [Neisseria gonorrhoeae FA6140]
 gi|240080974|ref|ZP_04725517.1| transketolase [Neisseria gonorrhoeae FA19]
 gi|240112667|ref|ZP_04727157.1| transketolase [Neisseria gonorrhoeae MS11]
 gi|240115413|ref|ZP_04729475.1| transketolase [Neisseria gonorrhoeae PID18]
 gi|240117710|ref|ZP_04731772.1| transketolase [Neisseria gonorrhoeae PID1]
 gi|240121905|ref|ZP_04734867.1| transketolase [Neisseria gonorrhoeae PID24-1]
 gi|240123263|ref|ZP_04736219.1| transketolase [Neisseria gonorrhoeae PID332]
 gi|240125515|ref|ZP_04738401.1| transketolase [Neisseria gonorrhoeae SK-92-679]
 gi|254493529|ref|ZP_05106700.1| transketolase [Neisseria gonorrhoeae 1291]
 gi|260440776|ref|ZP_05794592.1| transketolase [Neisseria gonorrhoeae DGI2]
 gi|268594588|ref|ZP_06128755.1| transketolase [Neisseria gonorrhoeae 35/02]
 gi|268597086|ref|ZP_06131253.1| transketolase [Neisseria gonorrhoeae FA19]
 gi|268598735|ref|ZP_06132902.1| transketolase [Neisseria gonorrhoeae MS11]
 gi|268601093|ref|ZP_06135260.1| transketolase [Neisseria gonorrhoeae PID18]
 gi|268603412|ref|ZP_06137579.1| transketolase [Neisseria gonorrhoeae PID1]
 gi|268681892|ref|ZP_06148754.1| transketolase [Neisseria gonorrhoeae PID332]
 gi|268684108|ref|ZP_06150970.1| transketolase [Neisseria gonorrhoeae SK-92-679]
 gi|291044089|ref|ZP_06569805.1| transketolase [Neisseria gonorrhoeae DGI2]
 gi|293399261|ref|ZP_06643426.1| transketolase [Neisseria gonorrhoeae F62]
 gi|59718299|gb|AAW89704.1| putative transketolase [Neisseria gonorrhoeae FA 1090]
 gi|193933616|gb|ACF29440.1| transketolase [Neisseria gonorrhoeae NCCP11945]
 gi|226512569|gb|EEH61914.1| transketolase [Neisseria gonorrhoeae 1291]
 gi|268547977|gb|EEZ43395.1| transketolase [Neisseria gonorrhoeae 35/02]
 gi|268550874|gb|EEZ45893.1| transketolase [Neisseria gonorrhoeae FA19]
 gi|268582866|gb|EEZ47542.1| transketolase [Neisseria gonorrhoeae MS11]
 gi|268585224|gb|EEZ49900.1| transketolase [Neisseria gonorrhoeae PID18]
 gi|268587543|gb|EEZ52219.1| transketolase [Neisseria gonorrhoeae PID1]
 gi|268622176|gb|EEZ54576.1| transketolase [Neisseria gonorrhoeae PID332]
 gi|268624392|gb|EEZ56792.1| transketolase [Neisseria gonorrhoeae SK-92-679]
 gi|291012552|gb|EFE04541.1| transketolase [Neisseria gonorrhoeae DGI2]
 gi|291610675|gb|EFF39785.1| transketolase [Neisseria gonorrhoeae F62]
 gi|317164033|gb|ADV07574.1| transketolase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 659

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 313/661 (47%), Positives = 428/661 (64%), Gaps = 14/661 (2%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+ IRFLS DA++  NSGHPG PMGMA++   L+T+ +  +P  P + NRDRFVLS G
Sbjct: 3   QLANVIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHNPANPKFYNRDRFVLSNG 62

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML Y+LL+L GY +++IED+KNFR + SKT GHPEYG   G+E TTGPLGQGIANAV
Sbjct: 63  HASMLLYSLLHLTGY-NLSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANAV 121

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DHYTYV +GDGCLMEG+S EA S AG LGL KLIVL+D+
Sbjct: 122 GMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEACSLAGTLGLGKLIVLYDD 181

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIACE 255
           N ISIDG +    + +   RF + GW+ + +VNGHD  AI + +  A+  + KP++I C+
Sbjct: 182 NNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTAAIQTAIEAARAETGKPSIICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG GS N+ G++K HG+ LG +EI+ATRK L W    F IP +I   W  A  + ++ 
Sbjct: 242 TLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWAYPAFEIPQEIYDAWN-AKEKGAKL 300

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A W E  +  ++       EF RR    LP+ FD       K+       +ATRK+S+ 
Sbjct: 301 EAGWNELFAQYQAKYPAEAAEFVRRMDKKLPENFDEYVQTALKEVCAKAETVATRKASQN 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E++   LPEL+GGSADLT SN T  S   ++++ D  G Y+HYGVRE  M A MNG+ 
Sbjct: 361 SIEILAKELPELVGGSADLTPSNLTDWSNSVSVTR-DKGGNYIHYGVREFGMGAIMNGLV 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ P+  TF++FS+Y R A+R+A+LM I  + V THDSIGLGEDGPTHQP+E  A L
Sbjct: 420 LHGGVKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSIGLGEDGPTHQPIEQTATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYD 552
           R IP++ V RP D+ E+L  W  A K ++ PS L  SRQNL F     +  N    GAY 
Sbjct: 480 RLIPNMDVWRPCDTAESLVAWAEAAKAEDHPSCLIFSRQNLKFQARSEQQLNDIKRGAY- 538

Query: 553 YISTP--NAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQII 610
            IS    NAQ  I ++GSE+ +AVEA ++L+ + I+ RVVS+P   +F  Q  +Y+A ++
Sbjct: 539 VISEAQGNAQAVIIATGSEVGLAVEAQKVLAGQGIAVRVVSMPSTSVFDRQDAAYQAAVL 598

Query: 611 GSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERK 670
                +IA+EAG   GW  ++G +G+ +G+  FG S   DLL++ FG     +VD V+  
Sbjct: 599 PEGLPRIAVEAGHTNGWYKYVGLNGAVVGINRFGESAPADLLFKAFGFTVDNVVDTVKSV 658

Query: 671 L 671
           L
Sbjct: 659 L 659


>gi|304387154|ref|ZP_07369398.1| transketolase [Neisseria meningitidis ATCC 13091]
 gi|304338758|gb|EFM04868.1| transketolase [Neisseria meningitidis ATCC 13091]
          Length = 659

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 312/660 (47%), Positives = 429/660 (65%), Gaps = 12/660 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIRFLS DA++  NSGHPG PMGMA++   L+T+ +  +P  P + NRDRFVLS G
Sbjct: 3   QLANAIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHNPANPKFYNRDRFVLSNG 62

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           H SML Y+LL+L GY +++IED+KNFR + SKT GHPEYG   G+E TTGPLGQGIANAV
Sbjct: 63  HASMLLYSLLHLTGY-NLSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANAV 121

Query: 141 GMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA+AE+ L  EF   G  ++DHYTYV +GDGCLMEG+S EA S AG LGL KLIVL+D+
Sbjct: 122 GMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEACSLAGTLGLGKLIVLYDD 181

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTL-SVNGHD-HHAITSTLRKAQLSDKPTMIACE 255
           N ISIDG +    + +   RF + GW+ + +VNGHD      +       + KP++I C+
Sbjct: 182 NNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTAAIQAAIEAARAETGKPSIICCK 241

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           T+IG GS N+ G++K HG+ LG +EI+ATRK L W    F IP +I   W  A  + ++ 
Sbjct: 242 TLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWTYPAFEIPQEIYDAWN-AKEKGAKL 300

Query: 316 RADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            ADW E  +  ++       EF RR    LP+ FD       K+       IATRK+S+ 
Sbjct: 301 EADWNELFAQYQAKYPAEAAEFVRRMDKKLPENFDEYVQTALKEVCAKAETIATRKASQN 360

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            +E++   LPEL+GGSADLT SN T  S   ++++ D  G Y+HYGVRE  M A MNG+A
Sbjct: 361 SIEILAKELPELVGGSADLTPSNLTDWSNSVSVTR-DKGGNYIHYGVREFGMGAIMNGLA 419

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G+ P+  TF++FS+Y R A+R+A+LM I  + V THDSIGLGEDGPTHQPVE  A L
Sbjct: 420 LHGGIKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSIGLGEDGPTHQPVEQTATL 479

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYESNNLCALGAY 551
           R IP++ V R  D+ E+L  W  A+K  + PS L  SRQNL F  R + + N++   G  
Sbjct: 480 RLIPNMDVWRSCDTTESLVAWAEAIKAADHPSCLIFSRQNLKFQARNEQQLNDIKRGGYV 539

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
              +  NAQ  I ++GSE+++A+EA + L+++NI+ RVVS+P   +F  Q  +Y+A ++ 
Sbjct: 540 ISEAQGNAQAVIIATGSEVELALEAQKALAAQNIAVRVVSMPSTNVFDRQDTAYQAAVLP 599

Query: 612 SSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
            S  +IA+EAG   GW  ++G +G+ +G+  FG S   DLL++ FG     +VD V+  L
Sbjct: 600 ESLPRIAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKAFGFTVDNVVDTVKSVL 659


>gi|262403690|ref|ZP_06080248.1| transketolase [Vibrio sp. RC586]
 gi|262350194|gb|EEY99329.1| transketolase [Vibrio sp. RC586]
          Length = 664

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 310/665 (46%), Positives = 427/665 (64%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +PQ P W +RDRFVLS 
Sbjct: 4   KQLANAIRALSMDGVQKANSGHPGAPMGMADIAEVLWRSHLNHNPQNPNWADRDRFVLSN 63

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI NA
Sbjct: 64  GHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGITNA 122

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 123 VGMAMAEKALAAQFNKPGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 182

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+  + +PT+I  
Sbjct: 183 DNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKAETSRPTLICT 242

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+AG++  HG+ LG +EIKA R+ L W+  PF IP DI   W      +S+
Sbjct: 243 KTIIGFGSPNKAGSHDCHGAPLGNDEIKAAREFLGWEYAPFEIPADIYAAWDAKPAGASK 302

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W E+ ++  ++      E++RR +  LP  ++ A   +  + + +   IA+RK+S+
Sbjct: 303 -EAAWDEKFAAYANAYPAEAAEYKRRVAGELPANWEAATSAIIAELQANPANIASRKASQ 361

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE     LPE +GGSADL  SN T  S  K+++  DFSG Y+HYGVRE  M A +NGI
Sbjct: 362 NALEAFGKLLPEFMGGSADLAPSNLTMWSGSKSLTAEDFSGNYIHYGVREFGMTAIINGI 421

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY  TF++F +Y+R A+R+A+LM ++ I V THDSIGLGEDGPTHQPVE +A+
Sbjct: 422 ALHGGFVPYGATFLMFMEYARNAMRMAALMKVQNIQVYTHDSIGLGEDGPTHQPVEQIAS 481

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR  P++   RP D +E+   W++A++ K+ PS L  SRQNL       E     A G Y
Sbjct: 482 LRMTPNMSTWRPCDQVESAMAWKLAIERKDAPSALIFSRQNLAQQPRSAEQVANIAKGGY 541

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D    P  ++ + ++GSE+++AV A E LS+   + RVVS+P  + F +Q  +YR  
Sbjct: 542 ILKDCAGQP--ELILIATGSEVELAVAAYEQLSAEGKAVRVVSMPSTDAFDKQDAAYREA 599

Query: 609 IIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ ++  K IAIEAG+   W  ++G  G  IGM  FG S     L++ FG     +V   
Sbjct: 600 VLPAAVTKRIAIEAGIADFWYKYVGFGGRIIGMTSFGESAPAGELFKLFGFTTENVVKQA 659

Query: 668 ERKLS 672
           +  L+
Sbjct: 660 KELLA 664


>gi|262164077|ref|ZP_06031816.1| transketolase [Vibrio mimicus VM223]
 gi|262027605|gb|EEY46271.1| transketolase [Vibrio mimicus VM223]
          Length = 665

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 314/665 (47%), Positives = 425/665 (63%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +PQ P W +RDRFVLS 
Sbjct: 5   KQLANAIRALSMDGVQKANSGHPGAPMGMADIAEVLWRSHLNHNPQNPNWADRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI NA
Sbjct: 65  GHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGITNA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 124 VGMAIAEKALAAQFNKPGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+  + +PT+I  
Sbjct: 184 DNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKAETSRPTLICT 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+AG++  HG+ LG +EIKA R+ L W+  PF IP DI   W      +S+
Sbjct: 244 KTIIGFGSPNKAGSHDCHGAPLGNDEIKAAREFLGWEHAPFEIPADIYAAWDAKAAGASK 303

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W E+  +   +      E++RR +  LP  ++ A   +    + +   IA+RK+S+
Sbjct: 304 -EAAWDEKFVAYAKAYPAEAAEYKRRVAGELPANWEAATSEIIASLQANPANIASRKASQ 362

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE     LPE +GGSADL  SN T  S  K++  +DFSG Y+HYGVRE  M A MNGI
Sbjct: 363 NALEAFGKLLPEFMGGSADLAPSNLTMWSGSKSLETNDFSGNYIHYGVREFGMTAIMNGI 422

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY  TF++F +Y+R A+R+A+LM I+ I V THDSIGLGEDGPTHQPVE +A+
Sbjct: 423 ALHGGFVPYGATFLMFMEYARNAMRMAALMKIQNIQVYTHDSIGLGEDGPTHQPVEQIAS 482

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR  P++   RP D +E+   W++A++ K+ PS L  SRQNL       E     A G Y
Sbjct: 483 LRMTPNMSTWRPCDQVESAVAWKLAIERKDAPSALIFSRQNLAQQPRSAEQVANIAKGGY 542

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D    P  ++ + ++GSE+++AV ACE LS+   + RVVS+P  + F +Q  +YR  
Sbjct: 543 ILKDCAGQP--ELILIATGSEVELAVAACEQLSAEGKAVRVVSMPSTDAFDKQDAAYREA 600

Query: 609 IIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ ++  K IAIEAG+   W  ++G  G  IGM  FG S     L++ FG     +V   
Sbjct: 601 VLPAAVTKRIAIEAGIADFWYKYVGFGGRIIGMTSFGESAPAGELFKLFGFTTENVVKQA 660

Query: 668 ERKLS 672
           +  L+
Sbjct: 661 KELLA 665


>gi|261212395|ref|ZP_05926680.1| transketolase [Vibrio sp. RC341]
 gi|260838326|gb|EEX64982.1| transketolase [Vibrio sp. RC341]
          Length = 664

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 310/665 (46%), Positives = 424/665 (63%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +PQ P W +RDRFVLS 
Sbjct: 4   KQLANAIRALSMDGVQKANSGHPGAPMGMADIAEVLWRSHLNHNPQNPNWADRDRFVLSN 63

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI NA
Sbjct: 64  GHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGITNA 122

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 123 VGMAIAEKALAAQFNKPGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 182

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+  + +PT+I  
Sbjct: 183 DNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKAETSRPTLICT 242

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+AG++  HG+ LG +EIKA R+ L W+  PF IP DI   W  A    + 
Sbjct: 243 KTIIGFGSPNKAGSHDCHGAPLGNDEIKAAREFLGWEYAPFEIPADIYAAWD-AKQAGAS 301

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W E+ ++   +      E++RR +  LP  ++ A   +    + +   IA+RK+S+
Sbjct: 302 KEAAWDEKFAAYAKAYPAEAAEYKRRVAGELPANWEAATSEIIANLQATPANIASRKASQ 361

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE     LPE +GGSADL  SN T  S  ++++  DFSG Y+HYGVRE  M A +NGI
Sbjct: 362 NALEAFGKLLPEFMGGSADLAPSNLTMWSGSQSLTAEDFSGNYIHYGVREFGMTAIINGI 421

Query: 432 ALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAA 491
           ALH G  PY  TF++F +Y+R A+R+A+LM ++ I V THDSIGLGEDGPTHQPVE +A+
Sbjct: 422 ALHGGFVPYGATFLMFMEYARNAMRMAALMKVQNIQVYTHDSIGLGEDGPTHQPVEQIAS 481

Query: 492 LRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY 551
           LR  P++   RP D +E+   W++A++ K+ PS L  SRQNL       E     A G Y
Sbjct: 482 LRMTPNMSTWRPCDQVESAVAWKLAIERKDAPSALIFSRQNLAQQPRSAEQVANIAKGGY 541

Query: 552 ---DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQ 608
              D    P  ++ + ++GSE+++AV A E LS+   + RVVS+P  + F +Q  +YR  
Sbjct: 542 ILKDCAGQP--ELILIATGSEVELAVAAYEQLSAEGKAVRVVSMPSTDAFDKQDAAYREA 599

Query: 609 IIGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMV 667
           ++ ++  K IAIEAG+   W  ++G  G  IGM  FG S     L++ FG     +V   
Sbjct: 600 VLPAAVTKRIAIEAGIADFWYKYVGFGGRIIGMTSFGESAPAGELFKLFGFTTENVVKQA 659

Query: 668 ERKLS 672
           +  L+
Sbjct: 660 KELLA 664


>gi|197335955|ref|YP_002155196.1| transketolase [Vibrio fischeri MJ11]
 gi|197317445|gb|ACH66892.1| transketolase [Vibrio fischeri MJ11]
          Length = 664

 Score =  596 bits (1537), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 309/664 (46%), Positives = 422/664 (63%), Gaps = 15/664 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K +A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +PQ P W +RDRF+LS 
Sbjct: 5   KHLANAIRALSMDGVQQANSGHPGAPMGMADIAEVLWRSHLNHNPQNPEWADRDRFILSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D++IED+KNFR + SKT GHPEYG   G+E TTGPLGQGI N 
Sbjct: 65  GHGSMLIYSLLHLSGY-DLSIEDLKNFRQLHSKTPGHPEYGYAPGVETTTGPLGQGITNG 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  +F   G  ++DH TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 124 VGMAMAEKALAAQFNREGHDIVDHNTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACE 255
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+   +P++I  +
Sbjct: 184 DNGISIDGEVEGWFSDDTPKRFEAYGWHVIPAVDGHDSDAINAAIEAAKADPRPSLICTK 243

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIGFGSPN+ GT+  HG+ LG EEI AT+  L W+   F IP D+  +W  A    S+ 
Sbjct: 244 TVIGFGSPNKQGTHDCHGAPLGAEEIAATKAQLGWEHGAFEIPADVYGEWD-AKEAGSEK 302

Query: 316 RADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A W  +  +  ++   +  E++RR +  LP  ++     +    + +   IA+RK+S+ 
Sbjct: 303 EAAWNAKFDAYAAAYPELAAEYKRRVNGDLPAEWEEKANAIIADLQANPANIASRKASQN 362

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            LE     LPE +GGSADL  SN T  S  K++  +DFSG Y+HYGVRE  M A MNGIA
Sbjct: 363 ALEAFGAMLPEFMGGSADLAPSNLTMWSGSKSLEANDFSGNYIHYGVREFGMTAIMNGIA 422

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G  PY  TF++F +Y+R A+R+A+LM ++ I V THDSIGLGEDGPTHQPVE +A+L
Sbjct: 423 LHGGFVPYGATFLMFMEYARNAMRMAALMKVQNIQVYTHDSIGLGEDGPTHQPVEQIASL 482

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY- 551
           R  P++   RP D +E+   W++A++ K+ PS L  SRQNL       E     A GAY 
Sbjct: 483 RLTPNMSTWRPCDQVESAVAWKLAIERKDGPSSLIFSRQNLAQQERTQEQVADIAKGAYI 542

Query: 552 --DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
             D    P  ++ + ++GSE+++AVEA   L++   + RVVS+P  + F +Q ++YR  +
Sbjct: 543 LKDCEGQP--ELILIATGSEVELAVEAAAQLTAEGKAVRVVSMPSTDAFDKQDEAYREAV 600

Query: 610 IGSSPIK-IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           + S+  K IAIEAG+   W  ++G  G  IGM  FG S   D L++ FG     +V+  +
Sbjct: 601 LPSAVTKRIAIEAGIADFWYKYVGFGGKIIGMTTFGESAPADELFKMFGFTTENVVNTAK 660

Query: 669 RKLS 672
             L+
Sbjct: 661 ELLA 664


>gi|254282073|ref|ZP_04957041.1| transketolase [gamma proteobacterium NOR51-B]
 gi|219678276|gb|EED34625.1| transketolase [gamma proteobacterium NOR51-B]
          Length = 666

 Score =  596 bits (1537), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 309/658 (46%), Positives = 418/658 (63%), Gaps = 12/658 (1%)

Query: 21  KMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAG 80
           ++A+AIR LSMDA++   SGHPG PMGMAD+   L+   +  +P  P W +RDRFVLS G
Sbjct: 6   ELANAIRVLSMDAVQAAKSGHPGAPMGMADIAEVLWNDHLKHNPADPKWVDRDRFVLSNG 65

Query: 81  HGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAV 140
           HGSML Y+LL+L GY D+ ++++K FR + SKT GHPEYG   G+E TTGPLGQG+ANAV
Sbjct: 66  HGSMLIYSLLHLSGY-DLPLDELKQFRQLHSKTPGHPEYGYAPGVETTTGPLGQGLANAV 124

Query: 141 GMAIAERKLREEFG---DVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDN 197
           GMA++E+ L  +F      ++DH+T+V +GDGCLMEGIS E  S AG LGL KLI  +D+
Sbjct: 125 GMALSEKVLAAQFNRGEHQIVDHHTWVFLGDGCLMEGISHEVCSLAGTLGLGKLIAFYDD 184

Query: 198 NGISIDGPISLADSTDQYARFRASGWNTLS-VNGHDHHAITSTLRKAQLSD-KPTMIACE 255
           NGISIDG +    + D  ARF A GW  ++ V+GHD  AI S +  A+  D +PT+I C+
Sbjct: 185 NGISIDGEVEGWFTDDTPARFNAYGWQVIADVDGHDPAAIESAITTAKAEDGRPTLICCK 244

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIG GSPN+AG+   HG+ LG++E+ ATR+AL W    F IPDDI   W  AG R +  
Sbjct: 245 TVIGKGSPNKAGSESCHGAPLGEDEVAATREALGWAHPAFSIPDDIYAGWD-AGNRGAAA 303

Query: 316 RADWQERLSSMKS---SIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
           +++WQ R +S K     +   FERR    LPD FD       ++       +A+RK+S+ 
Sbjct: 304 QSEWQRRFASYKGVHPDLAASFERRMCGDLPDDFDAGIDAYIRQCAEEGADVASRKASQQ 363

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            L  +   LPEL+GGSADL GSN T  +    +S+ D SG Y++YGVRE  M+A MNGIA
Sbjct: 364 ALNALGPMLPELLGGSADLAGSNLTLWAGSAPLSRDDASGNYVNYGVREFGMSAMMNGIA 423

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G  PY  TF+VF +Y+R A+R+A+LM  R + V THDSIGLGEDGPTHQPVE L A+
Sbjct: 424 LHGGFIPYGATFLVFMEYARNALRMAALMQQRAVFVYTHDSIGLGEDGPTHQPVEQLTAM 483

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF-LRTQYESNNLCALGAY 551
           R+ P+L   RP D++E+   W++A+K    P+ L  SRQ LP  +R+  +  N+   G  
Sbjct: 484 RSTPNLCTWRPCDTVESAVSWKMAVKRDTGPTALVFSRQGLPHQIRSDDQIANIERGGYV 543

Query: 552 DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIG 611
                      I ++GSE+ +AVEA + L+++    RVVS+PC E F  Q   YR  ++ 
Sbjct: 544 LVDEASELDAIIIATGSEVGLAVEAAQQLTAQGRGIRVVSMPCAEAFSGQDAMYRESVLP 603

Query: 612 SSPI-KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVE 668
           S  + ++A+EA     W  F+G DG  +GM  FG S     L++HF I   A+V  VE
Sbjct: 604 SDALARVAVEAAHTDYWYKFVGLDGRVVGMTSFGESAPAGALFEHFDITVEAVVSAVE 661


>gi|152988042|ref|YP_001346046.1| transketolase [Pseudomonas aeruginosa PA7]
 gi|150963200|gb|ABR85225.1| transketolase [Pseudomonas aeruginosa PA7]
          Length = 723

 Score =  596 bits (1537), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 309/666 (46%), Positives = 418/666 (62%), Gaps = 21/666 (3%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           ++ A+AIR LSMDA++  NSGHPG PMGMAD+   L+   M  +P  P W NRDRFVLS 
Sbjct: 63  RERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYMQHNPSNPQWANRDRFVLSN 122

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY D+ IED+KNFR + S+T GHPEYG  AG+E TTGPLGQGIANA
Sbjct: 123 GHGSMLIYSLLHLTGY-DLGIEDLKNFRQLNSRTPGHPEYGYTAGVETTTGPLGQGIANA 181

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMA+AE+ L  +F   G  ++DHYTY  +GDGC+MEGIS E  S AG L L+KLI  +D
Sbjct: 182 VGMALAEKVLAAQFNRDGHAVVDHYTYAFLGDGCMMEGISHEVASLAGTLRLNKLIAFYD 241

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQLSDKPTMIACE 255
           +NGISIDG +    + D   RF A GW  + +V+GHD   I + +  A+ SD+PT+I C+
Sbjct: 242 DNGISIDGEVHGWFTDDTPKRFEAYGWQVIRNVDGHDADEIKTAIDTARKSDQPTLICCK 301

Query: 256 TVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQT 315
           TVIGFGSPN+ G  + HG+ LG +EI ATR AL W+  PF IP  I  +W      ++Q 
Sbjct: 302 TVIGFGSPNKQGKEECHGAPLGADEIAATRAALGWEHGPFEIPAQIYAEWDARETGAAQ- 360

Query: 316 RADWQERLSSMKSS---IRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSEL 372
            A+W +R ++ +++   +  E  RR    LP  F            +    IA+RK+S+ 
Sbjct: 361 EAEWNKRFAAYQAAHPELAAELLRRLKGELPADFAEKAAAYVADVANKGETIASRKASQN 420

Query: 373 VLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIA 432
            L      LPEL+GGSADL GSN T     K +S  D +G Y+ YGVRE  M+A MNG+A
Sbjct: 421 ALNAFGPLLPELLGGSADLAGSNLTLWKGCKGVSADDAAGNYVFYGVREFGMSAIMNGVA 480

Query: 433 LHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAAL 492
           LH G  PY  TF++F +Y+R A+R+++LM  RV++V THDSIGLGEDGPTHQP+E LA+L
Sbjct: 481 LHGGFIPYGATFLIFMEYARNAVRMSALMKQRVLYVFTHDSIGLGEDGPTHQPIEQLASL 540

Query: 493 RAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAY- 551
           R  P+L   RPAD++E+   W+ A++  + PS L  SRQNLP            A G Y 
Sbjct: 541 RLTPNLDTWRPADAVESAVAWKHAIERADGPSALIFSRQNLPHQARDVAQVTDIARGGYV 600

Query: 552 --DYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQI 609
             D    P  ++ + ++GSE+ +AV+A + LS +    RVVS+PC  ++ +Q +SY+  +
Sbjct: 601 LKDCAGEP--ELILIATGSEVGLAVQAYDKLSEQGRKVRVVSMPCTSVYEQQDESYKQSV 658

Query: 610 IGSSPI----KIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVD 665
           +   P+    +IAIEA     W  ++G DG  IGM  FG S     L++HFG     ++ 
Sbjct: 659 L---PVEVGARIAIEAAHADYWYKYVGLDGRIIGMTSFGESAPAPALFEHFGFTLDNVLA 715

Query: 666 MVERKL 671
           + E  L
Sbjct: 716 VAEELL 721


>gi|229525164|ref|ZP_04414569.1| transketolase [Vibrio cholerae bv. albensis VL426]
 gi|229338745|gb|EEO03762.1| transketolase [Vibrio cholerae bv. albensis VL426]
          Length = 665

 Score =  596 bits (1537), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 310/665 (46%), Positives = 426/665 (64%), Gaps = 16/665 (2%)

Query: 20  KKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSA 79
           K++A+AIR LSMD ++  NSGHPG PMGMAD+   L+   +  +PQ P W +RDRFVLS 
Sbjct: 5   KQLANAIRALSMDGVQKANSGHPGAPMGMADIAEVLWRSHLNHNPQNPNWADRDRFVLSN 64

Query: 80  GHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANA 139
           GHGSML Y+LL+L GY+ ++I+D+KNFR + SKT GHPEYG   GIE TTGPLGQGI NA
Sbjct: 65  GHGSMLIYSLLHLSGYE-LSIDDLKNFRQLHSKTPGHPEYGYAPGIETTTGPLGQGITNA 123

Query: 140 VGMAIAERKLREEF---GDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           VGMAIAE+ L  +F   G  ++DH+TYV +GDGCLMEGIS EA S AG LGL KLI  WD
Sbjct: 124 VGMAIAEKALAAQFNKPGHDIVDHFTYVFMGDGCLMEGISHEACSLAGTLGLGKLIAFWD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTL-SVNGHDHHAITSTLRKAQL-SDKPTMIAC 254
           +NGISIDG +    S D   RF A GW+ + +V+GHD  AI + +  A+  + +PT+I  
Sbjct: 184 DNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDADAINAAIEAAKAETSRPTLICT 243

Query: 255 ETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQ 314
           +T+IGFGSPN+AG++  HG+ LG +EIKA R+ L W+  PF IP DI   W      +S+
Sbjct: 244 KTIIGFGSPNKAGSHDCHGAPLGNDEIKAAREFLGWEYAPFEIPADIYAAWDAKPAGASK 303

Query: 315 TRADWQERLSSMKSSI---RKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSE 371
             A W E+ ++   +      E++RR +  LP  ++ A   +    + +   IA+RK+S+
Sbjct: 304 -EAAWDEKFAAYAKAYPAEAAEYKRRVAGELPANWEAATSEIIANLQANPVNIASRKASQ 362

Query: 372 LVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGI 431
             LE +   LPE +GGSADL  SN T  S  ++++  DFSG Y+HYGVRE  M A +NGI
Sbjct: 363 NALEALGKLLPEFMGGSADLAPSNLTMWSGSQSLTAEDFSGNYIHYGVREFGMTAIINGI 422

Query: 432 ALHKGL