Query gi|254780657|ref|YP_003065070.1| hypothetical protein CLIBASIA_02720 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 61 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 20:28:25 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780657.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam03258 Baculo_FP Baculoviru 41.2 22 0.00057 17.7 2.4 47 2-59 133-179 (214) 2 COG0212 5-formyltetrahydrofola 21.4 79 0.002 14.8 3.1 40 4-43 2-41 (191) 3 TIGR02902 spore_lonB ATP-depen 20.1 36 0.00092 16.6 0.4 22 24-51 42-64 (532) 4 KOG3277 consensus 13.3 1.1E+02 0.0028 14.0 1.6 42 16-57 39-83 (165) 5 pfam01812 5-FTHF_cyc-lig 5-for 13.0 1.3E+02 0.0033 13.7 2.6 30 7-36 1-30 (182) 6 KOG3124 consensus 11.7 1E+02 0.0026 14.2 1.0 20 21-40 172-191 (267) 7 COG5040 BMH1 14-3-3 family pro 11.1 1E+02 0.0027 14.2 0.9 17 14-30 39-55 (268) 8 cd00649 catalase_peroxidase Ca 11.0 1.4E+02 0.0036 13.5 1.5 21 16-36 114-135 (405) 9 PRK00215 LexA repressor; Valid 9.9 1.7E+02 0.0042 13.1 2.7 29 1-29 2-30 (204) 10 pfam01726 LexA_DNA_bind LexA D 9.2 1.8E+02 0.0045 13.0 2.6 29 1-29 4-32 (65) No 1 >pfam03258 Baculo_FP Baculovirus FP protein. The FP protein is missing in baculovirus (Few Polyhedra) mutants. Probab=41.19 E-value=22 Score=17.73 Aligned_cols=47 Identities=36% Similarity=0.665 Sum_probs=34.5 Q ss_pred CHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCHHHHCCCCCCCCCCCCCCEEEEEECCC Q ss_conf 4057888898888888752267877543101554042227551139631388885135 Q gi|254780657|r 2 TPREHKNLIRKKKMIARNLLSPAYRHMKSISLADLGAKKIPLEKKKPKSQLFILCNRK 59 (61) Q Consensus 2 tprehknlirkkkmiarnllspayrhmksisladlgakkiplekkkpksqlfilcnrk 59 (61) .|.|||-|..| +|+.|-|.| |-||+..-|. .-.+..+|+.||+-|.. T Consensus 133 A~~e~K~LLkk----~RdaLLp~y---KYislcK~GV----MvR~~~~S~i~ivkne~ 179 (214) T pfam03258 133 ASPEHKQLLKK----TRDALLPHY---KYVSLCKNGV----MVRRNEKSKIYIVKNEN 179 (214) T ss_pred CCHHHHHHHHH----HHHHHCCCC---EEEEEECCCE----EEEECCCCEEEEEECHH T ss_conf 78889999999----887417645---2788704736----88606763289982630 No 2 >COG0212 5-formyltetrahydrofolate cyclo-ligase [Coenzyme metabolism] Probab=21.44 E-value=79 Score=14.83 Aligned_cols=40 Identities=33% Similarity=0.305 Sum_probs=33.2 Q ss_pred HHHHHHHHHHHHHHHHHCCHHHHHHHHCCHHHHCCCCCCC Q ss_conf 5788889888888875226787754310155404222755 Q gi|254780657|r 4 REHKNLIRKKKMIARNLLSPAYRHMKSISLADLGAKKIPL 43 (61) Q Consensus 4 rehknlirkkkmiarnllspayrhmksisladlgakkipl 43 (61) .+-|+.+|+...-.|..+|+..+|-.+..++.+-+.-+.. T Consensus 2 ~~~K~~lR~~~~~~r~~l~~~~~~~~~~~i~~~~~~~~~~ 41 (191) T COG0212 2 MATKSALRKLLLERRIALSPEERHEADQRIAKLLASLIEV 41 (191) T ss_pred CHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCC T ss_conf 0369999999999988579466777619999999855111 No 3 >TIGR02902 spore_lonB ATP-dependent protease LonB; InterPro: IPR014251 This entry represents LonB, a paralog of the ATP-dependent protease La (LonA, IPR004815 from INTERPRO). LonB proteins are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ) and are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore during sporulation, under control of sigmaF . The lonB gene, despite being located immediately upstream of lonA, was shown to be monocistronic. LonB appears to be involved in the post-translation control of sigmaH, but lonB mutation did not produce an obvious sporulation defect under the conditions tested . Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and these are excluded from this entry. . Probab=20.11 E-value=36 Score=16.64 Aligned_cols=22 Identities=45% Similarity=0.696 Sum_probs=16.1 Q ss_pred HHHHHHHCCHHHHCCCCCCC-CCCCCCCE Q ss_conf 87754310155404222755-11396313 Q gi|254780657|r 24 AYRHMKSISLADLGAKKIPL-EKKKPKSQ 51 (61) Q Consensus 24 ayrhmksisladlgakkipl-ekkkpksq 51 (61) --|||.+|+|. .|| ||-.|+|- T Consensus 42 kLn~mR~I~Lt------~PL~Ek~RP~SF 64 (532) T TIGR02902 42 KLNKMRAIRLT------EPLSEKTRPKSF 64 (532) T ss_pred HHHCCCEEECC------CCCCCCCCCCCC T ss_conf 76111434167------887746677763 No 4 >KOG3277 consensus Probab=13.34 E-value=1.1e+02 Score=14.04 Aligned_cols=42 Identities=26% Similarity=0.200 Sum_probs=32.7 Q ss_pred HHHHHCCHHHHHHHHCCHHHHCCCCCCC---CCCCCCCEEEEEEC Q ss_conf 8875226787754310155404222755---11396313888851 Q gi|254780657|r 16 IARNLLSPAYRHMKSISLADLGAKKIPL---EKKKPKSQLFILCN 57 (61) Q Consensus 16 iarnllspayrhmksisladlgakkipl---ekkkpksqlfilcn 57 (61) ..||.-++++..|.|-|++.-+....++ ...+|+-||-.-|+ T Consensus 39 l~r~r~a~~~~~s~s~se~~~~~s~t~l~~~~~~kp~m~l~yTCk 83 (165) T KOG3277 39 LFRNRPAALGTGSRSPSEAAKTDSATVLTFFKVPKPRMQLAYTCK 83 (165) T ss_pred HHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEE T ss_conf 650361212367546444578875441300157776148999852 No 5 >pfam01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family. 5-formyltetrahydrofolate cyclo-ligase or methenyl-THF synthetase EC:6.3.3.2 catalyses the interchange of 5-formyltetrahydrofolate (5-FTHF) to 5-10-methenyltetrahydrofolate, this requires ATP and Mg2+. 5-FTHF is used in chemotherapy where it is clinically known as Leucovorin. Probab=13.00 E-value=1.3e+02 Score=13.68 Aligned_cols=30 Identities=30% Similarity=0.283 Sum_probs=23.5 Q ss_pred HHHHHHHHHHHHHHCCHHHHHHHHCCHHHH Q ss_conf 888988888887522678775431015540 Q gi|254780657|r 7 KNLIRKKKMIARNLLSPAYRHMKSISLADL 36 (61) Q Consensus 7 knlirkkkmiarnllspayrhmksisladl 36 (61) |+-+|++-.-.|+.+|+..+...|..++.. T Consensus 1 K~~LR~~~~~~R~~l~~~~~~~~s~~I~~~ 30 (182) T pfam01812 1 KQELRKQLLAKRRALSEEERAAASRALHQK 30 (182) T ss_pred CHHHHHHHHHHHHCCCHHHHHHHHHHHHHH T ss_conf 989999999999739999999999999999 No 6 >KOG3124 consensus Probab=11.70 E-value=1e+02 Score=14.22 Aligned_cols=20 Identities=40% Similarity=0.451 Sum_probs=16.4 Q ss_pred CCHHHHHHHHCCHHHHCCCC Q ss_conf 26787754310155404222 Q gi|254780657|r 21 LSPAYRHMKSISLADLGAKK 40 (61) Q Consensus 21 lspayrhmksisladlgakk 40 (61) -+|||-.+-..+|||.|-|- T Consensus 172 SgPAy~f~~ieaLadGgVkm 191 (267) T KOG3124 172 SGPAYVFVAIEALADGGVKM 191 (267) T ss_pred CCHHHHHHHHHHHHCCCCCC T ss_conf 74999999999874445003 No 7 >COG5040 BMH1 14-3-3 family protein [Signal transduction mechanisms] Probab=11.07 E-value=1e+02 Score=14.18 Aligned_cols=17 Identities=41% Similarity=0.587 Sum_probs=12.8 Q ss_pred HHHHHHHCCHHHHHHHH Q ss_conf 88887522678775431 Q gi|254780657|r 14 KMIARNLLSPAYRHMKS 30 (61) Q Consensus 14 kmiarnllspayrhmks 30 (61) ..-+|||||-||...-+ T Consensus 39 sVeeRNLlSVAYKNvig 55 (268) T COG5040 39 SVEERNLLSVAYKNVIG 55 (268) T ss_pred HHHHHHHHHHHHHHHHH T ss_conf 38888789999998766 No 8 >cd00649 catalase_peroxidase Catalase-peroxidases. This is a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Catalase-peroxidases can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. These enzymes are found in many archaeal and bacterial organisms, where they neutralize potentially lethal hydrogen peroxide molecules generated during photosynthesis or stationary phase. Along with related intracellular fungal and plant peroxidases, catalase-peroxidases belong class I of the plant peroxidase superfamily. Unlike the eukaryotic enzymes, they are typically comprised of two homologous domains that probably arose via a single gene duplication event. The heme binding motif is present only in the N-terminal domain; the function of the C-terminal domain is not clear. Probab=10.97 E-value=1.4e+02 Score=13.51 Aligned_cols=21 Identities=48% Similarity=0.572 Sum_probs=16.9 Q ss_pred HHHHHCCHHHHHH-HHCCHHHH Q ss_conf 8875226787754-31015540 Q gi|254780657|r 16 IARNLLSPAYRHM-KSISLADL 36 (61) Q Consensus 16 iarnllspayrhm-ksisladl 36 (61) .||.||-|.-... ..||-||| T Consensus 114 KARrlLwPIK~KyG~~iSwaDL 135 (405) T cd00649 114 KARRLLWPIKKKYGQKISWADL 135 (405) T ss_pred HHHHHHHHHHHHHCCCCCHHHH T ss_conf 9999764798873688779999 No 9 >PRK00215 LexA repressor; Validated Probab=9.94 E-value=1.7e+02 Score=13.11 Aligned_cols=29 Identities=24% Similarity=0.272 Sum_probs=22.6 Q ss_pred CCHHHHHHHHHHHHHHHHHHCCHHHHHHH Q ss_conf 94057888898888888752267877543 Q gi|254780657|r 1 MTPREHKNLIRKKKMIARNLLSPAYRHMK 29 (61) Q Consensus 1 mtprehknlirkkkmiarnllspayrhmk 29 (61) +|||+.+-|---+..+.+|-.+|.||.+. T Consensus 2 LT~kQ~~il~fI~~~~~~~g~~Ps~rEI~ 30 (204) T PRK00215 2 LTARQQEILDFIKDRIEETGYPPSRREIA 30 (204) T ss_pred CCHHHHHHHHHHHHHHHHHCCCCCHHHHH T ss_conf 89899999999999999748899899999 No 10 >pfam01726 LexA_DNA_bind LexA DNA binding domain. This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins. The aligned region contains a variant form of the helix-turn-helix DNA binding motif. This domain is found associated with pfam00717 the auto-proteolytic domain of LexA EC:3.4.21.88. Probab=9.24 E-value=1.8e+02 Score=12.96 Aligned_cols=29 Identities=24% Similarity=0.256 Sum_probs=23.6 Q ss_pred CCHHHHHHHHHHHHHHHHHHCCHHHHHHH Q ss_conf 94057888898888888752267877543 Q gi|254780657|r 1 MTPREHKNLIRKKKMIARNLLSPAYRHMK 29 (61) Q Consensus 1 mtprehknlirkkkmiarnllspayrhmk 29 (61) +|||..+-|---+..+..+=.+|.+|.+. T Consensus 4 LT~rQ~~il~~I~~~~~~~G~~Pt~rEI~ 32 (65) T pfam01726 4 LTERQREVLDFIKASIEETGYPPSRREIA 32 (65) T ss_pred CCHHHHHHHHHHHHHHHHHCCCCCHHHHH T ss_conf 37999999999999999828898799999 Done!