RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780657|ref|YP_003065070.1| hypothetical protein CLIBASIA_02720 [Candidatus Liberibacter asiaticus str. psy62] (61 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 30.3 bits (68), Expect = 0.11 Identities = 14/77 (18%), Positives = 25/77 (32%), Gaps = 37/77 (48%) Query: 7 KNLIRKK--KMIAR-N--LLSPAYRHMKSISL---------------------------- 33 NL +++ + + N L PA + + ISL Sbjct: 342 SNLTQEQVQDYVNKTNSHL--PAGKQV-EISLVNGAKNLVVSGPPQSLYGLNLTLRKAKA 398 Query: 34 -ADLGAKKIPLEKKKPK 49 + L +IP ++K K Sbjct: 399 PSGLDQSRIPFSERKLK 415 >2jcb_A 5-formyltetrahydrofolate cyclo-ligase family protein; 10- methenyltetrahydrofolate synthetase, MTHFS, folate metabolism, structural genomics; HET: ADP; 1.6A {Bacillus anthracis} Length = 200 Score = 26.4 bits (57), Expect = 1.7 Identities = 10/44 (22%), Positives = 17/44 (38%) Query: 4 REHKNLIRKKKMIARNLLSPAYRHMKSISLADLGAKKIPLEKKK 47 RE K +RK+ + N LS S + ++ + K Sbjct: 10 REEKLRLRKQIIEHMNSLSKERYTTLSEQIVFSLYEQKEWAEAK 53 >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding domain, 37 amino acid insertional region; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis H37RV} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Score = 24.9 bits (54), Expect = 4.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 5/32 (15%) Query: 15 MIARNLLSPAYRH-----MKSISLADLGAKKI 41 ++ +N L+P R+ + +SLAD G K++ Sbjct: 4 LVTKNSLTPDVRNGIDFKIADLSLADFGRKEL 35 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.320 0.132 0.370 Gapped Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 489,808 Number of extensions: 17521 Number of successful extensions: 55 Number of sequences better than 10.0: 1 Number of HSP's gapped: 55 Number of HSP's successfully gapped: 9 Length of query: 61 Length of database: 5,693,230 Length adjustment: 32 Effective length of query: 29 Effective length of database: 4,917,422 Effective search space: 142605238 Effective search space used: 142605238 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.6 bits)