BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780658|ref|YP_003065071.1| 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liberibacter asiaticus str. psy62] (113 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780658|ref|YP_003065071.1| 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 113 Score = 235 bits (599), Expect = 2e-64, Method: Compositional matrix adjust. Identities = 113/113 (100%), Positives = 113/113 (100%) Query: 1 MIFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIA 60 MIFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIA Sbjct: 1 MIFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIA 60 Query: 61 DIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFSTEHIEKV 113 DIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFSTEHIEKV Sbjct: 61 DIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFSTEHIEKV 113 >gi|254780268|ref|YP_003064681.1| acetyl-CoA carboxylase biotin carboxylase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 443 Score = 20.4 bits (41), Expect = 8.8, Method: Compositional matrix adjust. Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 54 YYDRAIADIRLEGKN 68 YYD IA + + GKN Sbjct: 377 YYDSLIAKLIVHGKN 391 >gi|254780954|ref|YP_003065367.1| hypothetical protein CLIBASIA_04265 [Candidatus Liberibacter asiaticus str. psy62] Length = 380 Score = 20.4 bits (41), Expect = 9.1, Method: Composition-based stats. Identities = 10/36 (27%), Positives = 17/36 (47%) Query: 34 ILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNP 69 I+ PL +KG+ I G G +D + ++ P Sbjct: 176 IISPLSIDSIKGSVIAEGTGNFDNKRSAFKITANFP 211 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.138 0.396 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,531 Number of Sequences: 1233 Number of extensions: 2669 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 113 length of database: 328,796 effective HSP length: 63 effective length of query: 50 effective length of database: 251,117 effective search space: 12555850 effective search space used: 12555850 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 33 (17.3 bits)