HHsearch alignment for GI: 254780663 and conserved domain: PRK10437

>PRK10437 carbonic anhydrase; Provisional.
Probab=100.00  E-value=0  Score=389.56  Aligned_cols=194  Identities=31%  Similarity=0.480  Sum_probs=173.0

Q ss_pred             CCHHHHHHHHHHHHHHHCCC--CHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             97469999999999970687--9889998623899759999626789988885178866248886242234577777530
Q gi|254780663|r    1 MTSFPNTLLERHREFIQDQY--DKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQH   78 (207)
Q Consensus         1 M~~~~~~Ll~~N~~f~~~~~--~~~~~~~l~~~q~P~~~vitC~DsRv~~~~i~~~~~Gd~fv~RnaGn~v~~~~~~~~~   78 (207)
T Consensus         1 M~~i-~~Ll~gn~~w~~~~~~~~p~~F~~La~GQ~P~~L~IgCsDSRV~p~~I~~~~PGelFV~RNIaNlV~~~d~----   75 (220)
T PRK10437          1 MKDI-DTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDL----   75 (220)
T ss_pred             CCHH-HHHHHHHHHHHHHHHHHCHHHHHHHHCCCCCCEEEEEECCCCCCHHHHCCCCCCCEEEEEECCCCCCCCCC----
T ss_conf             9519-99999899999998764969999862789998499973377889999738998667899633454788884----


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHH----HCCCHHHHHHHHHH
Q ss_conf             25788877672205766899981585389887530000134633101468988889999864----01632468799999
Q gi|254780663|r   79 HATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIV----ANNPTEKQTILEQL  154 (207)
Q Consensus        79 ~~~~~sle~av~~l~v~~iiV~GHt~CGav~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~l~~~  154 (207)
T Consensus        76 -~~~aaIEYAV~~L~V~~IIVcGHs~CGgv~A~l~~~-----~~~~v~~Wl~~i~~~~~~~~~~~~~~~~~~~~~~l~e~  149 (220)
T PRK10437         76 -NCLSVVQYAVDVLEVEHIIICGHYGCGGVQAAVENP-----ELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCEL  149 (220)
T ss_pred             -HHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHCCC-----CCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             -089999999997498879995587640578886398-----65547889899999999989875459989999999999


Q ss_pred             HHHHHHHHHHCCHHHHHHHHCC-CCEEEEEEEECCCCEEEEEECCCCEEEEC
Q ss_conf             9999999973097889999779-96799999988987699984688825833
Q gi|254780663|r  155 SIRNSLKNIRNFPFVNKLEKEH-MLQIHGAWFDISSGKLWILDPTSNEFTCD  205 (207)
Q Consensus       155 nV~~~v~~L~~~p~i~~~v~~g-~l~I~G~~yDi~tG~v~~l~~~~~~F~~~  205 (207)
T Consensus       150 NV~~Qv~nL~~~p~V~~a~~~G~~l~iHGw~ydi~tG~l~~L~~~~~~~e~~  201 (220)
T PRK10437        150 NVMEQVYNLGHSTIMQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETL  201 (220)
T ss_pred             HHHHHHHHHHCCHHHHHHHHCCCCCEEEEEEEECCCCCEEECCCCCCCHHHH
T ss_conf             9999999982088999999769975798899987988678668877876679