HHsearch alignment of GI: 254780663 and MMDB domain: 1ym3_A_

>1ym3_A (A:) Carbonic anhydrase (carbonate dehydratase) (carbonic dehydratase); Zn protein, structural proteomics in europe, spine; 1.75A {Mycobacterium tuberculosis H37RV} PDB: 2a5v_A
Probab=100.00  E-value=0  Score=345.86  Aligned_cols=193  Identities=28%  Similarity=0.421  Sum_probs=170.2

Q ss_pred             HHHHHHHHHHHHHHHCCC-----CHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHCCCCCCEEEEECCCCCCCCCCCCCC
Q ss_conf             469999999999970687-----988999862389975999962678998888517886624888624223457777753
Q gi|254780663|r    3 SFPNTLLERHREFIQDQY-----DKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQ   77 (207)
Q Consensus         3 ~~~~~Ll~~N~~f~~~~~-----~~~~~~~l~~~q~P~~~vitC~DsRv~~~~i~~~~~Gd~fv~RnaGn~v~~~~~~~~   77 (207)
                      +-+++|++||++|++++.     .+++|+.|++||+|+++||||||||++||.+||++|||+||+||+||+|        
T Consensus        16 ~~l~~ll~gN~~f~~~~~~~~~~~~~~~~~l~~gq~P~~~vi~CsDsRv~pe~i~~~~~GdlfvvRn~Gn~v--------   87 (215)
T 1ym3_A           16 AAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFGCADSRVAAEIIFDQGLGDMFVVRTAGHVI--------   87 (215)
T ss_dssp             HHHHHHHHHHHHHHHTCCSSGGGC----------CCCSEEEEEETTCSSCHHHHTTCCTTSEEEEEEGGGCC--------
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCCEEEEECCCCCCCHHHHCCCCCCCEEEEEECCCCC--------
T ss_conf             999999999999983975685438899987415899836999405778787773389987468983043446--------


Q ss_pred             CHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             02578887767220576689998158538988753000013463310146898888999986401632468799999999
Q gi|254780663|r   78 HHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIR  157 (207)
Q Consensus        78 ~~~~~~sle~av~~l~v~~iiV~GHt~CGav~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~nV~  157 (207)
                      +.++++|||||+.+|+|++|||||||+||||+++++..........+...+....++... .....+.+..+.++++||+
T Consensus        88 ~~~~~asieyav~~L~v~~IvV~GHt~CGav~a~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~NV~  166 (215)
T 1ym3_A           88 DSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERVAPSVL-LGRRDGLSRVDEFEQRHVH  166 (215)
T ss_dssp             CHHHHHHHHHHHHTSCCCEEEEEEESSCHHHHHHHHHHHHTSCCSTTHHHHHHHHHHHHH-HHHHTTCCSHHHHHHHHHH
T ss_pred             CHHHHEEEEEEEECCCCCEEEEECCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHH-HHHCCCHHHHHHHHHHHHH
T ss_conf             843401568864127867899976865068887651012456763226799998605555-3201432243279999999


Q ss_pred             HHHHHHHCC-HHHHHHHHCCCCEEEEEEEECCCCEEEEEECCCCEEEE
Q ss_conf             999997309-78899997799679999998898769998468882583
Q gi|254780663|r  158 NSLKNIRNF-PFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTC  204 (207)
Q Consensus       158 ~~v~~L~~~-p~i~~~v~~g~l~I~G~~yDi~tG~v~~l~~~~~~F~~  204 (207)
                      .|+++|+++ |++++++++|+|.||||+||++||+|++|+.+++.|+.
T Consensus       167 ~~v~~l~~~~~~~~~~~~~g~l~I~G~~ydi~tG~v~~l~~~~~~~~~  214 (215)
T 1ym3_A          167 ETVAILMARSSAISERIAGGSLAIVGVTYQLDDGRAVLRDHIGNIGEE  214 (215)
T ss_dssp             HHHHHHHHHCHHHHHHHHHTSCEEEEEEECTTTCCCEEEEEESCCSCC
T ss_pred             HHHHHHHHCCHHHHHHHHCCCCEEEEEEEECCCEEEEEEECCCCCCCC
T ss_conf             999999746999999998898389999998787079999889865882