RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780663|ref|YP_003065076.1| carbonate dehydratase [Candidatus Liberibacter asiaticus str. psy62] (207 letters) >gnl|CDD|48223 cd00884, beta_CA_cladeB, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.. Length = 190 Score = 237 bits (607), Expect = 1e-63 Identities = 83/191 (43%), Positives = 120/191 (62%), Gaps = 7/191 (3%) Query: 11 RHREFIQDQY--DKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANI 68 R F ++ + +++LF++LA Q PK + I+C DSRV P I +PGELFVVRNV N+ Sbjct: 1 GFRRFRKEYFPEERELFEKLAKGQSPKALFIACSDSRVVPALITQTQPGELFVVRNVGNL 60 Query: 69 VPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKW 128 VPPYEPDG H TSAAIE+AV L VEHIVV GH CGGI+A+L + FIGKW Sbjct: 61 VPPYEPDGGFHGTSAAIEYAVAVLKVEHIVVCGHSDCGGIRALLSPEDLL-DKLPFIGKW 119 Query: 129 MDIVRPIAQKIVA----NNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAW 184 + I P + ++A + ++ LE+ ++ SL+N+ +PFV + + L +HG + Sbjct: 120 LRIAEPAKEVVLAELSHADFDDQLRALEKENVLLSLENLLTYPFVRERLEAGTLSLHGWY 179 Query: 185 FDISSGKLWIL 195 +DI +G+L+ Sbjct: 180 YDIETGELYAY 190 >gnl|CDD|144177 pfam00484, Pro_CA, Carbonic anhydrase. This family includes carbonic anhydrases as well as a family of non-functional homologues related to YbcF. Length = 146 Score = 191 bits (488), Expect = 9e-50 Identities = 57/157 (36%), Positives = 90/157 (57%), Gaps = 11/157 (7%) Query: 36 IMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVE 95 ++I C DSRV PE IF PG+LFV+RN NIVPP A++E+AV+ L V+ Sbjct: 1 ALVIGCSDSRVPPELIFGLGPGDLFVIRNAGNIVPPP-----DGDVLASLEYAVEVLGVK 55 Query: 96 HIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLS 155 IVV+GH CG ++A LD I +W+ +RP +++ + ++ L + + Sbjct: 56 EIVVLGHTDCGAVKAALDDV-----ELGLIDEWLRHIRPAVEEVKSEFE-DELDALVEEN 109 Query: 156 IRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKL 192 +R ++N+R P V + + L++HGA +DI +GKL Sbjct: 110 VREQVENLRTSPLVPEAVAKGELKVHGAVYDIETGKL 146 >gnl|CDD|30636 COG0288, CynT, Carbonic anhydrase [Inorganic ion transport and metabolism]. Length = 207 Score = 172 bits (436), Expect = 9e-44 Identities = 63/210 (30%), Positives = 106/210 (50%), Gaps = 17/210 (8%) Query: 3 SFPNTLLERHREFIQDQY--DKKLFQELANQ-QKPKIMIISCCDSRVAPETIFNAKPGEL 59 S LL ++ F + ++ LF++LA++ Q PK +II+C DSRV PE I PG+L Sbjct: 2 SALKDLLAGNQRFAEGKFPEQSALFRKLADKGQSPKALIITCSDSRVPPELITGLGPGDL 61 Query: 60 FVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSST 119 FV+RN NIV + + ++E+AV L V+ I+V GH CG ++A LD Sbjct: 62 FVIRNAGNIVTHPD-----GSVLRSLEYAVYVLGVKEIIVCGHTDCGAVKAALDDQLEGL 116 Query: 120 SPGDFIGKWMDIVRPIAQKIVANNPTEKQT-----ILEQLSIRNSLKNIRNFPFV-NKLE 173 I W+ + +A + L + ++R + N+R P V + L Sbjct: 117 K---PIPGWLLHIEDLAYAVSNLLGELPGEEDRSDELVEDNVREQVANLRTHPIVQSALV 173 Query: 174 KEHMLQIHGAWFDISSGKLWILDPTSNEFT 203 + + +HG +DI +G+L+++D + +F Sbjct: 174 RGQKVAVHGWVYDIETGRLYVVDVATIDFE 203 >gnl|CDD|73199 cd00382, beta_CA, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.. Length = 119 Score = 147 bits (372), Expect = 3e-36 Identities = 56/164 (34%), Positives = 81/164 (49%), Gaps = 45/164 (27%) Query: 32 QKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQG 91 QKPK +II C DSRV PE IF PG+LFVVRN N+VPPY A++E+AV+ Sbjct: 1 QKPKALIIGCSDSRVPPELIFGLGPGDLFVVRNAGNLVPPY-----DLDVLASLEYAVEV 55 Query: 92 LNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTIL 151 L V+HI+V GH CG ++A L Sbjct: 56 LGVKHIIVCGHTDCGAVKA----------------------------------------L 75 Query: 152 EQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWIL 195 + ++R ++N+R+ P + + L++HG +DI +GKL +L Sbjct: 76 VEENVREQVENLRSHPLIQEAVAPGELKVHGWVYDIETGKLEVL 119 >gnl|CDD|48222 cd00883, beta_CA_cladeA, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.. Length = 182 Score = 134 bits (338), Expect = 2e-32 Identities = 55/178 (30%), Positives = 87/178 (48%), Gaps = 16/178 (8%) Query: 21 DKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHA 80 D F LA Q P+ + I C DSRV TI PGE+FV RN+AN+V P Sbjct: 12 DPDFFPRLAKGQTPEYLWIGCSDSRVPENTILGLLPGEVFVHRNIANLVSP-----TDLN 66 Query: 81 TSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIV 140 + +++AV L V+HI+V GH CGG++A L + W+ +R + + Sbjct: 67 CLSVLQYAVDVLKVKHIIVCGHYGCGGVKAALTGKRLG-----LLDNWLRPIRDVYRLHA 121 Query: 141 AN-----NPTEKQTILEQLSIRNSLKNIRNFPFV-NKLEKEHMLQIHGAWFDISSGKL 192 A + E+ L +L++ +KN+ P V + ++ L++HG +D+ G L Sbjct: 122 AELDALEDEEERVDRLVELNVVEQVKNLCKTPIVQDAWKRGQELEVHGWVYDLGDGLL 179 >gnl|CDD|36791 KOG1578, KOG1578, KOG1578, Predicted carbonic anhydrase involved in protection against oxidative damage [Inorganic ion transport and metabolism]. Length = 276 Score = 114 bits (286), Expect = 2e-26 Identities = 60/184 (32%), Positives = 92/184 (50%), Gaps = 8/184 (4%) Query: 24 LFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSA 83 LF LA Q P+ + + C DSRV I PGE F +RN+AN+VPP + A Sbjct: 84 LFGALAKSQSPEPLALECSDSRVCISHILVCGPGECFAIRNIANLVPPPDKSK-PTNVGA 142 Query: 84 AIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVA-- 141 A+E+AV L VE+I+V+GH CGGI+ ++ S + FI W+ I + Sbjct: 143 ALEYAVTTLKVENIIVIGHSLCGGIKGLM-SFSLEAPSRSFIENWVYIDPEAKLAVEDKL 201 Query: 142 -NNPTEKQTI-LEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSG--KLWILDP 197 +Q E + SL + ++PFV + + LQ+HG +++ S G + W LD Sbjct: 202 SQINFLQQCENCESEAFLVSLARLLSYPFVREAVVKGFLQVHGGYYNFSKGTKEFWELDE 261 Query: 198 TSNE 201 + + Sbjct: 262 KTVD 265 >gnl|CDD|73356 cd03378, beta_CA_cladeC, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.. Length = 154 Score = 100 bits (250), Expect = 4e-22 Identities = 55/190 (28%), Positives = 82/190 (43%), Gaps = 51/190 (26%) Query: 7 TLLERHREFIQDQ-----YDKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFV 61 L E ++ F+ + D +ELA QKP +I+SC DSRV PE IF+ G+LFV Sbjct: 7 RLKEGNKRFVSGKPLHPDQDLARRRELAKGQKPFAVILSCSDSRVPPEIIFDQGLGDLFV 66 Query: 62 VRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSP 121 VR NIV ++E+AV+ L V +VV+GH CG + A N Sbjct: 67 VRVAGNIVDD--------DVLGSLEYAVEVLGVPLVVVLGHESCGAVAAAAVRAN----- 113 Query: 122 GDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQIH 181 V+ K+ + +P I+ + L L+I Sbjct: 114 ----------VKATVAKLRSRSP-----IIAE------------------LVAAGKLKIV 140 Query: 182 GAWFDISSGK 191 GA++D+ +GK Sbjct: 141 GAYYDLDTGK 150 >gnl|CDD|48225 cd03379, beta_CA_cladeD, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.. Length = 142 Score = 59.9 bits (145), Expect = 5e-10 Identities = 36/162 (22%), Positives = 62/162 (38%), Gaps = 26/162 (16%) Query: 33 KPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGL 92 K+ I++C D+R+ PE K G+ V+RN V ++ +V L Sbjct: 2 ARKLAIVTCMDARLDPEKALGLKLGDAKVIRNAGGRVT--------DDAIRSLVVSVYLL 53 Query: 93 NVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTI-- 150 I+V+ H CG T + + + M + Sbjct: 54 GTREIIVIHHTDCG----------MLTFTDEELKEKMKERGIAEAYGGIDKEFWFLGFDD 103 Query: 151 LEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKL 192 LE+ S+R ++ IRN P + + +HG +D+ +GKL Sbjct: 104 LEE-SVREDVERIRNHPLI-----PDDVPVHGYVYDVKTGKL 139 >gnl|CDD|143803 pfam00012, HSP70, Hsp70 protein. Hsp70 chaperones help to fold many proteins. Hsp70 assisted folding involves repeated cycles of substrate binding and release. Hsp70 activity is ATP dependent. Hsp70 proteins are made up of two regions: the amino terminus is the ATPase domain and the carboxyl terminus is the substrate binding region. Length = 598 Score = 29.5 bits (67), Expect = 0.73 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Query: 69 VPPYEPDGQHHATSAAIEFAVQGLNVEHIV 98 VP Y D Q AT A A GLNV I+ Sbjct: 140 VPAYFNDAQRQATKDAGRIA--GLNVLRII 167 >gnl|CDD|133259 cd01850, CDC_Septin, CDC/Septin. Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells. They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis. In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments. Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities. Length = 276 Score = 28.6 bits (65), Expect = 1.3 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 5/33 (15%) Query: 14 EFIQDQYDKKLFQELANQQKPKIMIISCCDSRV 46 ++I DQ+D+ L +E ++ P+I D+RV Sbjct: 88 DYIDDQFDQYLREESRIKRNPRI-----PDTRV 115 >gnl|CDD|34166 COG4499, COG4499, Predicted membrane protein [Function unknown]. Length = 434 Score = 28.0 bits (62), Expect = 2.0 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 46 VAPETIFNAKPGELFVV-RNVANIVPPYEPD 75 +APE I F V R + N +PPYE Sbjct: 110 LAPENILFDGGLTPFFVHRGLKNSLPPYEMT 140 >gnl|CDD|35325 KOG0102, KOG0102, KOG0102, Molecular chaperones mortalin/PBP74/GRP75, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones]. Length = 640 Score = 26.8 bits (59), Expect = 4.6 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Query: 62 VRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIV 98 V+N VP Y D Q AT A + A GLNV ++ Sbjct: 160 VKNAVITVPAYFNDSQRQATKDAGQIA--GLNVLRVI 194 >gnl|CDD|39432 KOG4231, KOG4231, KOG4231, Intracellular membrane-bound Ca2+-independent phospholipase A2 [Lipid transport and metabolism]. Length = 763 Score = 26.2 bits (57), Expect = 6.2 Identities = 15/71 (21%), Positives = 27/71 (38%), Gaps = 5/71 (7%) Query: 108 IQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFP 167 V + + +S +G M +++ K PTE L I + L+ + Sbjct: 260 QHVVEKACVALSSLARDVGVTMQLMKCDLMK-----PTETVLKLSSPDIISLLQVVVTLA 314 Query: 168 FVNKLEKEHML 178 FV+ + ML Sbjct: 315 FVSDSVSQEML 325 >gnl|CDD|35958 KOG0739, KOG0739, KOG0739, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]. Length = 439 Score = 26.1 bits (57), Expect = 6.9 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 5/33 (15%) Query: 22 KKLFQELANQQKPKIMII----SCCDSRVAPET 50 K LF E+A + KP I+ I S C SR E+ Sbjct: 215 KNLF-EMARENKPSIIFIDEIDSLCGSRSENES 246 >gnl|CDD|34624 COG5019, CDC3, Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]. Length = 373 Score = 26.0 bits (57), Expect = 7.0 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 5/33 (15%) Query: 14 EFIQDQYDKKLFQELANQQKPKIMIISCCDSRV 46 ++I DQ+D+ L +E ++ PK D+RV Sbjct: 107 DYIDDQFDQYLDEEQKIKRNPKF-----KDTRV 134 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.135 0.410 Gapped Lambda K H 0.267 0.0808 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,539,325 Number of extensions: 125231 Number of successful extensions: 348 Number of sequences better than 10.0: 1 Number of HSP's gapped: 331 Number of HSP's successfully gapped: 22 Length of query: 207 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 118 Effective length of database: 4,340,536 Effective search space: 512183248 Effective search space used: 512183248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (24.8 bits)