RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780666|ref|YP_003065079.1| Fmu (Sun) domain protein [Candidatus Liberibacter asiaticus str. psy62] (445 letters) >gnl|CDD|30493 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis]. Length = 355 Score = 254 bits (650), Expect = 3e-68 Identities = 128/364 (35%), Positives = 183/364 (50%), Gaps = 32/364 (8%) Query: 98 VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISI---IPEWFKE 154 V +A VD VE AK AK VN++LRR+ R + LL+ I + PEW E Sbjct: 1 VPPHAAVDETVEAAKERLGKDRAAKFVNAVLRRLERSEEALLEEILRPAFRYSHPEWLVE 60 Query: 155 RLENFYGKERVLAISDACISPLYIDL---TVKFDIETWAHKLNAV-------MLPTGGIR 204 +L + G++ AI+ A + P L T+K D+E L + +R Sbjct: 61 KLPDALGEDEAEAIAAALLRPPPRSLRVNTLKADVEELLEALEEAGVLDEKPWVLDEVLR 120 Query: 205 LKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI---- 260 ++ I LP FAEG+ +VQD ++ +P + VLDLCAAPGGKT L Sbjct: 121 IEA-SGPIGRLPEFAEGLIYVQDEASQLPALVLDPKPGERVLDLCAAPGGKTTHLAELME 179 Query: 261 VSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF----DYCPKKLFDAVLVDAPC 316 GA V A+DVS +RL++LR NL RL + ++ DA + FD +L+DAPC Sbjct: 180 NEGAIVVAVDVSPKRLKRLRENLKRLGVRNVIVVNKDARRLAELLPGGEKFDRILLDAPC 239 Query: 317 SSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEV 376 S TG IRR PDV W R +DI + A Q+++L + +KPGG++V+S CSL +++EEV Sbjct: 240 SGTGVIRRDPDVKWRRTPEDIAELAKLQKEILAAALKLLKPGGVLVYSTCSLTPEENEEV 299 Query: 377 VQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAV 436 V++ L P EL P+ W + + R+ P G DGFF Sbjct: 300 VERFLERHPD-FELEPVRLP-WGPLFEGLGSELGKTRRLYPH--------VHGTDGFFIA 349 Query: 437 ALRR 440 LR+ Sbjct: 350 KLRK 353 >gnl|CDD|144689 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family. Length = 277 Score = 165 bits (420), Expect = 2e-41 Identities = 89/244 (36%), Positives = 129/244 (52%), Gaps = 17/244 (6%) Query: 202 GIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQ 258 + + +LP SI SLP F G VQDAS+ + + +LD+CAAPGGKT A+ Sbjct: 45 ALPVGDLPYSIGSLPPFENGAVTVQDASSQLDAIALNPQEDEFILDMCAAPGGKTTHIAE 104 Query: 259 LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAP 315 L+ + V A+D +K+RL+++ N+ RL ++ + E DA FD +L+DAP Sbjct: 105 LMKNEGTVVAVDRNKQRLKRVYANIQRLGVFNIIVQEGDARQIDQKLLGGEFDRILLDAP 164 Query: 316 CSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEE 375 CS TG IRR PD+ W R DI + A Q++LL VKPGG++V+S CS+ +++E Sbjct: 165 CSGTGVIRRDPDIKWLRREADIAQLAELQKELLKAAWDLVKPGGVLVYSTCSVLPEENEA 224 Query: 376 VVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFA 435 V++ L+ P VELVP + K RI L+ + DGFF Sbjct: 225 VIKYFLQKRPD-VELVPTGLSEGKIA---------LAKRIVKGGLQSLPH-ELNRDGFFF 273 Query: 436 VALR 439 LR Sbjct: 274 AKLR 277 Score = 34.7 bits (80), Expect = 0.053 Identities = 23/102 (22%), Positives = 40/102 (39%), Gaps = 5/102 (4%) Query: 310 VLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLD 369 +L CS GT+R++ ++ A Q + L + + P G + +S SL Sbjct: 1 ILEANNCSPPGTLRKNVLKTKRWSLLQALELAGVQLEPLGRYPHAL-PVGDLPYSIGSLP 59 Query: 370 KQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEG 411 ++ V + S + L P + +DM A P G Sbjct: 60 PFENGAVTVQDASSQLDAIALNPQEDEFI--LDMCAA--PGG 97 >gnl|CDD|36338 KOG1122, KOG1122, KOG1122, tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification]. Length = 460 Score = 137 bits (347), Expect = 5e-33 Identities = 78/246 (31%), Positives = 122/246 (49%), Gaps = 12/246 (4%) Query: 202 GIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQ 258 G+ + + I + P + G + +Q+AS+ +PV +LD+CAAPGGKT A Sbjct: 202 GLVVFDSVVPIGATPEYLAGHYMLQNASSFLPVMALDPQPGERILDMCAAPGGKTTHIAA 261 Query: 259 LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKL---FDAVLVDAP 315 L+ + + A D ++ RL+ L+ NL RL + + D ++ K+ FD VL+DAP Sbjct: 262 LMKNTGVIFANDSNENRLKSLKANLHRLGVTNTIVSNYDGREFPEKEFPGSFDRVLLDAP 321 Query: 316 CSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEE 375 CS TG I + V + DI++ A QR+LLL I VK GG++V+S CS+ +++E Sbjct: 322 CSGTGVISKDQSVKTNKTVKDILRYAHLQRELLLSAIDLVKAGGVLVYSTCSITVEENEA 381 Query: 376 VVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFA 435 VV L+ P V+LVP G + + + MDGFF Sbjct: 382 VVDYALKKRP-EVKLVPTGLDIGGE-----GRFRGGRFHPSLKLTRRFYPHVHNMDGFFV 435 Query: 436 VALRRL 441 L++ Sbjct: 436 AKLKKA 441 >gnl|CDD|37409 KOG2198, KOG2198, KOG2198, tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis]. Length = 375 Score = 112 bits (280), Expect = 3e-25 Identities = 68/190 (35%), Positives = 96/190 (50%), Gaps = 21/190 (11%) Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI------VSGAKVTALDVSKR 274 G + Q+A + +PV G VLD+CAAPGGKTAQL+ + V A DV + Sbjct: 135 GNIYRQEAVSMLPVLALGVKPGDKVLDMCAAPGGKTAQLLEALHKDPTRGYVVANDVDPK 194 Query: 275 RLEKLRCNLDRLHLYAEDIIEMDA--FDYCPKK--------LFDAVLVDAPCSSTGTIRR 324 RL L L RL + DA F K FD VLVD PCS GT+R+ Sbjct: 195 RLNMLVHQLKRLPSPNLLVTNHDASLFPNIYLKDGNDKEQLKFDRVLVDVPCSGDGTLRK 254 Query: 325 HPDVL---WTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381 +P++ W + + Q ++L +G+ +K GG +V+S CSL+ ++E VVQ+ L Sbjct: 255 NPNIWKEGWKTQRALGLHA--LQLRILRRGLRLLKVGGRLVYSTCSLNPIENEAVVQEAL 312 Query: 382 RSSPIPVELV 391 + VELV Sbjct: 313 QKVGGAVELV 322 >gnl|CDD|37571 KOG2360, KOG2360, KOG2360, Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning]. Length = 413 Score = 93.1 bits (231), Expect = 1e-19 Identities = 95/453 (20%), Positives = 173/453 (38%), Gaps = 69/453 (15%) Query: 12 SHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVL 71 + +L V +K S+ L Y S+++ A+V TL++ P +D +L+ Sbjct: 5 AEILRDVEKKEGSIK---MLVYE------SSKQNPKRTLALVCETLKYRPVLDEILED-- 53 Query: 72 ISSLPRKKYSLQQLLRVSVAQILY---------------LDVADYAVVDLAVEQAKRDKE 116 K + + V V +L + ++ L +E K+ Sbjct: 54 SELKDAKMLARLVHMVVLVHDLLLSKIKRSGLMIDKRELKVIRLRLILRLKIETVMLKKK 113 Query: 117 NRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPL 176 + V S LR + L R I+ + + + ++ E+ I++ Sbjct: 114 -----RKVKS-LRELKLTMKIPLPRYVRINTL-KGTTDEALDYLDYEKWKMITELKPDEF 166 Query: 177 YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQL 236 Y+D V+ + + IV + G + +QD ++ +P L Sbjct: 167 YVDPHVE------------------NLIIFPPSNFIVEHELYKNGKFILQDKASCLPAHL 208 Query: 237 FGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDI 293 V+D CAAPG KT+ L + + K+ A + +R LR L + + Sbjct: 209 LDPRPGSRVIDTCAAPGNKTSHLAAIMRNQGKIYAFERDAKRAATLRKLLKIAGVSIVES 268 Query: 294 IEMDAFDYCPKKLFDAV---LVDAPCSSTGTIRRHPDVLW--TRDTDDIVKSACFQRKLL 348 +E D + + F V LVD CS +G + R + T + + FQ ++L Sbjct: 269 VEGDFLNTATPEKFRDVTYILVDPSCSGSGMVSRQDEDPGAETESPERLENLQSFQIRIL 328 Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLN-SAYWKSIDMAMAL 407 ++F + V+S CSL ++++E+VVQ+VL+ +P L P W ++ Sbjct: 329 KHALTFPNLKRL-VYSTCSLHREENEQVVQEVLQQNPDAKRLAPKKVLPAWPHRGLSTFS 387 Query: 408 SPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440 E +R +P S+ GFF R Sbjct: 388 GAEHCLRASPK--------STLTIGFFVALFER 412 >gnl|CDD|144570 pfam01029, NusB, NusB family. The NusB protein is involved in the regulation of rRNA biosynthesis by transcriptional antitermination. Length = 126 Score = 76.5 bits (189), Expect = 1e-14 Identities = 38/131 (29%), Positives = 63/131 (48%), Gaps = 7/131 (5%) Query: 5 MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64 NAR ++ L V + SL LLD L +RD+ +V LR L +D Sbjct: 1 RNARELALQALYAVEERGASLNELLDKL----LEADLDERDRAFATELVYGVLRNLEELD 56 Query: 65 AVLD-FVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAK 122 A++ + L R + +LR++ ++LYL D+ + ++ AVE AK+ A Sbjct: 57 ALIAKLLENWPLERLDPVDRAILRLAAYELLYLDDIPPHVAINEAVELAKK-FGGEKSAG 115 Query: 123 LVNSILRRVSR 133 VN +LR+++R Sbjct: 116 FVNGVLRKIAR 126 >gnl|CDD|29566 cd00620, Methyltransferase_Sun, N-terminal RNA binding domain of the methyltransferase Sun. The rRNA-specific 5-methylcytidine transferase Sun, also known as RrmB or Fmu shares the RNA-binding non-catalytic domain with the transcription termination factor NusB. The precise biological role of this domain in Sun is unknown, although it is likely to be involved in sequence-specific RNA binding. The C-terminal methyltransferase domain of Sun has been shown to catalyze formation of m5C at position 967 of 16S rRNA in Escherichia coli.. Length = 126 Score = 73.0 bits (179), Expect = 1e-13 Identities = 47/131 (35%), Positives = 71/131 (54%), Gaps = 5/131 (3%) Query: 5 MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64 MNAR ++ +L V+++ SL +L S RD+ L +V TLR+L +D Sbjct: 1 MNARSTAAEVLRDVLQRGASLNAVLSALQKKD----KSDRDRGLATELVYGTLRWLALLD 56 Query: 65 AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124 +++ +L K ++ LLR+ + Q+LYLDV +A VD VE AK K+ A LV Sbjct: 57 WIINPLLKKPDVGKDPDVRNLLRLGLYQLLYLDVPPHAAVDETVEIAKIRKD-LGRAGLV 115 Query: 125 NSILRRVSREK 135 N++LRR RE Sbjct: 116 NAVLRRFERED 126 >gnl|CDD|31289 COG1092, COG1092, Predicted SAM-dependent methyltransferases [General function prediction only]. Length = 393 Score = 59.9 bits (145), Expect = 1e-09 Identities = 37/132 (28%), Positives = 58/132 (43%), Gaps = 21/132 (15%) Query: 244 SVLDLCAAPGGKTAQLIVSGAK-VTALDVSKRRLEKLRCN--LDRLHLYAEDIIEMDAFD 300 VL+L + GG + + GA VT++D+SKR LE R N L+ L I D F Sbjct: 220 RVLNLFSYTGGFSVHAALGGASEVTSVDLSKRALEWARENAELNGLDGDRHRFIVGDVFK 279 Query: 301 YCPK-----KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355 + K + FD +++D P + R ++ D + L + + Sbjct: 280 WLRKAERRGEKFDLIILDPP-----SFARSKKQEFSAQRD--------YKDLNDLALRLL 326 Query: 356 KPGGIVVFSNCS 367 PGG +V S+CS Sbjct: 327 APGGTLVTSSCS 338 >gnl|CDD|29564 cd00447, NusB_Sun, RNA binding domain of NusB (N protein-Utilization Substance B) and Sun (also known as RrmB or Fmu) proteins. This family includes two orthologous groups exemplified by the transcription termination factor NusB and the N-terminal domain of the rRNA-specific 5-methylcytidine transferase (m5C-methyltransferase) Sun. The NusB protein plays a key role in the regulation of ribosomal RNA biosynthesis in eubacteria by modulating the efficiency of transcriptional antitermination. NusB along with other Nus factors (NusA, NusE/S10 and NusG) forms the core complex with the boxA element of the nut site of the rRNA operons. These interactions help RNA polymerase to counteract polarity during transcription of rRNA operons and allow stable antitermination. The transcription antitermination system can be appropriated by some bacteriophages such as lambda, which use the system to switch between the lysogenic and lytic modes of phage propagation. The m5C-methyltransferase Sun shares the N-terminal non-catalytic RNA-binding domain with NusB.. Length = 129 Score = 47.3 bits (112), Expect = 8e-06 Identities = 31/99 (31%), Positives = 54/99 (54%), Gaps = 6/99 (6%) Query: 41 LSQRDQILVRAIVNVTLRFLPRIDAVLDFVL----ISSLPRKKYSLQQLLRVSVAQILYL 96 L+++D+ +V LR LP +D ++ +L + L + ++ +LL + Q+LY Sbjct: 33 LAKKDRPFALELVYGVLRNLPELDDIISPLLKKWLLDRLDKVDRAILRLLLYELYQLLY- 91 Query: 97 DVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREK 135 DV ++ AVE AKR + AK VN +LRR+++E Sbjct: 92 DVPPPVAINEAVELAKRFGD-DDSAKFVNGVLRRIAKES 129 >gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).. Length = 107 Score = 45.1 bits (107), Expect = 4e-05 Identities = 32/123 (26%), Positives = 49/123 (39%), Gaps = 24/123 (19%) Query: 245 VLDLCAAPGGKTAQLIVS-GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD--Y 301 VLDL G L GA+VT +D+S LE R L ++++ DA + Sbjct: 2 VLDLGCGTGALALALASGPGARVTGVDISPVALELARKAAAALLADNVEVLKGDAEELPP 61 Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361 + FD ++ D P D ++ A R+LL KPGG++ Sbjct: 62 EADESFDVIISDPPLHH-----------LVEDLARFLEEA---RRLL-------KPGGVL 100 Query: 362 VFS 364 V + Sbjct: 101 VLT 103 >gnl|CDD|31243 COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair]. Length = 347 Score = 36.5 bits (84), Expect = 0.014 Identities = 36/156 (23%), Positives = 59/156 (37%), Gaps = 19/156 (12%) Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLY 289 A V L VLD GG + + GA+V D+ +R + + NL+ + Sbjct: 186 ARAMVNLARVKRGELVLDPFCGTGGILIEAGLMGARVIGSDIDERMVRGAKINLEYYGI- 244 Query: 290 AEDIIEMDAFDYC----PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345 ED + D DA+ D P + I+ ++ ++SA Sbjct: 245 -EDYPVLKVLDATNLPLRDNSVDAIATDPPYGRSTKIKGEG---LDELYEEALESA---- 296 Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381 +KPGG +VF+ + + EE+ KVL Sbjct: 297 ------SEVLKPGGRIVFAAPRDPRHELEELGFKVL 326 >gnl|CDD|29565 cd00619, Terminator_NusB, Transcription termination factor NusB (N protein-Utilization Substance B). NusB plays a key role in the regulation of ribosomal RNA biosynthesis in eubacteria by modulating the efficiency of transcriptional antitermination. NusB along with other Nus factors (NusA, NusE/S10 and NusG) forms the core complex with the boxA element of the nut site of the rRNA operons. These interactions help RNA polymerase to counteract polarity during transcription of rRNA operons and allow stable antitermination. The transcription antitermination system can be appropriated by some bacteriophages such as lambda, which use the system to switch between the lysogenic and lytic modes of phage propagation.. Length = 130 Score = 36.4 bits (84), Expect = 0.016 Identities = 26/89 (29%), Positives = 50/89 (56%), Gaps = 5/89 (5%) Query: 50 RAIVNVTLRFLPRIDAVLDFVLIS-SLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLA 107 +V L + ID +++ L + SL R + +LR++V ++L+L DV V++ A Sbjct: 44 LKLVRGVLENIEEIDELIEKHLRNWSLDRLAIVERAILRLAVYELLFLPDVPHPVVINEA 103 Query: 108 VEQAKR-DKENRHFAKLVNSILRRVSREK 135 +E AKR ++ H K VN +L +++++ Sbjct: 104 IELAKRFGGDDSH--KFVNGVLDKIAKDL 130 >gnl|CDD|31124 COG0781, NusB, Transcription termination factor [Transcription]. Length = 151 Score = 36.1 bits (83), Expect = 0.022 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 3/91 (3%) Query: 50 RAIVNVTLRFLPRIDAVLDFVLIS-SLPRKKYSLQQLLRVSVAQILYLDVADYAVV-DLA 107 R++V L +D ++ L SL R + +LR+++ ++L+ D Y VV + A Sbjct: 59 RSLVKGVLENQEELDELISPHLKKWSLERLDLVERAILRLALYELLFRDDVPYKVVINEA 118 Query: 108 VEQAKRDKENRHFAKLVNSILRRVSREKIEL 138 +E AK+ K VN +L +++++ Sbjct: 119 IELAKKFSGEDSH-KFVNGVLDKIAKKLRPK 148 >gnl|CDD|145073 pfam01728, FtsJ, FtsJ-like methyltransferase. This family consists of FtsJ from various bacterial and archaeal sources FtsJ is a methyltransferase, but actually has no effect on cell division. FtsJ's substrate is the 23S rRNA. The 1.5 A crystal structure of FtsJ in complex with its cofactor S-adenosylmethionine revealed that FtsJ has a methyltransferase fold. This family also includes the N terminus of flaviviral NS5 protein. It has been hypothesized that the N-terminal domain of NS5 is a methyltransferase involved in viral RNA capping. Length = 176 Score = 34.9 bits (81), Expect = 0.041 Identities = 37/149 (24%), Positives = 59/149 (39%), Gaps = 31/149 (20%) Query: 241 NNLSVLDLCAAPGGKTAQLI--VSGAKVTALDV----SKRRLEKLRCNLDRLHLYAEDII 294 +VLDL AAPGG + L+ + +V A+D+ + + LR + E ++ Sbjct: 21 GGKTVLDLGAAPGGFSQVLLERGAKGRVVAVDLGPMKPIQGVTFLRGD-ITDPETLEKLL 79 Query: 295 EMDAFDYCPKKLFDAVLVD-APCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353 E+ D VL D AP S L +V +A L L+ Sbjct: 80 EL------LPGKVDLVLCDGAPNVSGLENTDSFISL------RLVLAAL---LLALE--- 121 Query: 354 FVKPGGIVVFSNCSL--DKQDSEEVVQKV 380 ++PGG V L + S E++ K+ Sbjct: 122 VLRPGGNFV---VKLFKGFEFSVELLYKL 147 >gnl|CDD|32446 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]. Length = 432 Score = 33.4 bits (76), Expect = 0.15 Identities = 20/75 (26%), Positives = 30/75 (40%), Gaps = 4/75 (5%) Query: 245 VLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPK 304 VLDL G L KV +++S +E + N + + I DA ++ P Sbjct: 297 VLDLYCGVGTFGLPLAKRVKKVHGVEISPEAVEAAQENAAANGIDNVEFIAGDAEEFTPA 356 Query: 305 ----KLFDAVLVDAP 315 D V+VD P Sbjct: 357 WWEGYKPDVVVVDPP 371 >gnl|CDD|32408 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]. Length = 238 Score = 32.6 bits (74), Expect = 0.25 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 3/82 (3%) Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRLHLYAE 291 + L G VLD+ G L V +V LD+S+ LE R L + + Sbjct: 44 ISLLGIKPGDKVLDVACGTGDMALLLAKSVGTGEVVGLDISESMLEVAREKLKKKGVQNV 103 Query: 292 DIIEMDAFDY-CPKKLFDAVLV 312 + + DA + P FDAV + Sbjct: 104 EFVVGDAENLPFPDNSFDAVTI 125 >gnl|CDD|145225 pfam01936, DUF88, Protein of unknown function DUF88. This highly conserved bacterial protein has no known function. The alignment contains many conserved aspartates, suggesting an enzymatic function such as an endonuclease or glycosyl hydrolase (Bateman A pers. obs). Length = 140 Score = 32.2 bits (74), Expect = 0.29 Identities = 30/125 (24%), Positives = 46/125 (36%), Gaps = 30/125 (24%) Query: 328 VLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV---FSNCSLDKQDSEEVVQKVLRSS 384 V D ++ A + +L+ G +V + + S K L S+ Sbjct: 4 VFI--DGENCPVPAGIDYRKVLE--EIKSGGEVVRARAYGDWSDPKLRK---FPDALSST 56 Query: 385 PIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE-----KIDG---VSSGMDGFFAV 436 IPV+ PL + ++D+ +A+ D LE D VS DG FA Sbjct: 57 GIPVQHKPLTKSGKNAVDVGLAV----------DALELAYDNNPDTFVLVSG--DGDFAP 104 Query: 437 ALRRL 441 L RL Sbjct: 105 LLERL 109 >gnl|CDD|32423 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism]. Length = 187 Score = 32.1 bits (73), Expect = 0.33 Identities = 21/91 (23%), Positives = 39/91 (42%), Gaps = 7/91 (7%) Query: 245 VLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302 + D+ A G T + ++G +V A++ + LE + N R + +++E DA + Sbjct: 38 LWDIGAGTGSITIEWALAGPSGRVIAIERDEEALELIERNAARFGVDNLEVVEGDAPEAL 97 Query: 303 PK-KLFDAVLVDAPCSSTGTIRRHPDVLWTR 332 P DA+ + G I + W R Sbjct: 98 PDLPSPDAIFI----GGGGNIEEILEAAWER 124 >gnl|CDD|35693 KOG0472, KOG0472, KOG0472, Leucine-rich repeat protein [Function unknown]. Length = 565 Score = 31.5 bits (71), Expect = 0.51 Identities = 34/131 (25%), Positives = 53/131 (40%), Gaps = 37/131 (28%) Query: 204 RLKELPESIVSLPGFAEGVWWVQDASASIPVQL---FGTLNNLSVLD-----LCAAPGG- 254 +L ELPE I SL + D S++ +L G L +L LD + + P Sbjct: 102 KLSELPEQIGSLISLVK-----LDCSSNELKELPDSIGRLLDLEDLDATNNQISSLPEDM 156 Query: 255 ----KTAQLIVSGAKVTALD---VSKRRLEKLRCN----------------LDRLHLYAE 291 K ++L + G K+ AL ++ +RL+ L CN L+ L+L Sbjct: 157 VNLSKLSKLDLEGNKLKALPENHIAMKRLKHLDCNSNLLETLPPELGGLESLELLYLRRN 216 Query: 292 DIIEMDAFDYC 302 I + F C Sbjct: 217 KIRFLPEFPGC 227 >gnl|CDD|30409 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 933 Score = 31.3 bits (71), Expect = 0.55 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Query: 130 RVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174 V + + ++L+ I ++ +P+W K R N D CIS Sbjct: 421 SVDKLRDKMLKEINKVNWVPDWGKNRFGNMVENRP-----DWCIS 460 >gnl|CDD|30641 COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis]. Length = 205 Score = 31.3 bits (71), Expect = 0.56 Identities = 33/145 (22%), Positives = 57/145 (39%), Gaps = 26/145 (17%) Query: 245 VLDLCAAPGGKT---AQLIVSGAKVTALDV----SKRRLEKLRCNLDRLHLYAEDIIEMD 297 V+DL AAPGG + A+ + +G K+ A+D+ + L+ ++ E ++E Sbjct: 49 VVDLGAAPGGWSQVAAKKLGAGGKIVAVDILPMKPIPGVIFLQGDI-TDEDTLEKLLEAL 107 Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357 D VL D P+ R D +S L + +KP Sbjct: 108 -----GGAPVDVVLSDM----------APNTSGNRSVDHA-RSMYLCELALEFALEVLKP 151 Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLR 382 GG V +D E++++ + R Sbjct: 152 GGSFVAK--VFQGEDFEDLLKALRR 174 >gnl|CDD|32757 COG2933, COG2933, Predicted SAM-dependent methyltransferase [General function prediction only]. Length = 358 Score = 31.1 bits (70), Expect = 0.66 Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALD 270 + +DL A PGG T QL+ +V A+D Sbjct: 211 PGMWAVDLGACPGGWTYQLVKRNMRVYAVD 240 >gnl|CDD|37941 KOG2730, KOG2730, KOG2730, Methylase [General function prediction only]. Length = 263 Score = 30.4 bits (68), Expect = 1.2 Identities = 18/77 (23%), Positives = 32/77 (41%), Gaps = 6/77 (7%) Query: 245 VLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNL------DRLHLYAEDIIEMDA 298 ++D GG T Q + G V A+D+ ++ R N DR+ D +++ + Sbjct: 98 IVDAFCGVGGNTIQFALQGPYVIAIDIDPVKIACARHNAEVYGVPDRITFICGDFLDLAS 157 Query: 299 FDYCPKKLFDAVLVDAP 315 K +D V + P Sbjct: 158 KLKADKIKYDCVFLSPP 174 >gnl|CDD|38127 KOG2916, KOG2916, KOG2916, Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis]. Length = 304 Score = 30.3 bits (68), Expect = 1.3 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 18/89 (20%) Query: 70 VLISSLPRKKY-SLQQLLRVSVAQIL----------YLDVADYAVVDLAVEQAKRDKENR 118 +L+S L R++ S+Q+L+RV + + Y+D++ V E ++ +E Sbjct: 46 ILLSELSRRRIRSIQKLIRVGRNEPVVVLRVDKEKGYIDLSKRRVSP---EDKEKCEERF 102 Query: 119 HFAKLVNSILRRVSR----EKIELLQRIA 143 +KLV SILR V+ E EL QRI Sbjct: 103 AKSKLVYSILRHVAEKLGYELEELYQRIG 131 >gnl|CDD|36314 KOG1098, KOG1098, KOG1098, Putative SAM-dependent rRNA methyltransferase SPB1 [RNA processing and modification, General function prediction only]. Length = 780 Score = 29.6 bits (66), Expect = 1.6 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Query: 244 SVLDLCAAPGG---KTAQLIVSGAKVTALDVSK 273 VLDLCAAPGG +Q + G+ + +D+ Sbjct: 47 VVLDLCAAPGGWLQVASQSMPVGSLIVGVDLVP 79 >gnl|CDD|32715 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis]. Length = 280 Score = 29.6 bits (66), Expect = 1.6 Identities = 30/125 (24%), Positives = 53/125 (42%), Gaps = 6/125 (4%) Query: 244 SVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301 +LDL G L G A+V A+D+S L R N +R L +++ D F+ Sbjct: 113 RILDLGTGSGAIAIALAKEGPDAEVIAVDISPDALALARENAERNGLVRVLVVQSDLFE- 171 Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC---FQRKLLLQGISFVKPG 358 + FD ++ + P P+V+ +V R++L + +KPG Sbjct: 172 PLRGKFDLIVSNPPYIPAEDPELLPEVVRYEPLLALVGGGDGLEVYRRILGEAPDILKPG 231 Query: 359 GIVVF 363 G+++ Sbjct: 232 GVLIL 236 >gnl|CDD|31264 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only]. Length = 339 Score = 29.4 bits (66), Expect = 2.1 Identities = 31/142 (21%), Positives = 51/142 (35%), Gaps = 17/142 (11%) Query: 263 GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTG 320 GA+V A+ S+ +LE + L A+ +I D K++ DA++ Sbjct: 190 GAEVIAITRSEEKLELAK------KLGADHVINSSDSDALEAVKEIADAIID---TVGPA 240 Query: 321 TIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKV 380 T+ L T +V LL + I + + + D EE + Sbjct: 241 TLEPSLKALRRGGTLVLVGLPGGGPIPLLPAFLLI-LKEISIVGSLVGTRADLEEALDFA 299 Query: 381 LRSS--PIPVELVPL---NSAY 397 P +E +PL N AY Sbjct: 300 AEGKIKPEILETIPLDEINEAY 321 >gnl|CDD|73191 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology. Cytosine-specific DNA methylases are found both in prokaryotes and eukaryotes. DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the mammalian genome. These effects include transcriptional repression via inhibition of transcription factor binding or the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability.. Length = 275 Score = 29.1 bits (65), Expect = 2.4 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 4/75 (5%) Query: 243 LSVLDLCAAPGGKTAQLIVSGAK-VTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301 L V+DL A GG L +G + V A ++ K E N L DI ++D D+ Sbjct: 1 LRVIDLFAGIGGFRLGLEKAGFEIVAANEIDKSAAETYEANF-PNKLIEGDITKIDEKDF 59 Query: 302 CPKKLFDAVLVDAPC 316 P D + PC Sbjct: 60 IPD--IDLLTGGFPC 72 >gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases. Isoleucine amino-acyl tRNA synthetases (IleRS) catalytic core domain . This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. IleRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids. Length = 338 Score = 29.1 bits (66), Expect = 2.7 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 5/45 (11%) Query: 130 RVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174 RV++ K LL+ ++ IPEW K R N+ + R D CIS Sbjct: 156 RVTKIKDRLLEANDKVNWIPEWVKNRFGNWL-ENR----RDWCIS 195 >gnl|CDD|147386 pfam05175, MTS, Methyltransferase small domain. This domain is found in ribosomal RNA small subunit methyltransferase C as well as other methyltransferases . Length = 170 Score = 29.1 bits (66), Expect = 2.8 Identities = 19/70 (27%), Positives = 28/70 (40%), Gaps = 2/70 (2%) Query: 244 SVLDLCAAPG--GKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301 VLDL G G +VT +D++ R LE R NL L ++ D + Sbjct: 34 KVLDLGCGYGVLGAALAKRSPDLEVTMVDINARALESARANLAANGLENGEVFWSDLYSA 93 Query: 302 CPKKLFDAVL 311 FD ++ Sbjct: 94 VEPGKFDLII 103 >gnl|CDD|36940 KOG1729, KOG1729, KOG1729, FYVE finger containing protein [General function prediction only]. Length = 288 Score = 28.9 bits (64), Expect = 3.3 Identities = 17/72 (23%), Positives = 23/72 (31%), Gaps = 11/72 (15%) Query: 323 RRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNC----SLDKQDSEEVVQ 378 RRH R+ DIV + C + + LL + I V C + E Sbjct: 184 RRHH----CRNCGDIVCAPCSRNRFLLP---NLSTKPIRVCDICFEELEKGARGDREDSL 236 Query: 379 KVLRSSPIPVEL 390 V P L Sbjct: 237 PVFHGKCYPNWL 248 >gnl|CDD|30771 COG0422, ThiC, Thiamine biosynthesis protein ThiC [Coenzyme metabolism]. Length = 432 Score = 28.6 bits (64), Expect = 3.4 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Query: 372 DSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVS 427 D E+ + ++R+SP+PV VP+ A + L+ + + E GV Sbjct: 103 DLHEIREWIIRNSPVPVGTVPIYQALEEVNGKVEDLTEDDFFDTVEKQAE--QGVD 156 >gnl|CDD|38290 KOG3080, KOG3080, KOG3080, Nucleolar protein-like/EBNA1-binding protein [RNA processing and modification]. Length = 328 Score = 28.5 bits (63), Expect = 3.4 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query: 109 EQAKRDKENRHFAKLV-NSILRRVSREKIELLQRI 142 E+A++ +E + F K V + L+ REK E L++I Sbjct: 200 EEARKQRELKKFGKQVQKAKLQERQREKKETLEKI 234 >gnl|CDD|143905 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V). Other tRNA synthetase sub-families are too dissimilar to be included. Length = 606 Score = 28.5 bits (64), Expect = 3.6 Identities = 19/108 (17%), Positives = 36/108 (33%), Gaps = 32/108 (29%) Query: 130 RVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS---------PLYID- 179 R+ L+ + + +P+W ++R N+ + I D CIS P + Sbjct: 387 RMKNLAEAALKAVEKVQFVPKWGEKRYGNW-----LENIQDWCISRQRWWGHPIPAWYSK 441 Query: 180 -----------------LTVKFDIETWAHKLNAVMLPTGGIRLKELPE 210 + IE W H+ +L G L++ + Sbjct: 442 DTGEVYVRGSLKELVAGREEEEGIEAWLHRDAKDLLGKGAGTLEQDED 489 >gnl|CDD|36484 KOG1270, KOG1270, KOG1270, Methyltransferases [Coenzyme transport and metabolism]. Length = 282 Score = 28.0 bits (62), Expect = 5.1 Identities = 20/82 (24%), Positives = 32/82 (39%), Gaps = 8/82 (9%) Query: 237 FGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCN------LDRLHLYA 290 L + +LD+ G + L GA+VT +D S +E + L+ Y Sbjct: 85 SKPLLGMKILDVGCGGGLLSEPLARLGAQVTGIDASDDMVEVANEHKKMDPVLEGAIAYR 144 Query: 291 EDIIEMDAFDYCPKKLFDAVLV 312 + + D K FDAV+ Sbjct: 145 LEYEDTDVEGLTGK--FDAVVC 164 >gnl|CDD|145244 pfam01964, ThiC, ThiC family. ThiC is found within the thiamine biosynthesis operon. ThiC is involved in pyrimidine biosynthesis. The precise catalytic function of ThiC is still not known. ThiC participates in the formation of 4-Amino-5-hydroxymethyl-2-methylpyrimidine from AIR, an intermediate in the de novo pyrimidine biosynthesis. Length = 421 Score = 28.2 bits (64), Expect = 5.2 Identities = 16/70 (22%), Positives = 31/70 (44%), Gaps = 17/70 (24%) Query: 372 DSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKI-----DGV 426 D +E+ + +L +SP+PV VP+ A + + ++ + D+ + I DGV Sbjct: 101 DLDEIRRAILENSPVPVGTVPIYQAAERKGGSVVDMTED-------DLFDVIEEQAKDGV 153 Query: 427 SSGMDGFFAV 436 F + Sbjct: 154 D-----FMTI 158 >gnl|CDD|32409 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]. Length = 243 Score = 27.5 bits (61), Expect = 7.3 Identities = 33/125 (26%), Positives = 48/125 (38%), Gaps = 28/125 (22%) Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLE--KLRCNLDRLHL-YAEDIIEMDAF 299 L VLD+ G + L GA VT +D S++ +E KL +++ Y + +E A Sbjct: 61 LRVLDVGCGGGILSEPLARLGASVTGIDASEKPIEVAKLHALESGVNIDYRQATVEDLAS 120 Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359 FD V C +VL + AC + VKPGG Sbjct: 121 A---GGQFDVVT----CM---------EVLEHVPDPESFLRACAKL---------VKPGG 155 Query: 360 IVVFS 364 I+ S Sbjct: 156 ILFLS 160 >gnl|CDD|173970 cd08205, RuBisCO_IV_RLP, Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV. Ribulose bisphosphate carboxylase (Rubisco) plays an important role in the Calvin reductive pentose phosphate pathway. It catalyzes the primary CO2 fixation step. Rubisco is activated by carbamylation of an active site lysine, stabilized by a divalent cation, which then catalyzes the proton abstraction from the substrate ribulose 1,5 bisphosphate (RuBP) and leads to the formation of two molecules of 3-phosphoglycerate. Members of the Rubisco family can be divided into 4 subgroups, Form I-IV, which differ in their taxonomic distribution and subunit composition. Form I-III have Rubisco activity, while Form IV, also called Rubisco-like proteins (RLP), are missing critical active site residues and therefore do not catalyze CO2 fixation. They are believed to utilize a related enzymatic mechanism, but have divergent functions, like for example 2,3-diketo-5-methylthiopentyl-1-phosphate enolase or 5-methylthio-d-ribulose 1-phosphate isomerase. Length = 367 Score = 27.1 bits (61), Expect = 8.8 Identities = 15/46 (32%), Positives = 18/46 (39%), Gaps = 15/46 (32%) Query: 139 LQRIAG--ISIIPEWFKERLENFYGK-----ERVLAISDACISPLY 177 L R+AG I P G+ E LAI+ AC PL Sbjct: 276 LMRLAGADAVIFP--------GPGGRFPFSREECLAIARACRRPLG 313 >gnl|CDD|147240 pfam04965, GPW_gp25, Gene 25-like lysozyme. This family includes the phage protein Gene 25 from T4 which is a structural component of the outer wedge of the baseplate that has acidic lysozyme activity. The family also includes relatives from bacteria that are also presumably lysozymes. Length = 98 Score = 27.2 bits (61), Expect = 8.9 Identities = 20/76 (26%), Positives = 28/76 (36%), Gaps = 14/76 (18%) Query: 7 ARLVSSHLLSCVMRKRISLTCLLDLEYG--DSAFRLLSQRD-QILVRAIVNVTLRFLPRI 63 L+++ V R +YG D F LS + RAI LRF PR+ Sbjct: 14 EDLLNTRPGERVSR----------PDYGLPDLIFEPLSPALRLAIARAIREAILRFEPRL 63 Query: 64 DAV-LDFVLISSLPRK 78 V ++ V P Sbjct: 64 RLVSVEVVPDEDDPGT 79 >gnl|CDD|32588 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]. Length = 209 Score = 27.1 bits (60), Expect = 9.8 Identities = 15/72 (20%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Query: 244 SVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD-YC 302 VL++ G + A L +V +++ + E+ R NL+ L + D + Sbjct: 75 RVLEIGTGSGYQAAVLARLVGRVVSIERIEELAEQARRNLETLGYENVTVRHGDGSKGWP 134 Query: 303 PKKLFDAVLVDA 314 + +D ++V A Sbjct: 135 EEAPYDRIIVTA 146 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.138 0.406 Gapped Lambda K H 0.267 0.0796 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 5,411,157 Number of extensions: 291317 Number of successful extensions: 803 Number of sequences better than 10.0: 1 Number of HSP's gapped: 779 Number of HSP's successfully gapped: 49 Length of query: 445 Length of database: 6,263,737 Length adjustment: 97 Effective length of query: 348 Effective length of database: 4,167,664 Effective search space: 1450347072 Effective search space used: 1450347072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 59 (26.4 bits)