BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780667|ref|YP_003065080.1| hypothetical protein CLIBASIA_02770 [Candidatus Liberibacter asiaticus str. psy62] (43 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780667|ref|YP_003065080.1| hypothetical protein CLIBASIA_02770 [Candidatus Liberibacter asiaticus str. psy62] Length = 43 Score = 92.0 bits (227), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 1 MMKGLLHADDIEFRFTAVQRLVFAFYPSAVVWEFGRILTATCQ 43 MMKGLLHADDIEFRFTAVQRLVFAFYPSAVVWEFGRILTATCQ Sbjct: 1 MMKGLLHADDIEFRFTAVQRLVFAFYPSAVVWEFGRILTATCQ 43 >gi|254780661|ref|YP_003065074.1| exonuclease I [Candidatus Liberibacter asiaticus str. psy62] Length = 471 Score = 21.2 bits (43), Expect = 4.0, Method: Composition-based stats. Identities = 6/15 (40%), Positives = 9/15 (60%) Query: 18 VQRLVFAFYPSAVVW 32 V R ++AF P + W Sbjct: 134 VMRAIYAFSPDGIQW 148 >gi|254781169|ref|YP_003065582.1| ascorbate-specific PTS system enzyme IIC/IIB [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 20.0 bits (40), Expect = 7.8, Method: Composition-based stats. Identities = 5/13 (38%), Positives = 10/13 (76%) Query: 22 VFAFYPSAVVWEF 34 ++ F P+A++W F Sbjct: 319 IYGFAPNALIWGF 331 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.336 0.142 0.458 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,784 Number of Sequences: 1233 Number of extensions: 510 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 43 length of database: 328,796 effective HSP length: 16 effective length of query: 27 effective length of database: 309,068 effective search space: 8344836 effective search space used: 8344836 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 31 (16.5 bits)