BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780668|ref|YP_003065081.1| hypothetical protein
CLIBASIA_02775 [Candidatus Liberibacter asiaticus str. psy62]
         (46 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780668|ref|YP_003065081.1| hypothetical protein CLIBASIA_02775 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040345|gb|ACT57141.1| hypothetical protein CLIBASIA_02775 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 46

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 46/46 (100%), Positives = 46/46 (100%)

Query: 1  MYNLATGADLTEKFSKGKLNVAAVKCELKAEVTVTRAAIVEAKELH 46
          MYNLATGADLTEKFSKGKLNVAAVKCELKAEVTVTRAAIVEAKELH
Sbjct: 1  MYNLATGADLTEKFSKGKLNVAAVKCELKAEVTVTRAAIVEAKELH 46


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.313    0.125    0.328 

Lambda     K      H
   0.267   0.0391    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 273,117,327
Number of Sequences: 14124377
Number of extensions: 4817998
Number of successful extensions: 7095
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 7094
Number of HSP's gapped (non-prelim): 1
length of query: 46
length of database: 4,842,793,630
effective HSP length: 20
effective length of query: 26
effective length of database: 4,560,306,090
effective search space: 118567958340
effective search space used: 118567958340
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 75 (33.6 bits)