BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780668|ref|YP_003065081.1| hypothetical protein CLIBASIA_02775 [Candidatus Liberibacter asiaticus str. psy62] (46 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780668|ref|YP_003065081.1| hypothetical protein CLIBASIA_02775 [Candidatus Liberibacter asiaticus str. psy62] Length = 46 Score = 92.0 bits (227), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 46/46 (100%), Positives = 46/46 (100%) Query: 1 MYNLATGADLTEKFSKGKLNVAAVKCELKAEVTVTRAAIVEAKELH 46 MYNLATGADLTEKFSKGKLNVAAVKCELKAEVTVTRAAIVEAKELH Sbjct: 1 MYNLATGADLTEKFSKGKLNVAAVKCELKAEVTVTRAAIVEAKELH 46 >gi|254781224|ref|YP_003065637.1| hypothetical protein CLIBASIA_05655 [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Score = 26.6 bits (57), Expect = 0.076, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 22/33 (66%) Query: 4 LATGADLTEKFSKGKLNVAAVKCELKAEVTVTR 36 LAT ADL + ++ K ++A V+ ELKA++ R Sbjct: 29 LATKADLADVRTELKQDIANVRTELKADIADVR 61 >gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Score = 21.6 bits (44), Expect = 2.7, Method: Composition-based stats. Identities = 8/13 (61%), Positives = 11/13 (84%) Query: 9 DLTEKFSKGKLNV 21 DLTEK KGK+++ Sbjct: 193 DLTEKVKKGKVDI 205 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.125 0.328 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,767 Number of Sequences: 1233 Number of extensions: 393 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 46 length of database: 328,796 effective HSP length: 19 effective length of query: 27 effective length of database: 305,369 effective search space: 8244963 effective search space used: 8244963 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)