HHsearch alignment for GI: 254780669 and conserved domain: COG2876

>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism].
Probab=100.00  E-value=0  Score=585.11  Aligned_cols=246  Identities=30%  Similarity=0.513  Sum_probs=233.7

Q ss_pred             CCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             72797699706999548634999999999999999655339970660155768866632224567124888999886652
Q gi|254780669|r   35 NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY  114 (301)
Q Consensus        35 ~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~  114 (301)
T Consensus        36 ~~~~~g~~~~~~viAGPCsvEs~E~i~~~A~~vk~~Ga~~lRGgafKP------RTSPYsFQGlg-e~gL~~l~~a~~~~  108 (286)
T COG2876          36 GDVVIGEGRALRVIAGPCSVESEEQVRETAESVKAAGAKALRGGAFKP------RTSPYSFQGLG-EEGLKLLKRAADET  108 (286)
T ss_pred             CCCEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCHHHCCCCCCCC------CCCCCCCCCCC-HHHHHHHHHHHHHC
T ss_conf             552005886138995474247799999999999873622313776788------89953336657-78899999988872


Q ss_pred             CCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             87688522889999876502157882257628999999985059779983677789999999999997258780899514
Q gi|254780669|r  115 GFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       115 glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
T Consensus       109 Gl~vvtEvm~~~~~e~~~~y~DilqvGARNMQNF~LLke~G~~~kPvLLKRg~~aTieEwL~AAEYI~s~GN~~vILCER  188 (286)
T COG2876         109 GLPVVTEVMDVRDVEAAAEYADILQVGARNMQNFALLKEVGRQNKPVLLKRGLSATIEEWLNAAEYILSHGNGNVILCER  188 (286)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             99058895489899999866169886332005169999823559976972474124999999999999679995799714


Q ss_pred             CC-CCC-CHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHC
Q ss_conf             65-444-0100000001068885-18716871177742122345321263889999999999718988999836983347
Q gi|254780669|r  195 GT-SFG-YNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA  271 (301)
Q Consensus       195 G~-~fg-y~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~A  271 (301)
T Consensus       189 GIRtfe~~TRntLDi~aV~~~kq~THLPVivDpSH~~-----------Grr~lv~pla~AA~AaGAdglmiEVHp~P~~A  257 (286)
T COG2876         189 GIRTFEKATRNTLDISAVPILKQETHLPVIVDPSHAT-----------GRRDLVEPLAKAAIAAGADGLMIEVHPDPEKA  257 (286)
T ss_pred             CCCCCCCCCCCEECHHHHHHHHHHCCCCEEECCCCCC-----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCC
T ss_conf             4334555666422368888887615787798787765-----------53135788899998616773699964795434


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             978201868899999999999999988
Q gi|254780669|r  272 PSDGPNMINIKDLPKLLSQLLAIDKII  298 (301)
Q Consensus       272 lsD~~q~l~l~~l~~ll~~l~~i~~~v  298 (301)
T Consensus       258 lsD~~Qql~~~~f~~l~~~~~~~~~~~  284 (286)
T COG2876         258 LSDAKQQLTPEEFEELVKELRALADAL  284 (286)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             576000179999999999998776540