HHsearch alignment for GI: 254780669 and conserved domain: TIGR01362

>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase; InterPro: IPR006269 These sequences describe 2-dehydro-3-deoxyphosphooctonate aldolase. Alternate names include 3-deoxy-d-manno-octulosonic acid 8-phosphate and KDO-8 phosphate synthetase. It catalyzes the aldol condensation of phosphoenolpyruvate with D-arabinose 5-phosphate. phosphoenolpyruvate + D-arabinose 5-phosphate + H_2O = 2-dehydro-3-deoxy-D-octonate 8-phosphate + phosphate In Gram-negative bacteria, this is the first step in the biosynthesis of 3-deoxy-D-manno-octulosonate, part of the oligosaccharide core of lipopolysaccharide. ; GO: 0008676 3-deoxy-8-phosphooctulonate synthase activity, 0008152 metabolic process, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=877.17  Aligned_cols=258  Identities=60%  Similarity=1.023  Sum_probs=255.5

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHH-CCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             7069995486349999999999999996553-399706601557688666322245671248889998866528768852
Q gi|254780669|r   43 QRFVLIAGPCQIESHDHAFMIAEKLYAICQS-LNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTD  121 (301)
Q Consensus        43 ~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~-~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~Te  121 (301)
T Consensus         1 ~~f~LiAGPCvIES~d~~L~~A~~l~~~~~k~~gi~fiFKsSFDKANRtS~~SfRGpGle~GL~iL~kvK~~fG~pi~TD   80 (279)
T TIGR01362         1 EKFFLIAGPCVIESEDHALRIAEKLKELTSKSLGIPFIFKSSFDKANRTSINSFRGPGLEEGLKILQKVKEEFGVPILTD   80 (279)
T ss_pred             CCCEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             98406428775356899999988877663120266745723410123211024368887899999998656528970235


Q ss_pred             CCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCC-------------CC
Q ss_conf             28899998765021578822576289999999850597799836777899999999999972587-------------80
Q gi|254780669|r  122 VHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGA-------------KD  188 (301)
Q Consensus       122 V~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn-------------~~  188 (301)
T Consensus        81 VHE~~q~~~vAeVvDilQiPAFLCRQTDLl~AaA~TG~ivNvKKGQFLsP~dM~nv~~K~~~~GnksiqsPtyetal~~~  160 (279)
T TIGR01362        81 VHESSQAEPVAEVVDILQIPAFLCRQTDLLVAAAKTGKIVNVKKGQFLSPWDMKNVVEKVLKTGNKSIQSPTYETALKKN  160 (279)
T ss_pred             CCCCHHHHHHCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHCCCC
T ss_conf             47721022004130011066132114689999982398686058863871211589999987278622475122330477


Q ss_pred             EEEEECCCCCCCHHHCCCCCCCHHHHHHC--CCEEECHHHHHHHCC-----CCCCCCCCCHHHHHHHHHHHHHHCCCEEE
Q ss_conf             89951465444010000000106888518--716871177742122-----34532126388999999999971898899
Q gi|254780669|r  189 VLFCERGTSFGYNTLVTDMRSIPIMTSMG--VPVIFDASHSVQQPG-----IHGNCSGGERQYIVPLAKAAVAIGIAGIF  261 (301)
Q Consensus       189 i~lcERG~~fgy~~lvvD~~~i~~lk~~~--~PVi~D~SHs~q~p~-----~~~~~~gG~r~~v~~la~aa~a~G~dGlf  261 (301)
T Consensus       161 v~lcERG~~FGYnnLVvDmRsL~iM~~~~kG~PVvfDaTHSvQ~PgGkkl~G~G~~SGG~refvp~LARAA~AVG~~GlF  240 (279)
T TIGR01362       161 VLLCERGTSFGYNNLVVDMRSLPIMRELGKGCPVVFDATHSVQQPGGKKLDGLGGKSGGQREFVPTLARAAVAVGIDGLF  240 (279)
T ss_pred             CEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCEECCCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             15861788888875311124558999716997368730124037687122577776798743467999988986243146


Q ss_pred             EEECCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             983698334797820186889999999999999998851
Q gi|254780669|r  262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP  300 (301)
Q Consensus       262 iE~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~vk~  300 (301)
T Consensus       241 ~EtH~DP~~A~SDGp~mlpL~~LE~Ll~~l~~i~~~~k~  279 (279)
T TIGR01362       241 IETHPDPKNAKSDGPNMLPLDELEALLEKLLKIDAVTKK  279 (279)
T ss_pred             EECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             621788777788884678988999999999999998449