Query         gi|254780669|ref|YP_003065082.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 301
No_of_seqs    160 out of 1628
Neff          5.0 
Searched_HMMs 39220
Date          Sun May 29 21:28:45 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780669.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01362 KDO8P_synth 3-deoxy- 100.0       0       0  877.2  20.2  258   43-300     1-279 (279)
  2 PRK12457 2-dehydro-3-deoxyphos 100.0       0       0  766.0  28.5  271   28-301     3-275 (281)
  3 PRK05198 2-dehydro-3-deoxyphos 100.0       0       0  767.0  26.8  264   35-298     1-264 (264)
  4 COG2877 KdsA 3-deoxy-D-manno-o 100.0       0       0  745.0  24.8  272   26-301     3-274 (279)
  5 TIGR01361 DAHP_synth_Bsub phos 100.0       0       0  695.0  20.8  255    9-293     2-261 (262)
  6 PRK13396 3-deoxy-7-phosphohept 100.0       0       0  675.5  28.2  275    1-299    64-342 (352)
  7 PRK08673 3-deoxy-7-phosphohept 100.0       0       0  665.3  26.9  269    1-299    62-333 (335)
  8 PRK13398 3-deoxy-7-phosphohept 100.0       0       0  664.0  26.7  253   23-298    11-266 (266)
  9 PRK13397 3-deoxy-7-phosphohept 100.0       0       0  635.9  22.4  240   35-293     6-249 (250)
 10 PRK12595 bifunctional 3-deoxy- 100.0       0       0  622.8  26.3  260    9-298    95-357 (360)
 11 COG2876 AroA 3-deoxy-D-arabino 100.0       0       0  585.1  22.0  246   35-298    36-284 (286)
 12 pfam00793 DAHP_synth_1 DAHP sy 100.0       0       0  556.2  19.4  247   34-287     7-258 (271)
 13 PRK12756 phospho-2-dehydro-3-d  99.8 3.3E-19 8.5E-24  147.2  17.7  251   35-299    44-346 (349)
 14 PRK12755 phospho-2-dehydro-3-d  99.8 5.5E-19 1.4E-23  145.8  18.4  251   36-299    46-347 (352)
 15 PRK12822 phospho-2-dehydro-3-d  99.8 6.1E-19 1.6E-23  145.5  18.3  246   36-292    45-341 (356)
 16 PRK09261 phospho-2-dehydro-3-d  99.8   1E-18 2.6E-23  144.0  18.8  247   36-292    45-343 (351)
 17 TIGR00034 aroFGH phospho-2-deh  99.8 1.5E-19 3.8E-24  149.5   8.2  244   35-291    42-340 (348)
 18 COG0722 AroG 3-deoxy-D-arabino  99.7 2.6E-16 6.6E-21  128.2  13.7  247   35-291    44-342 (351)
 19 TIGR03586 PseI pseudaminic aci  99.4 2.2E-10 5.6E-15   89.2  18.1  231   45-298     2-257 (327)
 20 pfam03102 NeuB NeuB family. Ne  99.4 1.4E-10 3.6E-15   90.5  17.0  176  103-298    57-236 (240)
 21 TIGR03569 NeuB_NnaB N-acetylne  99.3 5.9E-09 1.5E-13   79.8  20.6  227   50-298     8-258 (329)
 22 COG2089 SpsE Sialic acid synth  99.3 1.4E-08 3.7E-13   77.3  22.1  237   35-297     5-269 (347)
 23 pfam03599 CdhD CO dehydrogenas  96.9   0.048 1.2E-06   34.3  15.0  220   28-272     2-246 (384)
 24 cd02810 DHOD_DHPD_FMN Dihydroo  96.9   0.049 1.2E-06   34.3  14.9  101   94-194    76-198 (289)
 25 cd00423 Pterin_binding Pterin   96.8   0.056 1.4E-06   33.9  15.7  203   53-266    19-246 (258)
 26 cd00739 DHPS DHPS subgroup of   96.2    0.14 3.5E-06   31.4  15.4  204   55-267    21-246 (257)
 27 pfam01474 DAHP_synth_2 Class-I  96.0    0.11 2.8E-06   32.0   9.7  148  135-286   256-414 (437)
 28 cd04740 DHOD_1B_like Dihydroor  95.7    0.22 5.6E-06   30.0  13.6  152   37-194     7-188 (296)
 29 pfam01207 Dus Dihydrouridine s  95.5    0.22 5.5E-06   30.1   9.4   80  141-221   100-187 (309)
 30 KOG2335 consensus               95.2    0.26 6.8E-06   29.5   9.1  108  140-263   118-233 (358)
 31 PRK09427 bifunctional indole-3  95.1    0.34 8.6E-06   28.8  14.1  148  102-290   147-305 (459)
 32 COG0673 MviM Predicted dehydro  94.8    0.29 7.4E-06   29.2   8.3   82  104-191    40-123 (342)
 33 pfam01408 GFO_IDH_MocA Oxidore  94.8    0.32 8.1E-06   28.9   8.5   77  105-186    37-114 (120)
 34 PRK11613 folP dihydropteroate   94.7    0.43 1.1E-05   28.1  15.8  205   55-269    35-261 (282)
 35 KOG2741 consensus               94.7    0.12 3.2E-06   31.6   6.3   77  107-185    46-123 (351)
 36 pfam09370 TIM-br_sig_trns TIM-  94.6    0.29 7.5E-06   29.2   8.0  136   45-196    82-223 (268)
 37 PRK10415 tRNA-dihydrouridine s  94.6    0.46 1.2E-05   27.9   9.1  112  140-268   110-231 (321)
 38 COG0167 PyrD Dihydroorotate de  94.4    0.12   3E-06   31.8   5.6   97   94-193    72-194 (310)
 39 PRK08318 dihydropyrimidine deh  94.0    0.61 1.6E-05   27.1  14.9  147   36-194    10-202 (413)
 40 PRK09331 Sep-tRNA:Cys-tRNA syn  93.9    0.24 6.1E-06   29.8   6.3  181   48-267    27-220 (386)
 41 cd06452 SepCysS Sep-tRNA:Cys-t  93.6     0.5 1.3E-05   27.7   7.5  153   90-266    36-201 (361)
 42 pfam05690 ThiG Thiazole biosyn  93.2    0.18 4.6E-06   30.6   4.7  168   47-264    11-204 (246)
 43 PRK10550 tRNA-dihydrouridine s  93.2    0.69 1.8E-05   26.7   7.7   83  140-222   108-199 (312)
 44 PRK07259 dihydroorotate dehydr  93.1    0.84 2.1E-05   26.2  10.7   99   94-194    70-191 (301)
 45 pfam04481 DUF561 Protein of un  93.0    0.88 2.2E-05   26.0  11.4  200   45-299    15-238 (243)
 46 cd00331 IGPS Indole-3-glycerol  92.8    0.62 1.6E-05   27.1   7.0  170   60-272    33-214 (217)
 47 cd02801 DUS_like_FMN Dihydrour  92.5       1 2.6E-05   25.6   9.3  107  140-263   100-213 (231)
 48 PRK11815 tRNA-dihydrouridine s  92.4    0.54 1.4E-05   27.4   6.3   19  176-194   155-173 (333)
 49 PRK01033 imidazole glycerol ph  92.3     1.1 2.7E-05   25.5  10.7  169   61-263    33-226 (253)
 50 pfam00218 IGPS Indole-3-glycer  92.3    0.81 2.1E-05   26.3   7.1  171   60-272    70-251 (254)
 51 cd04728 ThiG Thiazole synthase  92.1    0.24 6.1E-06   29.8   4.2  168   47-264    12-205 (248)
 52 PRK05567 inositol-5'-monophosp  92.0     1.2   3E-05   25.2  10.1  145   94-262   161-359 (486)
 53 PRK01130 N-acetylmannosamine-6  92.0     1.2   3E-05   25.2   9.5  163   54-264    19-204 (222)
 54 cd02940 DHPD_FMN Dihydropyrimi  92.0     1.2   3E-05   25.2  11.5  153   37-194     9-202 (299)
 55 PRK00208 thiG thiazole synthas  92.0     0.2 5.2E-06   30.2   3.7  167   47-264    13-206 (256)
 56 PRK02621 consensus              92.0     1.2   3E-05   25.2  12.0  189   60-290    32-247 (254)
 57 PRK03220 consensus              91.9     1.2   3E-05   25.2  12.2  188   60-290    33-251 (257)
 58 cd02911 arch_FMN Archeal FMN-b  91.8     1.2 3.2E-05   25.0   7.9  110  130-263    93-220 (233)
 59 PRK00694 4-hydroxy-3-methylbut  91.6     1.3 3.3E-05   25.0   9.5  117   23-163    13-163 (606)
 60 PRK11840 bifunctional sulfur c  91.0    0.39 9.9E-06   28.4   4.3   99  149-264   158-280 (327)
 61 PRK00278 trpC indole-3-glycero  91.0     1.3 3.4E-05   24.9   7.0  168   60-272    72-253 (261)
 62 PRK07565 dihydroorotate dehydr  90.8     1.5 3.9E-05   24.4  10.1   98   95-194    81-199 (333)
 63 PRK11579 putative oxidoreducta  90.1     1.2   3E-05   25.2   6.1   70  113-187    47-117 (346)
 64 COG3200 AroG 3-deoxy-D-arabino  90.1     1.8 4.5E-05   24.1   8.2  129  136-268   260-399 (445)
 65 CHL00162 thiG thiamin biosynth  89.9    0.47 1.2E-05   27.8   4.0  188   24-264     4-219 (267)
 66 PRK13587 1-(5-phosphoribosyl)-  89.9     1.8 4.6E-05   24.0  12.5  141  101-263    62-221 (234)
 67 PRK13585 1-(5-phosphoribosyl)-  89.8     1.9 4.8E-05   23.9  11.5  187   60-289    33-239 (240)
 68 PRK00366 ispG 4-hydroxy-3-meth  89.8     1.9 4.8E-05   23.9  10.1  174   24-227    11-210 (367)
 69 cd02803 OYE_like_FMN_family Ol  89.7     1.9 4.7E-05   23.9   6.9   47  149-196   196-251 (327)
 70 cd04739 DHOD_like Dihydroorota  89.1     2.1 5.4E-05   23.6  10.3   99   94-194    78-197 (325)
 71 TIGR03572 WbuZ glycosyl amidat  89.0     2.1 5.4E-05   23.5  12.1  167   60-263    32-227 (232)
 72 pfam00478 IMPDH IMP dehydrogen  88.8     2.2 5.6E-05   23.4  11.4  140   96-263   158-355 (467)
 73 PRK00748 1-(5-phosphoribosyl)-  88.5     2.3 5.8E-05   23.3  12.9  168   60-263    31-221 (241)
 74 pfam04551 GcpE GcpE protein. I  88.5     2.3 5.9E-05   23.3  10.0  173   26-227     2-199 (345)
 75 PRK02747 consensus              88.4     2.3 5.9E-05   23.3  10.8  188   60-289    32-248 (257)
 76 PRK00830 consensus              88.3     2.4   6E-05   23.2   9.0  188   61-290    37-266 (273)
 77 cd04734 OYE_like_3_FMN Old yel  88.3     2.4   6E-05   23.2   6.7   64  134-197   154-253 (343)
 78 COG0821 gcpE 1-hydroxy-2-methy  88.3     2.4 6.1E-05   23.2  11.3  172   25-227     6-204 (361)
 79 PRK02083 imidazole glycerol ph  88.2     2.4 6.1E-05   23.2  10.0  189   60-290    32-246 (253)
 80 PRK13597 imidazole glycerol ph  88.1     2.5 6.3E-05   23.1  12.7  188   60-290    33-244 (252)
 81 PRK13802 bifunctional indole-3  87.8     1.1 2.8E-05   25.4   4.7   46  103-148   148-194 (695)
 82 cd04732 HisA HisA.  Phosphorib  87.4     2.7 6.9E-05   22.8  12.0  170   60-264    31-220 (234)
 83 PRK10206 putative dehydrogenas  87.2     2.8   7E-05   22.8   6.5   70  111-185    45-116 (345)
 84 cd04729 NanE N-acetylmannosami  87.0     2.8 7.2E-05   22.7   8.9  163   54-264    23-207 (219)
 85 PRK08195 4-hydroxy-2-ketovaler  87.0     2.8 7.2E-05   22.7  15.0  183   54-267    21-223 (337)
 86 cd04738 DHOD_2_like Dihydrooro  87.0     2.8 7.2E-05   22.7  10.7   99   94-193   108-237 (327)
 87 COG0042 tRNA-dihydrouridine sy  87.0     2.8 7.2E-05   22.7   9.4   81  141-222   113-203 (323)
 88 COG1456 CdhE CO dehydrogenase/  86.8     2.9 7.3E-05   22.7  17.0  186   24-226    65-279 (467)
 89 PRK13957 indole-3-glycerol-pho  86.8     1.3 3.2E-05   25.0   4.5  170   61-273    64-244 (247)
 90 pfam00977 His_biosynth Histidi  86.7     2.9 7.4E-05   22.6  12.7  168   61-263    32-220 (229)
 91 PRK01659 consensus              86.5       3 7.6E-05   22.6  10.7  145   60-222    32-202 (252)
 92 cd00377 ICL_PEPM Members of th  86.3     3.1 7.8E-05   22.5  13.4   28  243-270   160-187 (243)
 93 PRK13118 consensus              85.9     3.2 8.2E-05   22.3   7.3  218   46-294    22-263 (269)
 94 cd02929 TMADH_HD_FMN Trimethyl  85.7     3.3 8.3E-05   22.3   6.4   45  149-195   205-260 (370)
 95 TIGR00737 nifR3_yhdG putative   85.5     3.1   8E-05   22.4   6.0  138   28-198   103-273 (336)
 96 PRK08782 consensus              85.2     3.5 8.8E-05   22.1  10.9  110   53-191    24-136 (219)
 97 cd04723 HisA_HisF Phosphoribos  85.1     3.5 8.9E-05   22.1  14.7  173   49-264    29-219 (233)
 98 PRK07709 fructose-bisphosphate  84.9     3.6 9.1E-05   22.0   7.8   77  168-264   155-234 (285)
 99 PRK13122 consensus              84.7     3.6 9.3E-05   22.0   7.3  206   46-292     8-237 (242)
100 PRK04281 consensus              84.5     3.7 9.4E-05   21.9  10.4  142   60-222    32-203 (254)
101 cd05805 MPG1_transferase GTP-m  84.3     3.2 8.2E-05   22.3   5.6   11  240-250   301-311 (441)
102 COG2022 ThiG Uncharacterized e  84.2     1.1 2.9E-05   25.3   3.2  170   47-264    19-212 (262)
103 PRK13115 consensus              84.0     3.9 9.9E-05   21.8   7.1  211   46-293    29-262 (269)
104 PRK07807 inositol-5-monophosph  83.7       4  0.0001   21.7  10.0  147   95-263   162-359 (479)
105 pfam06258 DUF1022 Protein of u  83.0     4.3 0.00011   21.5  10.9  126   45-187   147-274 (308)
106 PRK02145 consensus              82.6     4.4 0.00011   21.4   9.9  186   60-290    33-250 (257)
107 PTZ00314 inosine-5'-monophosph  82.6     4.4 0.00011   21.4  10.6  145   95-263   172-370 (499)
108 TIGR01108 oadA oxaloacetate de  82.2     4.6 0.00012   21.3   9.1  149  127-296    96-272 (616)
109 PRK13134 consensus              82.1     4.6 0.00012   21.3   8.2  192   46-265    24-236 (257)
110 cd04731 HisF The cyclase subun  82.1     4.6 0.00012   21.3  13.4  188   60-289    29-241 (243)
111 PRK05211 consensus              81.7     4.7 0.00012   21.2  10.1  185   60-290    23-241 (248)
112 cd04724 Tryptophan_synthase_al  81.5     4.9 0.00012   21.2   7.5  184   56-265    12-217 (242)
113 PRK04165 acetyl-CoA decarbonyl  81.4     4.9 0.00012   21.1  16.3  227   24-272    60-309 (454)
114 pfam07745 Glyco_hydro_53 Glyco  81.2     4.9 0.00013   21.1  10.0  193   56-262    56-293 (332)
115 PRK13123 consensus              80.8     5.1 0.00013   21.0   7.1  215   46-294    20-253 (256)
116 smart00518 AP2Ec AP endonuclea  80.8     5.1 0.00013   21.0   5.8  188   91-289    33-243 (273)
117 cd00950 DHDPS Dihydrodipicolin  80.4     5.3 0.00013   20.9  10.3   89   46-165    71-161 (284)
118 PRK13119 consensus              79.8     5.5 0.00014   20.8   7.3  192   46-265    20-233 (261)
119 PRK08610 fructose-bisphosphate  79.5     5.6 0.00014   20.7   6.5   77  168-264   155-234 (286)
120 cd04730 NPD_like 2-Nitropropan  79.2     5.7 0.00015   20.7  14.3  136  101-264    39-186 (236)
121 TIGR00674 dapA dihydrodipicoli  79.1     5.8 0.00015   20.7   6.5  167   43-271    66-253 (288)
122 PRK12581 oxaloacetate decarbox  79.1     5.8 0.00015   20.7  11.8  184   53-263    30-238 (468)
123 cd02930 DCR_FMN 2,4-dienoyl-Co  78.3     6.1 0.00016   20.5   6.6   46  149-195   192-246 (353)
124 PRK13121 consensus              78.2     6.1 0.00016   20.5   7.3  217   46-293    22-261 (265)
125 PRK12737 gatY tagatose-bisphos  78.2     6.1 0.00016   20.5  10.4  192   63-282    30-257 (284)
126 cd04722 TIM_phosphate_binding   77.9     6.2 0.00016   20.4  11.0  171   58-262    12-198 (200)
127 PRK08104 consensus              77.9     6.3 0.00016   20.4  10.9  113   53-194    22-137 (212)
128 cd00947 TBP_aldolase_IIB Tagat  77.9     6.3 0.00016   20.4  10.5  174   63-264    25-227 (276)
129 TIGR01358 DAHP_synth_II 3-deox  77.9     6.3 0.00016   20.4   6.4   59  135-194   261-322 (450)
130 PRK09389 (R)-citramalate synth  77.4     6.5 0.00016   20.3   5.4   18   56-73     21-38  (487)
131 cd04733 OYE_like_2_FMN Old yel  77.3     6.5 0.00017   20.3   5.8   47  149-196   204-259 (338)
132 TIGR00513 accA acetyl-CoA carb  77.0     1.8 4.6E-05   24.0   2.2   30   90-125   140-169 (329)
133 PRK13111 trpA tryptophan synth  77.0     6.6 0.00017   20.3   7.5  217   46-293    14-252 (256)
134 cd04741 DHOD_1A_like Dihydroor  76.9     6.7 0.00017   20.2  12.1  133   43-185    10-184 (294)
135 COG0134 TrpC Indole-3-glycerol  76.7     5.3 0.00014   20.9   4.6  170   60-271    68-248 (254)
136 PRK02048 4-hydroxy-3-methylbut  76.4     6.9 0.00018   20.2   9.1  116   24-163    10-159 (613)
137 cd02932 OYE_YqiM_FMN Old yello  76.0     7.1 0.00018   20.1   5.9   44  149-192   209-261 (336)
138 PRK13114 consensus              75.9     7.1 0.00018   20.1   7.6  217   46-296    18-259 (266)
139 PRK06552 keto-hydroxyglutarate  75.9     7.1 0.00018   20.1  11.0  157   54-262    21-187 (209)
140 PRK08064 cystathionine beta-ly  75.8     5.7 0.00014   20.7   4.5   19  278-296   363-381 (390)
141 pfam04131 NanE Putative N-acet  74.8     7.6 0.00019   19.9   9.1  137  103-263    20-173 (192)
142 pfam01180 DHO_dh Dihydroorotat  74.0     7.9  0.0002   19.8  12.1  147   37-197     9-193 (290)
143 PRK11858 aksA trans-homoaconit  73.1     8.3 0.00021   19.6   6.4  175   51-260    19-217 (378)
144 cd02922 FCB2_FMN Flavocytochro  72.8     8.4 0.00022   19.6  10.3   88  149-263   203-300 (344)
145 PRK13139 consensus              72.7     8.5 0.00022   19.6   7.3  213   46-292    21-254 (254)
146 PRK06015 keto-hydroxyglutarate  72.7     8.5 0.00022   19.6  10.9  118   53-199    22-142 (212)
147 cd03084 phosphohexomutase The   72.7     8.5 0.00022   19.6   7.7   26  158-183   186-213 (355)
148 TIGR03217 4OH_2_O_val_ald 4-hy  72.7     8.5 0.00022   19.6  15.2  202   55-288    21-240 (333)
149 PRK07998 gatY putative fructos  72.6     8.5 0.00022   19.6  10.5  178   56-265    27-231 (283)
150 PRK05718 keto-hydroxyglutarate  72.4     8.6 0.00022   19.5  10.8  113   53-194    22-137 (212)
151 PRK07455 keto-hydroxyglutarate  72.0     8.8 0.00022   19.5  11.2  110   53-191    20-132 (210)
152 cd00381 IMPDH IMPDH: The catal  71.9     8.9 0.00023   19.4  10.0  135  100-262    69-225 (325)
153 cd02931 ER_like_FMN Enoate red  71.5       9 0.00023   19.4   5.7   62  134-196   163-275 (382)
154 PRK08185 hypothetical protein;  71.0     9.3 0.00024   19.3   9.5  164  101-284    54-255 (283)
155 PRK05835 fructose-bisphosphate  70.9     9.3 0.00024   19.3  10.3  194   56-265    26-257 (307)
156 pfam01070 FMN_dh FMN-dependent  70.6     9.4 0.00024   19.3   9.9  104  135-263   143-253 (301)
157 PRK13136 consensus              70.2     9.6 0.00025   19.2   7.4  192   46-265    17-228 (253)
158 pfam00809 Pterin_bind Pterin b  70.2     9.6 0.00025   19.2  11.8  164   55-226    16-203 (208)
159 PRK13138 consensus              69.3      10 0.00026   19.1   7.4  217   52-293    21-261 (264)
160 pfam00290 Trp_syntA Tryptophan  69.1      10 0.00026   19.1   7.3  217   46-292    14-254 (258)
161 PRK13113 consensus              69.1      10 0.00026   19.1   7.3  215   46-293    22-258 (263)
162 cd00452 KDPG_aldolase KDPG and  69.1      10 0.00026   19.1  10.9  109   54-191    12-123 (190)
163 pfam01081 Aldolase KDPG and KH  69.0      10 0.00026   19.0  10.9  110   53-191    15-127 (196)
164 CHL00200 trpA tryptophan synth  69.0      10 0.00026   19.0   7.3  219   46-293    20-259 (263)
165 PRK11320 prpB 2-methylisocitra  68.3      11 0.00027   18.9  13.9   51   73-124    35-87  (292)
166 cd02811 IDI-2_FMN Isopentenyl-  68.1      11 0.00027   18.9  13.5  138   43-199    53-217 (326)
167 cd06451 AGAT_like Alanine-glyo  68.0      11 0.00027   18.9   5.3   89  134-228    76-165 (356)
168 cd00952 CHBPH_aldolase Trans-o  67.5      11 0.00028   18.8   7.6   90   45-165    78-170 (309)
169 PRK12344 putative alpha-isopro  67.3      11 0.00028   18.8   6.9   19  241-259   212-230 (530)
170 PRK13132 consensus              67.2      11 0.00028   18.8   7.2  190   46-265    16-225 (246)
171 PRK06857 consensus              66.5      11 0.00029   18.7  11.1  113   53-194    19-134 (209)
172 COG5564 Predicted TIM-barrel e  66.0      12  0.0003   18.7   8.8  134   46-181    89-243 (276)
173 PRK05437 isopentenyl pyrophosp  66.0      12  0.0003   18.6   5.3  126   58-199    73-225 (351)
174 PRK13120 consensus              65.3      12 0.00031   18.6  11.1  217   46-294    26-274 (285)
175 PRK08904 consensus              64.7      12 0.00031   18.5  11.0  110   53-191    17-129 (207)
176 KOG0069 consensus               64.7      12 0.00031   18.5   5.5   85   94-180   166-269 (336)
177 pfam00701 DHDPS Dihydrodipicol  64.6      12 0.00032   18.5   7.6   90   45-165    71-162 (289)
178 PRK13135 consensus              64.6      12 0.00032   18.5   7.3  217   46-292    22-259 (267)
179 cd03332 LMO_FMN L-Lactate 2-mo  64.5      12 0.00032   18.5   9.9   43   92-134    92-134 (383)
180 PRK03170 dihydrodipicolinate s  64.4      12 0.00032   18.5  10.0   91   45-166    71-163 (292)
181 pfam00682 HMGL-like HMGL-like.  64.4      12 0.00032   18.5  12.5  118  149-289   112-234 (237)
182 PRK12331 oxaloacetate decarbox  64.3      13 0.00032   18.4  12.4  185   55-264    23-230 (463)
183 TIGR02153 gatD_arch glutamyl-t  64.1      13 0.00032   18.4   4.6   88  167-266   121-215 (413)
184 pfam02879 PGM_PMM_II Phosphogl  64.0      13 0.00032   18.4   5.5   75  200-291     3-78  (103)
185 cd06346 PBP1_ABC_ligand_bindin  63.3      13 0.00033   18.3  11.8   76  176-266   127-202 (312)
186 PRK07084 fructose-bisphosphate  62.8      13 0.00034   18.3   8.2  115  166-284   161-295 (321)
187 PRK13137 consensus              62.4      14 0.00035   18.2   8.1  192   46-265    30-242 (266)
188 PRK13112 consensus              62.2      14 0.00035   18.2   6.9  220   46-293    23-268 (279)
189 PRK09140 2-dehydro-3-deoxy-6-p  62.2      14 0.00035   18.2  10.4  135   54-228    18-160 (206)
190 cd06343 PBP1_ABC_ligand_bindin  61.3      14 0.00036   18.1  11.3   11   49-59     16-26  (362)
191 PRK13753 dihydropteroate synth  60.4      15 0.00037   18.0  14.7  202   55-269    22-252 (279)
192 PRK13129 consensus              60.4      15 0.00038   18.0   7.3  219   46-293    24-263 (267)
193 TIGR01768 GGGP-family geranylg  60.3      11 0.00027   18.9   3.2  165   51-259     8-194 (242)
194 PRK09196 fructose-1,6-bisphosp  59.9      15 0.00038   17.9   7.9  159   99-264    58-278 (347)
195 PRK12999 pyruvate carboxylase;  59.6      15 0.00039   17.9   9.0   22   51-72     58-79  (1147)
196 COG0502 BioB Biotin synthase a  59.0      16  0.0004   17.8   4.4  179   55-264    84-295 (335)
197 KOG1357 consensus               58.2     6.5 0.00017   20.3   1.9  108  187-295   276-395 (519)
198 PRK10329 glutaredoxin-like pro  57.9     6.9 0.00018   20.2   2.0   58  191-257    21-81  (81)
199 cd05800 PGM_like2 This PGM-lik  57.9      16 0.00041   17.7   8.3   23  161-183   250-273 (461)
200 PRK13124 consensus              57.2      17 0.00042   17.6   9.0  217   47-293    15-252 (257)
201 PRK00915 2-isopropylmalate syn  56.9      17 0.00043   17.6  12.0   23   51-73     19-41  (511)
202 PRK13133 consensus              56.1      17 0.00044   17.5   8.5  189   46-265    20-241 (267)
203 PRK05286 dihydroorotate dehydr  55.9      17 0.00044   17.5   8.4  100   93-193   113-243 (336)
204 PRK07050 cystathionine beta-ly  55.9      17 0.00044   17.5   4.5   37  104-140   118-156 (394)
205 PRK13399 fructose-1,6-bisphosp  55.7      18 0.00045   17.5   8.9  178   99-283    58-303 (347)
206 PRK13131 consensus              55.7      18 0.00045   17.5   7.3  193   46-265    16-229 (257)
207 COG0106 HisA Phosphoribosylfor  55.5      18 0.00045   17.5  11.9  166   60-263    33-221 (241)
208 PRK06460 hypothetical protein;  55.2      18 0.00046   17.4   5.6   63  103-165    97-167 (375)
209 TIGR00292 TIGR00292 thiazole b  55.2      18 0.00046   17.4   6.7   82  175-270    34-137 (283)
210 TIGR03470 HpnH hopanoid biosyn  55.1      18 0.00046   17.4  12.1  161   96-294    57-228 (318)
211 COG3964 Predicted amidohydrola  55.1      18 0.00046   17.4   5.5  139  129-295   145-299 (386)
212 TIGR01037 pyrD_sub1_fam dihydr  54.0      17 0.00042   17.6   3.4  152   95-256    70-268 (308)
213 pfam04441 Pox_VERT_large Poxvi  53.9      13 0.00034   18.3   2.9   75  141-226   363-447 (700)
214 PRK13523 NADPH dehydrogenase N  53.8      19 0.00048   17.3   6.3   96  149-254   197-310 (337)
215 PRK05586 biotin carboxylase; V  53.8      19 0.00048   17.3   6.6  128   45-196    48-203 (447)
216 cd00615 Orn_deC_like Ornithine  53.6     4.1 0.00011   21.6   0.3   80  169-266   140-220 (294)
217 PRK12738 kbaY tagatose-bisphos  53.6      19 0.00048   17.3  10.3  175   63-265    30-234 (286)
218 PRK06801 hypothetical protein;  53.4      19 0.00049   17.2  10.2  173   64-264    31-234 (286)
219 PRK07178 acetyl-CoA carboxylas  53.3      19 0.00049   17.2   5.7  124   50-194    52-200 (471)
220 TIGR01404 FlhB_rel_III type II  53.0      14 0.00037   18.0   3.0   52   73-129   268-319 (346)
221 cd00453 FTBP_aldolase_II Fruct  52.9      19  0.0005   17.2   8.0  152   98-265    68-274 (340)
222 pfam01116 F_bP_aldolase Fructo  52.9      19  0.0005   17.2  10.8  175   62-264    27-232 (283)
223 PRK06256 biotin synthase; Vali  52.8      19  0.0005   17.2   8.7  179   56-264    91-300 (325)
224 KOG2965 consensus               52.2      17 0.00043   17.6   3.2   27  123-149   117-143 (318)
225 PRK07582 cystathionine gamma-l  52.0      20 0.00051   17.1   5.7   45  185-231   134-182 (370)
226 COG0329 DapA Dihydrodipicolina  52.0      20 0.00051   17.1   8.0   91   45-166    74-166 (299)
227 PRK05096 guanosine 5'-monophos  51.5      20 0.00052   17.0   9.0  103  135-263   123-242 (347)
228 pfam02056 Glyco_hydro_4 Family  51.1      20  0.0005   17.2   3.4   84  107-192    48-141 (183)
229 TIGR00977 LeuA_rel 2-isopropyl  50.1      21 0.00055   16.9   6.0  164   58-293    23-194 (543)
230 PRK06806 fructose-bisphosphate  50.0      22 0.00055   16.9  10.6  173   64-264    31-231 (281)
231 cd06268 PBP1_ABC_transporter_L  49.7      22 0.00056   16.9  11.5  138   47-199     7-148 (298)
232 PRK11197 lldD L-lactate dehydr  49.7      22 0.00056   16.9  10.8   68   91-158    76-148 (381)
233 TIGR03301 PhnW-AepZ 2-aminoeth  49.0      22 0.00057   16.8   5.3   89  134-228    76-166 (355)
234 PRK08247 cystathionine gamma-s  48.8      22 0.00057   16.8   4.4   37  104-140   104-142 (366)
235 COG0399 WecE Predicted pyridox  48.8      22 0.00057   16.8   3.5   24  205-228   136-160 (374)
236 cd04737 LOX_like_FMN L-Lactate  48.5      23 0.00058   16.7  10.0   81  157-262   220-304 (351)
237 pfam02548 Pantoate_transf Keto  48.4      23 0.00058   16.7  12.4  157  104-268     5-187 (261)
238 PRK13586 1-(5-phosphoribosyl)-  48.4      23 0.00058   16.7  13.6  167   60-263    31-217 (231)
239 pfam01053 Cys_Met_Meta_PP Cys/  48.2      16 0.00041   17.7   2.6   14  279-292   364-377 (381)
240 PRK13117 consensus              47.4      24  0.0006   16.6   7.4  217   46-292    22-263 (268)
241 cd01568 QPRTase_NadC Quinolina  47.3      24  0.0006   16.6   8.1   88  105-228   169-261 (269)
242 cd01494 AAT_I Aspartate aminot  47.2      24 0.00061   16.6   4.4   49  178-228    84-133 (170)
243 PRK08574 cystathionine gamma-s  47.1      24 0.00061   16.6   8.7   39  185-225   136-175 (384)
244 cd04158 ARD1 ARD1 subfamily.    46.8      24 0.00062   16.6   4.4   18  114-131    68-85  (169)
245 PRK12857 putative aldolase; Re  46.7      24 0.00062   16.6   9.9  174   63-264    30-233 (284)
246 COG0439 AccC Biotin carboxylas  46.4      24 0.00062   16.5   5.6  130   45-194    48-201 (449)
247 cd00954 NAL N-Acetylneuraminic  46.2      25 0.00063   16.5   7.7   47  252-298   195-244 (288)
248 PRK07049 methionine gamma-lyas  46.1      25 0.00063   16.5   6.7   29  103-131   135-165 (427)
249 PRK09197 fructose-bisphosphate  45.7      24 0.00061   16.6   3.1   33  167-199   186-218 (349)
250 PRK00043 thiE thiamine-phospha  45.7      25 0.00064   16.5   6.8  178   45-271     9-198 (210)
251 PRK08045 cystathionine gamma-s  45.7      25 0.00064   16.5   4.9   37  104-140   105-143 (386)
252 TIGR03249 KdgD 5-dehydro-4-deo  45.5      25 0.00064   16.5   7.6  111   45-192    75-186 (296)
253 PRK08249 cystathionine gamma-s  45.4      25 0.00065   16.4   6.5   63  103-165   116-186 (398)
254 TIGR01369 CPSaseII_lrg carbamo  45.3      25 0.00065   16.4   5.0  116  121-256   639-760 (1089)
255 pfam07075 DUF1343 Protein of u  45.1     9.4 0.00024   19.3   1.0  106   47-166     3-120 (359)
256 PRK01395 V-type ATP synthase s  45.0      13 0.00034   18.3   1.7   54   89-142    12-79  (104)
257 PRK13127 consensus              44.6      26 0.00066   16.4   7.4  219   46-293    16-256 (262)
258 TIGR00742 yjbN TIM-barrel prot  44.4      26 0.00067   16.3   3.6  123   53-186   143-274 (326)
259 pfam05636 DUF795 Protein of un  44.4      18 0.00046   17.4   2.4   32  102-134    85-116 (389)
260 PRK13670 hypothetical protein;  44.3      19 0.00048   17.3   2.4   31  102-133    85-115 (390)
261 PRK07360 FO synthase subunit 2  44.2      26 0.00067   16.3   3.6  223   48-291    80-357 (375)
262 COG0191 Fba Fructose/tagatose   43.4      27 0.00069   16.2   8.1  145  100-264    60-235 (286)
263 pfam01946 Thi4 Thi4 family. Th  43.3      27 0.00069   16.2   6.4   12   61-72     30-41  (229)
264 PRK06512 thiamine-phosphate py  43.1      27  0.0007   16.2   5.8  183   43-273    13-206 (221)
265 PRK00719 alkanesulfonate monoo  42.9      22 0.00055   16.9   2.5   48  232-279   297-344 (377)
266 PRK05968 hypothetical protein;  42.9      26 0.00066   16.4   3.0   37  104-140   116-153 (389)
267 TIGR02549 CRISPR_DxTHG CRISPR-  42.7      11 0.00029   18.7   1.1   19  220-252     2-20  (21)
268 pfam01729 QRPTase_C Quinolinat  42.6      28 0.00071   16.2   8.0  114   75-228    45-161 (169)
269 PRK08776 cystathionine gamma-s  42.6      28 0.00071   16.2   4.5   63  103-165   112-182 (405)
270 cd00564 TMP_TenI Thiamine mono  42.3      28 0.00072   16.1   5.9  136  104-271    45-190 (196)
271 cd04736 MDH_FMN Mandelate dehy  42.1      28 0.00072   16.1   9.2   33  157-195   235-267 (361)
272 PRK03620 5-dehydro-4-deoxygluc  42.0      28 0.00073   16.1   7.7  111   45-192    71-182 (296)
273 PRK07671 cystathionine beta-ly  41.6      29 0.00074   16.1   6.7   62  103-164   101-170 (377)
274 PRK09195 gatY tagatose-bisphos  41.6      29 0.00074   16.1  10.7  174   63-264    30-233 (284)
275 cd00616 AHBA_syn 3-amino-5-hyd  41.5      29 0.00074   16.1   6.7  114  103-228    20-144 (352)
276 pfam02679 ComA (2R)-phospho-3-  41.1      29 0.00075   16.0   9.4   28  167-194   143-170 (245)
277 PRK06939 2-amino-3-ketobutyrat  41.1      29 0.00075   16.0   4.4  123  108-235    94-222 (395)
278 TIGR02707 butyr_kinase butyrat  41.0      14 0.00035   18.2   1.3  129   62-209    51-201 (353)
279 PRK07896 nicotinate-nucleotide  40.9      30 0.00075   16.0   9.1   88  106-228   188-279 (288)
280 COG2513 PrpB PEP phosphonomuta  40.8      30 0.00076   16.0   9.3   24  100-123    63-86  (289)
281 PRK08134 O-acetylhomoserine am  40.4      30 0.00077   15.9   3.1   68  103-171   116-191 (433)
282 PRK00230 orotidine 5'-phosphat  40.2      30 0.00077   15.9   9.8   52   52-122     9-60  (231)
283 TIGR01496 DHPS dihydropteroate  40.0      31 0.00078   15.9  14.2  215   26-266     4-254 (268)
284 cd06326 PBP1_STKc_like Type I   40.0      31 0.00078   15.9  13.2   15  106-120   155-169 (336)
285 TIGR03012 sulf_tusD_dsrE sulfu  39.8      31 0.00079   15.9   6.7  114   45-162     4-126 (127)
286 PRK05937 8-amino-7-oxononanoat  39.3      31  0.0008   15.8   5.7  110  149-264   107-223 (370)
287 TIGR00519 asnASE_I L-asparagin  39.3      31  0.0008   15.8   3.9   29  159-191   221-249 (347)
288 COG1703 ArgK Putative periplas  39.2      31  0.0008   15.8   3.8   44   99-142   127-175 (323)
289 KOG2971 consensus               38.9      11 0.00028   18.9   0.5   36  137-173   220-255 (299)
290 cd00946 FBP_aldolase_IIA Class  38.7      19 0.00048   17.3   1.7   34  167-200   181-215 (345)
291 cd06333 PBP1_ABC-type_HAAT_lik  38.6      32 0.00082   15.8  11.7   20  175-194   122-141 (312)
292 PRK08123 histidinol-phosphatas  38.5      32 0.00082   15.8   5.3   12  210-221   232-243 (266)
293 PRK06111 acetyl-CoA carboxylas  38.5      32 0.00082   15.8   6.1  208   45-281    48-308 (449)
294 pfam01591 6PF2K 6-phosphofruct  38.4      28 0.00072   16.1   2.6   39  216-267    96-134 (223)
295 cd01572 QPRTase Quinolinate ph  38.4      32 0.00082   15.7   8.4   85  106-228   171-260 (268)
296 PRK04296 thymidine kinase; Pro  38.3      32 0.00083   15.7   6.3   45   44-93      3-47  (197)
297 COG0825 AccA Acetyl-CoA carbox  38.3      24 0.00061   16.6   2.2   26   99-125   135-160 (317)
298 cd00953 KDG_aldolase KDG (2-ke  38.0      33 0.00084   15.7   7.6   79   56-166    76-158 (279)
299 PRK04176 ribulose-1,5-biphosph  37.8      33 0.00084   15.7   6.8   19   47-72     31-49  (257)
300 PRK05724 acetyl-CoA carboxylas  37.7      22 0.00055   16.9   1.9   26   99-125   135-160 (318)
301 PRK04147 N-acetylneuraminate l  37.5      33 0.00085   15.6   7.8   24   99-122    55-80  (294)
302 cd06331 PBP1_AmiC_like Type I   37.4      33 0.00085   15.6  12.4   14  173-186   175-188 (333)
303 cd05803 PGM_like4 This PGM-lik  37.4      34 0.00085   15.6   7.0   19  240-258   307-325 (445)
304 pfam01276 OKR_DC_1 Orn/Lys/Arg  37.3      16 0.00042   17.7   1.2   48  199-259   178-226 (417)
305 COG1921 SelA Selenocysteine sy  37.3      28 0.00071   16.2   2.4   82   47-138   129-217 (395)
306 TIGR02708 L_lactate_ox L-lacta  37.1      34 0.00086   15.6   5.6   90  149-262   220-312 (368)
307 PTZ00133 ADP-ribosylation fact  36.9      34 0.00087   15.6   4.6   25  110-134    82-106 (182)
308 TIGR00514 accC acetyl-CoA carb  36.9      34 0.00087   15.6   4.2  147  101-265    12-203 (451)
309 cd04160 Arfrp1 Arfrp1 subfamil  36.9      34 0.00087   15.6   4.9   17  115-131    76-92  (167)
310 PRK06740 histidinol-phosphatas  36.8      34 0.00087   15.6   3.6   71  148-222   204-289 (338)
311 TIGR02194 GlrX_NrdH Glutaredox  36.6      14 0.00034   18.2   0.7   36  190-225    18-57  (72)
312 smart00426 TEA TEA domain.      36.2      27  0.0007   16.2   2.2   34  174-207    14-47  (68)
313 PRK06176 cystathionine gamma-s  36.2      35 0.00089   15.5   5.4   41  185-227   133-174 (379)
314 COG0325 Predicted enzyme with   36.2      35 0.00089   15.5   4.2  122  118-262    74-218 (228)
315 COG1084 Predicted GTPase [Gene  35.8      35  0.0009   15.5   8.8   97   22-133   199-303 (346)
316 cd02809 alpha_hydroxyacid_oxid  35.7      36 0.00091   15.5  11.0  185   39-263    59-256 (299)
317 PRK07811 cystathionine gamma-s  35.7      32 0.00082   15.7   2.5   39  185-225   142-181 (386)
318 cd00614 CGS_like CGS_like: Cys  35.5      36 0.00091   15.4   2.8   63  103-165    92-162 (369)
319 PRK12319 acetyl-CoA carboxylas  35.4      24  0.0006   16.6   1.8   26   99-125    83-108 (256)
320 cd03284 ABC_MutS1 MutS1 homolo  34.9      35 0.00089   15.5   2.6   32   34-65     21-52  (216)
321 pfam00448 SRP54 SRP54-type pro  34.6      37 0.00094   15.4  11.5  156   45-224     3-174 (196)
322 cd03115 SRP The signal recogni  34.5      37 0.00095   15.3  10.0  153   45-222     2-171 (173)
323 cd03280 ABC_MutS2 MutS2 homolo  34.3      35  0.0009   15.5   2.5   35   34-68     19-53  (200)
324 PRK09248 putative hydrolase; V  34.1      36 0.00091   15.4   2.5   31  213-251   181-212 (246)
325 PRK12833 acetyl-CoA carboxylas  33.9      38 0.00097   15.3  10.1   74   46-120    52-135 (458)
326 pfam03308 ArgK ArgK protein. T  33.9      38 0.00097   15.3   3.7   28   47-74     33-60  (267)
327 PRK05265 pyridoxine 5'-phospha  33.7      32 0.00081   15.8   2.2  111   87-216    95-211 (240)
328 PRK08133 O-succinylhomoserine   33.6      38 0.00098   15.2   2.6   62  103-164   113-182 (391)
329 PRK07503 methionine gamma-lyas  33.4      36 0.00091   15.4   2.4   63  103-165   117-187 (403)
330 KOG0238 consensus               33.2      33 0.00083   15.7   2.2  187   45-259    44-266 (670)
331 PRK13116 consensus              33.1      39   0.001   15.2   7.8  220   46-298    22-273 (278)
332 PRK06767 methionine gamma-lyas  33.1      19 0.00049   17.2   1.0   55  103-157   113-174 (386)
333 cd02933 OYE_like_FMN Old yello  32.7      40   0.001   15.2   5.5   12  176-187   156-167 (338)
334 cd05802 GlmM GlmM is a bacteri  32.5      40   0.001   15.1   8.1   28  158-185   240-269 (434)
335 cd00003 PNPsynthase Pyridoxine  32.5      35 0.00088   15.6   2.2  107   89-215    94-207 (234)
336 PRK09622 porA pyruvate flavodo  32.5      40   0.001   15.1   3.7   90  149-251   284-375 (407)
337 TIGR00904 mreB cell shape dete  32.5      19 0.00048   17.3   0.9   54  172-228   261-321 (337)
338 pfam00697 PRAI N-(5'phosphorib  32.2      40   0.001   15.1   4.5   90   52-161     4-95  (195)
339 PRK05994 O-acetylhomoserine am  32.2      40   0.001   15.1   3.3   69  103-172   115-191 (426)
340 PRK02412 aroD 3-dehydroquinate  32.1      41   0.001   15.1  21.4  224   26-292     2-250 (253)
341 PRK04183 glutamyl-tRNA(Gln) am  31.6      41  0.0011   15.0   8.3   95  101-196   104-235 (421)
342 pfam10421 OAS1_C 2'-5'-oligoad  31.6      32 0.00081   15.8   1.9   39  217-261   136-174 (191)
343 TIGR01302 IMP_dehydrog inosine  31.5      42  0.0011   15.0   4.7   48   93-141   258-308 (476)
344 cd03313 enolase Enolase: Enola  30.9      42  0.0011   15.0  12.2   93  101-194   264-364 (408)
345 TIGR00078 nadC nicotinate-nucl  30.8      43  0.0011   15.0   7.4   69   99-195   171-240 (276)
346 PRK03991 threonyl-tRNA synthet  30.8      43  0.0011   15.0   5.7  154   61-226   356-535 (613)
347 cd03085 PGM1 Phosphoglucomutas  30.8      43  0.0011   14.9   3.3   25   47-71     53-77  (548)
348 PRK07504 O-succinylhomoserine   30.7      43  0.0011   14.9   2.7   63  103-165   117-187 (397)
349 cd05801 PGM_like3 This bacteri  30.7      43  0.0011   14.9   2.8   43  212-269   205-247 (522)
350 cd04155 Arl3 Arl3 subfamily.    30.6      43  0.0011   14.9   4.1   67   99-177    67-139 (173)
351 TIGR01949 AroFGH_arch predicte  30.6      43  0.0011   14.9   4.0   50  135-186   171-222 (259)
352 cd00280 TRFH Telomeric Repeat   30.6      43  0.0011   14.9   2.5   60   47-117    42-102 (200)
353 PRK02506 dihydroorotate dehydr  30.3      43  0.0011   14.9   9.0   97   94-190    70-189 (308)
354 COG1902 NemA NADH:flavin oxido  30.3      43  0.0011   14.9  11.3   48  149-196   204-262 (363)
355 TIGR02702 SufR_cyano iron-sulf  30.2      37 0.00094   15.4   2.1   29  240-268   124-152 (215)
356 smart00177 ARF ARF-like small   30.1      44  0.0011   14.9   4.6  102   46-163    16-119 (175)
357 COG5016 Pyruvate/oxaloacetate   30.0      44  0.0011   14.9   8.9  164  115-296    86-277 (472)
358 PRK07564 phosphoglucomutase; V  30.0      44  0.0011   14.9   3.2   25   47-71     82-106 (544)
359 PRK00843 egsA NAD(P)-dependent  30.0      44  0.0011   14.9   3.0   54   17-72      3-62  (351)
360 TIGR00750 lao LAO/AO transport  29.7      44  0.0011   14.8   3.7   33  232-264   112-144 (333)
361 cd05564 PTS_IIB_chitobiose_lic  29.7      44  0.0011   14.8   5.3   62  105-166    17-79  (96)
362 pfam03740 PdxJ Pyridoxal phosp  29.7      41   0.001   15.1   2.2   35  106-141   116-152 (239)
363 TIGR01859 fruc_bis_ald_ fructo  29.7      44  0.0011   14.8   7.0  111  137-296    15-132 (339)
364 PRK13209 L-xylulose 5-phosphat  29.7      44  0.0011   14.8  10.1  105  149-265   142-255 (283)
365 PRK07328 histidinol-phosphatas  29.4      45  0.0011   14.8   5.8   19  210-228   213-232 (268)
366 PRK00207 hypothetical protein;  29.4      45  0.0011   14.8   6.4  114   45-162     5-127 (128)
367 PRK13140 consensus              29.3      45  0.0011   14.8   8.2  215   46-292    19-256 (257)
368 PRK07810 O-succinylhomoserine   28.3      43  0.0011   14.9   2.1   25  105-129   127-152 (406)
369 PRK07114 keto-hydroxyglutarate  28.0      47  0.0012   14.6  10.4  127   53-216    23-153 (223)
370 cd06349 PBP1_ABC_ligand_bindin  27.9      48  0.0012   14.6  12.0   15  173-187   178-192 (340)
371 TIGR00972 3a0107s01c2 phosphat  27.8      38 0.00096   15.3   1.8   26   45-71     29-54  (248)
372 KOG0657 consensus               27.4      45  0.0012   14.8   2.1   97  112-209   149-280 (285)
373 TIGR00736 nifR3_rel_arch TIM-b  27.2      49  0.0013   14.5   5.4  109  108-222    63-198 (234)
374 COG2355 Zn-dependent dipeptida  27.1      49  0.0013   14.5  10.1   43  149-191   206-258 (313)
375 PRK12394 putative metallo-depe  27.0      49  0.0013   14.5   8.1   91  152-264   178-273 (387)
376 PRK09028 cystathionine beta-ly  26.8      47  0.0012   14.6   2.1   62  103-164   113-182 (394)
377 PRK05613 O-acetylhomoserine am  26.7      50  0.0013   14.5   3.7   55  103-157   121-183 (437)
378 TIGR01521 FruBisAldo_II_B fruc  26.6      45  0.0011   14.8   2.0   14  165-178   230-243 (347)
379 TIGR02010 IscR iron-sulfur clu  26.6      32 0.00082   15.7   1.3   16  277-292    35-50  (140)
380 TIGR02071 PBP_1b penicillin-bi  26.3      51  0.0013   14.5   4.0   50  137-198    33-95  (742)
381 cd06542 GH18_EndoS-like Endo-b  26.2      51  0.0013   14.4   6.5   99   48-151    77-184 (255)
382 PRK11658 UDP-4-amino-4-deoxy-L  26.2      43  0.0011   14.9   1.9  110  107-228    39-159 (379)
383 PRK00409 recombination and DNA  26.1      51  0.0013   14.4   2.5   18   36-53    318-335 (780)
384 COG2873 MET17 O-acetylhomoseri  26.0      51  0.0013   14.4   3.7   65  106-171   117-189 (426)
385 pfam09439 SRPRB Signal recogni  25.9      52  0.0013   14.4   2.9  151   43-203     3-177 (181)
386 PRK04175 rpl7ae 50S ribosomal   25.8      52  0.0013   14.4   3.3   33   44-82     49-81  (123)
387 PRK08305 spoVFB dipicolinate s  25.7      46  0.0012   14.7   1.9  157   53-224    15-194 (195)
388 TIGR03642 cas_csx13 CRISPR-ass  25.6      52  0.0013   14.4   2.9   30  219-261    92-121 (124)
389 pfam03392 OS-D Insect pheromon  25.6      36 0.00092   15.4   1.4   29   46-74     27-55  (95)
390 COG0148 Eno Enolase [Carbohydr  25.4      53  0.0013   14.3  11.7   88  102-189   264-359 (423)
391 cd00408 DHDPS-like Dihydrodipi  25.4      53  0.0013   14.3   7.8   27   46-73     68-94  (281)
392 pfam03537 DUF297 TM1410 hypoth  25.4      53  0.0013   14.3   7.7   18  247-264    94-111 (203)
393 TIGR00715 precor6x_red precorr  25.3      32 0.00081   15.8   1.0  195   45-274     3-246 (260)
394 TIGR01584 citF citrate lyase,   24.9      54  0.0014   14.3   3.2   27  146-172   309-337 (496)
395 cd04149 Arf6 Arf6 subfamily.    24.8      54  0.0014   14.3   4.4   23  112-134    76-98  (168)
396 KOG0423 consensus               24.6      37 0.00095   15.3   1.3   48  241-290    99-146 (223)
397 PRK02240 GTP cyclohydrolase II  24.6      51  0.0013   14.4   2.0   24   97-120    63-86  (254)
398 COG0800 Eda 2-keto-3-deoxy-6-p  24.5      55  0.0014   14.2   9.9  102   54-180    21-125 (211)
399 KOG3021 consensus               24.5      55  0.0014   14.2   2.3   35   37-73     25-64  (313)
400 PRK07535 methyltetrahydrofolat  24.4      55  0.0014   14.2  10.6  178   55-263    22-228 (268)
401 TIGR00423 TIGR00423 conserved   24.3      55  0.0014   14.2   3.2  118   51-187    33-169 (331)
402 PRK07094 biotin synthase; Prov  24.3      55  0.0014   14.2   5.7  191   56-279    71-299 (323)
403 cd05799 PGM2 This CD includes   24.2      56  0.0014   14.2   8.6   18   56-73     58-75  (487)
404 pfam00265 TK Thymidine kinase.  24.2      56  0.0014   14.2   5.4   44   45-93      3-46  (175)
405 cd05191 NAD_bind_amino_acid_DH  23.9      56  0.0014   14.2   3.5   48  175-225    36-86  (86)
406 PRK13958 N-(5'-phosphoribosyl)  23.9      56  0.0014   14.2   8.8  102   52-170     6-109 (207)
407 cd00405 PRAI Phosphoribosylant  23.8      57  0.0014   14.1   5.2  123   52-195     4-129 (203)
408 COG1663 LpxK Tetraacyldisaccha  23.7      57  0.0014   14.1   4.3  111   23-156    45-168 (336)
409 cd04157 Arl6 Arl6 subfamily.    23.6      57  0.0015   14.1   4.2   23  112-134    68-90  (162)
410 pfam04872 Pox_L5 Poxvirus L5 p  23.5      56  0.0014   14.2   2.0   50  243-292    15-66  (79)
411 COG1419 FlhF Flagellar GTP-bin  23.5      57  0.0015   14.1  12.2  159   43-223   203-371 (407)
412 TIGR02152 D_ribokin_bact ribok  23.5      57  0.0015   14.1   3.2  122   38-198   100-231 (303)
413 smart00178 SAR Sar1p-like memb  23.4      45  0.0012   14.8   1.5   66   99-177    70-142 (184)
414 COG1109 {ManB} Phosphomannomut  23.2      58  0.0015   14.1   4.8   24  163-186   257-281 (464)
415 PRK11539 hypothetical protein;  23.2      52  0.0013   14.4   1.8   53   28-82    504-556 (754)
416 PRK09490 metH B12-dependent me  23.2      58  0.0015   14.1   3.3   21   50-70    312-332 (1229)
417 TIGR00789 flhB_rel FlhB domain  23.0      49  0.0012   14.6   1.6   31   96-128    23-53  (84)
418 COG0159 TrpA Tryptophan syntha  23.0      59  0.0015   14.0   5.9  217   46-293    22-261 (265)
419 pfam05036 SPOR Sporulation rel  22.8      59  0.0015   14.0   5.9   22  166-187    49-70  (75)
420 COG1366 SpoIIAA Anti-anti-sigm  22.8      31 0.00078   15.9   0.5   66  203-272    47-112 (117)
421 PRK12861 malic enzyme; Reviewe  22.6      59  0.0015   14.0   4.3  152   94-280   129-318 (762)
422 PRK07315 fructose-bisphosphate  22.6      60  0.0015   14.0   9.6   78  166-264   151-233 (293)
423 cd00879 Sar1 Sar1 subfamily.    22.6      49  0.0012   14.6   1.5   53  111-176    85-143 (190)
424 cd02072 Glm_B12_BD B12 binding  22.5      60  0.0015   14.0   8.8   91   99-189    11-112 (128)
425 TIGR00097 HMP-P_kinase phospho  22.5      60  0.0015   14.0   3.1   30   93-123     8-37  (264)
426 PRK00125 pyrF orotidine 5'-pho  22.4      60  0.0015   14.0   5.2  122   55-187    33-182 (277)
427 PRK08248 O-acetylhomoserine am  22.4      60  0.0015   14.0   4.5   68  103-171   116-191 (431)
428 TIGR00438 rrmJ ribosomal RNA l  22.3      60  0.0015   14.0   4.2   70   35-120   103-173 (192)
429 PRK08385 nicotinate-nucleotide  22.3      60  0.0015   14.0   7.9   89  106-228   173-266 (279)
430 PRK08255 salicylyl-CoA 5-hydro  22.3      60  0.0015   13.9   8.9  103  149-259   611-743 (770)
431 PRK05939 hypothetical protein;  22.2      61  0.0015   13.9   7.0   14  279-292   377-390 (396)
432 PRK04311 selenocysteine syntha  22.2      61  0.0016   13.9   4.2   58   75-138   218-289 (465)
433 PRK00941 acetyl-CoA decarbonyl  22.0      35  0.0009   15.5   0.7   91  100-192   159-269 (779)
434 CHL00198 accA acetyl-CoA carbo  21.8      60  0.0015   14.0   1.9   26   99-125   139-164 (322)
435 PRK06084 O-acetylhomoserine am  21.7      62  0.0016   13.9   2.7   63  103-165   110-180 (424)
436 pfam01244 Peptidase_M19 Membra  21.6      62  0.0016   13.9   9.1  228   45-293    49-294 (316)
437 TIGR03565 alk_sulf_monoox alka  21.4      63  0.0016   13.8   3.1   40  232-271   296-335 (346)
438 PRK07179 hypothetical protein;  21.4      63  0.0016   13.8   6.3   88  145-234   125-228 (408)
439 PRK13306 ulaD 3-keto-L-gulonat  21.3      63  0.0016   13.8   8.0  198   43-295     3-215 (216)
440 PRK09435 arginine/ornithine tr  21.3      63  0.0016   13.8   3.8   29   46-74     52-80  (325)
441 cd04509 PBP1_ABC_transporter_G  21.3      63  0.0016   13.8  11.1   43  152-194   158-200 (299)
442 PRK10927 essential cell divisi  21.3      63  0.0016   13.8   4.0   49   96-144    71-136 (319)
443 pfam03356 Pox_LP_H2 Viral late  21.3      63  0.0016   13.8   3.4   59  134-193   102-163 (189)
444 KOG3846 consensus               21.2      64  0.0016   13.8   2.9   86  175-267   202-296 (465)
445 TIGR02315 ABC_phnC phosphonate  21.2      64  0.0016   13.8   3.4   24   45-69     30-53  (253)
446 TIGR01789 lycopene_cycl lycope  21.1      39 0.00099   15.2   0.8   41  217-266   170-211 (392)
447 cd01948 EAL EAL domain. This d  21.1      64  0.0016   13.8   5.3   79  170-264   130-209 (240)
448 PRK13479 2-aminoethylphosphona  21.0      64  0.0016   13.8   6.1   89  135-228    83-172 (368)
449 PRK06361 hypothetical protein;  20.9      64  0.0016   13.8   5.2   34  210-251   159-193 (216)
450 cd04153 Arl5_Arl8 Arl5/Arl8 su  20.8      65  0.0017   13.8   4.8   24  111-134    81-104 (174)
451 KOG0053 consensus               20.7      65  0.0017   13.7   3.9   69  102-171   128-204 (409)
452 pfam03841 SelA L-seryl-tRNA se  20.6      65  0.0017   13.7   4.1   59   75-139   136-208 (367)
453 cd06358 PBP1_NHase Type I peri  20.5      66  0.0017   13.7  11.5   21  171-191   173-193 (333)
454 COG3598 RepA RecA-family ATPas  20.1      67  0.0017   13.7   4.1  203   84-294    82-324 (402)
455 PRK13840 sucrose phosphorylase  20.1      67  0.0017   13.7   3.7   92   58-156   173-277 (496)
456 cd04150 Arf1_5_like Arf1-Arf5-  20.0      67  0.0017   13.6   4.2   22  112-133    67-88  (159)
457 TIGR02320 PEP_mutase phosphoen  20.0      67  0.0017   13.6   3.9   73  210-295    62-138 (272)

No 1  
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase; InterPro: IPR006269   These sequences describe 2-dehydro-3-deoxyphosphooctonate aldolase. Alternate names include 3-deoxy-d-manno-octulosonic acid 8-phosphate and KDO-8 phosphate synthetase. It catalyzes the aldol condensation of phosphoenolpyruvate with D-arabinose 5-phosphate.   phosphoenolpyruvate + D-arabinose 5-phosphate + H_2O = 2-dehydro-3-deoxy-D-octonate 8-phosphate + phosphate    In Gram-negative bacteria, this is the first step in the biosynthesis of 3-deoxy-D-manno-octulosonate, part of the oligosaccharide core of lipopolysaccharide. ; GO: 0008676 3-deoxy-8-phosphooctulonate synthase activity, 0008152 metabolic process, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=877.17  Aligned_cols=258  Identities=60%  Similarity=1.023  Sum_probs=255.5

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHH-CCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             7069995486349999999999999996553-399706601557688666322245671248889998866528768852
Q gi|254780669|r   43 QRFVLIAGPCQIESHDHAFMIAEKLYAICQS-LNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTD  121 (301)
Q Consensus        43 ~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~-~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~Te  121 (301)
                      ++|+||||||+|||+|++|+||+.|+++..+ +.++||||+|||||||||.+||||+|+||||+||++||++||+||+||
T Consensus         1 ~~f~LiAGPCvIES~d~~L~~A~~l~~~~~k~~gi~fiFKsSFDKANRtS~~SfRGpGle~GL~iL~kvK~~fG~pi~TD   80 (279)
T TIGR01362         1 EKFFLIAGPCVIESEDHALRIAEKLKELTSKSLGIPFIFKSSFDKANRTSINSFRGPGLEEGLKILQKVKEEFGVPILTD   80 (279)
T ss_pred             CCCEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             98406428775356899999988877663120266745723410123211024368887899999998656528970235


Q ss_pred             CCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCC-------------CC
Q ss_conf             28899998765021578822576289999999850597799836777899999999999972587-------------80
Q gi|254780669|r  122 VHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGA-------------KD  188 (301)
Q Consensus       122 V~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn-------------~~  188 (301)
                      |||.+||+.+|+||||||||||||||||||+|+|+||++||||||||+|||||.++++|+..+||             +|
T Consensus        81 VHE~~q~~~vAeVvDilQiPAFLCRQTDLl~AaA~TG~ivNvKKGQFLsP~dM~nv~~K~~~~GnksiqsPtyetal~~~  160 (279)
T TIGR01362        81 VHESSQAEPVAEVVDILQIPAFLCRQTDLLVAAAKTGKIVNVKKGQFLSPWDMKNVVEKVLKTGNKSIQSPTYETALKKN  160 (279)
T ss_pred             CCCCHHHHHHCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHCCCC
T ss_conf             47721022004130011066132114689999982398686058863871211589999987278622475122330477


Q ss_pred             EEEEECCCCCCCHHHCCCCCCCHHHHHHC--CCEEECHHHHHHHCC-----CCCCCCCCCHHHHHHHHHHHHHHCCCEEE
Q ss_conf             89951465444010000000106888518--716871177742122-----34532126388999999999971898899
Q gi|254780669|r  189 VLFCERGTSFGYNTLVTDMRSIPIMTSMG--VPVIFDASHSVQQPG-----IHGNCSGGERQYIVPLAKAAVAIGIAGIF  261 (301)
Q Consensus       189 i~lcERG~~fgy~~lvvD~~~i~~lk~~~--~PVi~D~SHs~q~p~-----~~~~~~gG~r~~v~~la~aa~a~G~dGlf  261 (301)
                      |||||||+|||||||||||||+++||+.+  +|||||+|||||+||     +.|++|||.|||||.|||||+|.|+||||
T Consensus       161 v~lcERG~~FGYnnLVvDmRsL~iM~~~~kG~PVvfDaTHSvQ~PgGkkl~G~G~~SGG~refvp~LARAA~AVG~~GlF  240 (279)
T TIGR01362       161 VLLCERGTSFGYNNLVVDMRSLPIMRELGKGCPVVFDATHSVQQPGGKKLDGLGGKSGGQREFVPTLARAAVAVGIDGLF  240 (279)
T ss_pred             CEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCEECCCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             15861788888875311124558999716997368730124037687122577776798743467999988986243146


Q ss_pred             EEECCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             983698334797820186889999999999999998851
Q gi|254780669|r  262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP  300 (301)
Q Consensus       262 iE~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~vk~  300 (301)
                      |||||||++|+||||+||+|++||.||.+|++|++++|+
T Consensus       241 ~EtH~DP~~A~SDGp~mlpL~~LE~Ll~~l~~i~~~~k~  279 (279)
T TIGR01362       241 IETHPDPKNAKSDGPNMLPLDELEALLEKLLKIDAVTKK  279 (279)
T ss_pred             EECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             621788777788884678988999999999999998449


No 2  
>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional
Probab=100.00  E-value=0  Score=766.04  Aligned_cols=271  Identities=43%  Similarity=0.763  Sum_probs=265.2

Q ss_pred             EEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             68357877279769970699954863499999999999999965533997066015576886663222456712488899
Q gi|254780669|r   28 IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIF  107 (301)
Q Consensus        28 ~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il  107 (301)
                      |.|++   +|+|||++||++|||||++||+||++++|+++++++.++.++++||+|||||||||+|||||+|+|+||+||
T Consensus         3 v~i~~---gv~ig~~~p~~~iaGPC~vEs~e~~~~iA~~l~~~~~~~~~~~ifK~sfdkaNRTS~~sfqG~G~eegL~~L   79 (281)
T PRK12457          3 VAISP---GITVGNDLPFVLFGGINVLESLDFTLDVCGEYVEVTRKLGIPFVFKASFDKANRSSIHSYRGVGLDEGLRIF   79 (281)
T ss_pred             EECCC---CCEECCCCCEEEEECCCHHHCHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             43479---938889980589916646659999999999999999972998784377887768999777898889999999


Q ss_pred             HHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             98866528768852288999987650215788225762899999998505977998367778999999999999725878
Q gi|254780669|r  108 RDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       108 ~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      +++|++||+||+||||+++|++.+++++||||||||||||||||+|+|+|+||||||||||+|||||++++||+.+.||+
T Consensus        80 ~~ik~~~gl~viTeVh~~~q~~~v~e~vDilQIpAr~~rqtdLL~a~~~t~kpV~lKkGq~~s~~e~~~aaeki~s~Gn~  159 (281)
T PRK12457         80 EEVKARFGVPVITDVHEVEQAAPVAEVADVLQVPAFLARQTDLVVAIAKTGKPVNIKKPQFMSPTQMKHVVSKCREAGND  159 (281)
T ss_pred             HHHHHHHCCCEEEEECCHHHHHHHHHHHHHEEECHHHCCCCHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             99999879967998588889999986502123443750281899999973992795587769999999999999975998


Q ss_pred             CEEEEECCCCCCCHHHCCCCCCCHHHHHH--CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             08995146544401000000010688851--8716871177742122345321263889999999999718988999836
Q gi|254780669|r  188 DVLFCERGTSFGYNTLVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH  265 (301)
Q Consensus       188 ~i~lcERG~~fgy~~lvvD~~~i~~lk~~--~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~H  265 (301)
                      +|||||||++|||+|+++|+|++++||+.  ++|||+|||||+|+|++.+++|||+|+||++|||||+|+|+||||+|||
T Consensus       160 ~vilcERGt~fgy~~lvvD~~~i~~mk~~~~~~PVi~D~THs~q~~~~~g~~sgG~r~~v~~la~Aava~GadGlfiEvH  239 (281)
T PRK12457        160 RVILCERGSSFGYDNLVVDMLGFRQMKRTTGDLPVIFDVTHSLQCRDPLGAASGGRRRQVVDLARAGMAVGLAGLFLEAH  239 (281)
T ss_pred             EEEEEECCCCCCCCCCCCCCCHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             49998388987888876550009999986569986875676751348887888882899999999999808888999837


Q ss_pred             CCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             983347978201868899999999999999988519
Q gi|254780669|r  266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL  301 (301)
Q Consensus       266 p~P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~vk~l  301 (301)
                      |||++|||||+|||+|++|++|++++++|+++||+.
T Consensus       240 p~P~~AlSDg~q~l~l~~~~~ll~~l~~i~~~vk~~  275 (281)
T PRK12457        240 PDPDRARCDGPSALPLDQLEPFLAQVKALDDLVKSF  275 (281)
T ss_pred             CCCCCCCCCHHCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             982437886020579999999999999999998348


No 3  
>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional
Probab=100.00  E-value=0  Score=766.98  Aligned_cols=264  Identities=56%  Similarity=0.977  Sum_probs=260.9

Q ss_pred             CCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             72797699706999548634999999999999999655339970660155768866632224567124888999886652
Q gi|254780669|r   35 NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY  114 (301)
Q Consensus        35 ~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~  114 (301)
                      ++++|||++||++|||||++||+||++++|+.+|++|+++.|+++|||||||||||||+||||+|+|+||+||+++|++|
T Consensus         1 g~~~ig~~~pl~~IaGPCsvEs~e~~~~~A~~lk~~~~~~~~~~ifK~sf~KaNRTsp~sf~G~G~e~gL~~l~~vk~~~   80 (264)
T PRK05198          1 GDIEVGNDLPFVLIAGPCVIESRDLALEIAEHLKEITEKLGIPFVFKASFDKANRSSIHSYRGPGLEEGLKILAEVKETF   80 (264)
T ss_pred             CCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             98577899804899477820399999999999999887549984853677866678886767866888989999999984


Q ss_pred             CCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             87688522889999876502157882257628999999985059779983677789999999999997258780899514
Q gi|254780669|r  115 GFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       115 glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      |+||+||||+++|+|.+++||||||||||||||||||+|+|+|+||||||||||+|||||++++||+.+.||+||++|||
T Consensus        81 glpi~TeV~~~~~~e~~~~~vDilQIgAfl~rqtdLl~a~a~t~kpV~lKkgqf~sp~~~~~a~eki~~~Gn~~v~lcER  160 (264)
T PRK05198         81 GVPVLTDVHEPEQAAPVAEVVDVLQIPAFLCRQTDLLVAAAKTGKVVNIKKGQFLAPWDMKNVVDKVRETGNDKIILCER  160 (264)
T ss_pred             CCCCCEEECCHHHHHHHHHHHHHHEECHHHHCCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             99640146789999999834023201235403479999998649908842556589999999999999749984999848


Q ss_pred             CCCCCCHHHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCC
Q ss_conf             65444010000000106888518716871177742122345321263889999999999718988999836983347978
Q gi|254780669|r  195 GTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD  274 (301)
Q Consensus       195 G~~fgy~~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD  274 (301)
                      |++|||+||++|||++|+||++++|||+|||||+|+|++.++++||+|+||++||+||+++|+||||+||||||++|+||
T Consensus       161 G~~fgY~~lvvD~~~i~~lk~~~~PVi~DpSHs~q~p~~~~~~sgG~r~~v~~la~aaia~G~dGl~iE~HpdP~~AlsD  240 (264)
T PRK05198        161 GTSFGYNNLVVDMRGLPIMRETGAPVIFDATHSVQLPGGQGGSSGGQREFVPVLARAAVAVGVAGLFIETHPDPDNALSD  240 (264)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCCEECCCCHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC
T ss_conf             99868887631267789998528982665732001678877876551777999999999829998999836880217886


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             201868899999999999999988
Q gi|254780669|r  275 GPNMINIKDLPKLLSQLLAIDKII  298 (301)
Q Consensus       275 ~~q~l~l~~l~~ll~~l~~i~~~v  298 (301)
                      ++|||+|++|++|++++++|+++|
T Consensus       241 ~~q~l~~~~l~~ll~~l~~i~~~v  264 (264)
T PRK05198        241 GPNALPLDKLEPLLEQLKAIDDLV  264 (264)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             001579999999999999998649


No 4  
>COG2877 KdsA 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=744.98  Aligned_cols=272  Identities=57%  Similarity=0.979  Sum_probs=266.9

Q ss_pred             CEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             70683578772797699706999548634999999999999999655339970660155768866632224567124888
Q gi|254780669|r   26 AAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE  105 (301)
Q Consensus        26 ~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~  105 (301)
                      +.+.+    ++|.++|++||++|||||++||+|+++++|+.+++++.++.++++||+|||||||||.+||||+|+|+||+
T Consensus         3 ~~vk~----g~i~~~n~~~f~LiaGpcviEs~d~a~~~a~~l~~~t~~lgi~~vfKsSfDKANRsSi~s~RGpGLeeglk   78 (279)
T COG2877           3 KVVKV----GDIVIGNDLPFVLIAGPCVIESRDLALEIAEHLKELTEKLGIPYVFKSSFDKANRSSIHSYRGPGLEEGLK   78 (279)
T ss_pred             CEEEE----CCEEECCCCCEEEEECCHHHCHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             36886----87774288853797144200107889999999999986039856986243423333211246877888999


Q ss_pred             HHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCC
Q ss_conf             99988665287688522889999876502157882257628999999985059779983677789999999999997258
Q gi|254780669|r  106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHG  185 (301)
Q Consensus       106 il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~G  185 (301)
                      +|+++|++||+||+||||+++|+.++++++||||||||||||||||.|+|+||++||+|||||++||||.++++|+.++|
T Consensus        79 i~~~vK~efgv~ilTDVHe~~q~~~vA~VvDilQiPAFL~RQTDLlvA~AkTg~~vNvKKgQFLaPwdMkniv~K~~~~g  158 (279)
T COG2877          79 ILQEVKEEFGVPILTDVHEPSQAQPVAEVVDVLQIPAFLCRQTDLLVAAAKTGAVVNVKKGQFLAPWDMKNIVEKFLETG  158 (279)
T ss_pred             HHHHHHHHCCCCEEECCCCHHHCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCEEEECCCCCCCHHHHHHHHHHHHHCC
T ss_conf             99999987199634135886653147755002213088763079999999758847612655158667555999998538


Q ss_pred             CCCEEEEECCCCCCCHHHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             78089951465444010000000106888518716871177742122345321263889999999999718988999836
Q gi|254780669|r  186 AKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH  265 (301)
Q Consensus       186 n~~i~lcERG~~fgy~~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~H  265 (301)
                      |++|++||||+||||||||+|||++++||+++.|||||+|||+|+||+.|++|||+|+||++|||||+|.|++|||+|+|
T Consensus       159 n~~v~lcERG~sFGYnnLV~DMrsl~iM~~~~~PViFDaTHSvQ~pg~~g~~SGG~refv~~LaRAa~AvGvaGlF~EtH  238 (279)
T COG2877         159 NNKVILCERGASFGYNNLVVDMRSLPIMKEFGAPVIFDATHSVQQPGGQGGSSGGRREFVPTLARAAVAVGVAGLFIETH  238 (279)
T ss_pred             CCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECC
T ss_conf             98679972667567540477766039998709986982423112788888888875211588899998743114787406


Q ss_pred             CCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             983347978201868899999999999999988519
Q gi|254780669|r  266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL  301 (301)
Q Consensus       266 p~P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~vk~l  301 (301)
                      |||++|+||||+||+|++|+.||.++++|++++|+.
T Consensus       239 pdP~~A~sDgp~mlpL~~le~ll~~l~~~d~l~k~~  274 (279)
T COG2877         239 PDPDNAKSDGPNMLPLDKLEALLEQLKAIDDLVKSF  274 (279)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             983337788866567889999999999999998504


No 5  
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR006268   These sequences are one of at least three types of phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase). This enzyme catalyzes the first of 7 steps in the biosynthesis of chorismate, that last common precursor of all three aromatic amino acids and of PABA, ubiquinone and menaquinone. Some members of this family, including an experimentally characterised member from Bacillus subtilis, are bifunctional, with a chorismate mutase domain N-terminal to this region. The member of this family from Synechocystis PCC 6803, CcmA, was shown to be essential for carboxysome formation. However, no other candidate for this enzyme is present in that species, chorismate biosynthesis does occur, other species having this protein lack carboxysomes but appear to make chorismate, and a requirement of CcmA for carboxysome formation does not prohibit a role in chorismate biosynthesis.; GO: 0016832 aldehyde-lyase activity, 0009073 aromatic amino acid family biosynthetic process.
Probab=100.00  E-value=0  Score=695.02  Aligned_cols=255  Identities=29%  Similarity=0.516  Sum_probs=237.1

Q ss_pred             HHHHHCCCCCCEEEECCCEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             44543046876178317706835787727976997069995486349999999999999996553399706601557688
Q gi|254780669|r    9 LEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKAN   88 (301)
Q Consensus         9 l~~~~~~i~~~~~~~~~~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKan   88 (301)
                      +.|+++|.+       +..+.+    ++|+||++. +.+|||||||||+||++++|+.+|+.|++++|||+|||      
T Consensus         2 l~S~~~~~~-------~tv~~v----~~v~IG~G~-~~~iAGPCsvEs~eq~~~~A~~vk~~Ga~~LRGGAfKP------   63 (262)
T TIGR01361         2 LVSREFKPE-------KTVVDV----KGVKIGEGS-PIVIAGPCSVESEEQIVETARFVKEAGAKILRGGAFKP------   63 (262)
T ss_pred             CCCCCCCCC-------CCEEEC----CCEEECCCE-EEEEECCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCC------
T ss_conf             887532677-------615771----857753847-89986487748879999999999866740430663488------


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCC
Q ss_conf             66632224567124888999886652876885228899998765021578822576289999999850597799836777
Q gi|254780669|r   89 RSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQF  168 (301)
Q Consensus        89 RtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~  168 (301)
                      |||||||||+| ++||+|++++++++||+|+|||||+++++.+++|+|||||||||||||+||+++|+++|||+||||+.
T Consensus        64 RTSPYsFQGlg-~~gl~~l~~A~~~~GL~~vTEvmd~~d~e~~~~y~D~lQiGARNmQNF~LL~~vG~~~KPVLLKRG~~  142 (262)
T TIGR01361        64 RTSPYSFQGLG-EEGLKLLRRAADETGLPVVTEVMDPRDVEIVAEYADILQIGARNMQNFELLKEVGKQGKPVLLKRGMG  142 (262)
T ss_pred             CCCCCCCCCCH-HHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCCEEEECCCC
T ss_conf             88884124741-89999999999860994898863625677787651134222541225699999722379755307721


Q ss_pred             CCHHHHHHHHHHHHHCC-CCCEEEEECCC-CCCCHHHCC-CCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHH
Q ss_conf             89999999999997258-78089951465-444010000-0001068885-18716871177742122345321263889
Q gi|254780669|r  169 LSPWEMHNILQKLHAHG-AKDVLFCERGT-SFGYNTLVT-DMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQY  244 (301)
Q Consensus       169 ~s~~e~~~a~eki~~~G-n~~i~lcERG~-~fgy~~lvv-D~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~  244 (301)
                      .|++||+.|||||++.| |.||||||||+ ||...|+.+ |+.++|++|+ +|||||+||||++           |+|||
T Consensus       143 aTi~EwL~AAEYIl~~GsN~~ViLCERGIRTfE~~TR~TLD~saV~~~K~~tHLPi~VDPSH~~-----------GrRdL  211 (262)
T TIGR01361       143 ATIEEWLEAAEYILSEGSNGNVILCERGIRTFEKSTRNTLDLSAVPLLKKETHLPIIVDPSHAA-----------GRRDL  211 (262)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEECCCCCC-----------CHHHH
T ss_conf             5899999999999846889954899758567630024533378999998605898787187987-----------62457


Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCCCH-HHHHHHHHHHHH
Q ss_conf             9999999997189889998369833479782018688-999999999999
Q gi|254780669|r  245 IVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI-KDLPKLLSQLLA  293 (301)
Q Consensus       245 v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l~l-~~l~~ll~~l~~  293 (301)
                      |+|||+||+|+|||||+|||||||++||||++|||+| ++|+.+++++..
T Consensus       212 V~plA~AA~A~GADgl~iEVHp~Pe~ALSD~~Qql~~c~~f~~~~~~~~~  261 (262)
T TIGR01361       212 VLPLAKAAIAAGADGLMIEVHPDPEKALSDSKQQLTPCEEFKRLVKELRA  261 (262)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCHHHHCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             88999998975747368986678333207871144667889999998504


No 6  
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional
Probab=100.00  E-value=0  Score=675.53  Aligned_cols=275  Identities=26%  Similarity=0.459  Sum_probs=257.1

Q ss_pred             CCCCCCCHHHHHHCCCCCCEEEECCCEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             97775203445430468761783177068357877279769970699954863499999999999999965533997066
Q gi|254780669|r    1 MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY   80 (301)
Q Consensus         1 ~~i~~pykl~~~~~~i~~~~~~~~~~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~if   80 (301)
                      +||++||||++|+++-..+      ..+.+....+.+.||+++++++||||||+||+||++++|+.+|+.|++++|+|+|
T Consensus        64 ~~i~~pyKl~sre~~~~~~------~~~~v~~~~G~v~~G~~~~~~iiAGPCsvEs~eq~~~~A~~vk~~Ga~~lRgGa~  137 (352)
T PRK13396         64 LRVEKPFKRASLEYRHGEA------SEVVVPTPNGPVTFGENHPVVVVAGPCSVENEEMIVETAKRVKAAGAKFLRGGAY  137 (352)
T ss_pred             EECCCCHHHHHHHCCCCCC------CCEEEECCCCCEEECCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEECCCCC
T ss_conf             5568723366653166899------8639956898777479977999967875689999999999999839987826502


Q ss_pred             ECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCE
Q ss_conf             01557688666322245671248889998866528768852288999987650215788225762899999998505977
Q gi|254780669|r   81 KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV  160 (301)
Q Consensus        81 K~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kp  160 (301)
                      ||      |||||||||+| ++||+||+++|++||+||+||||+++|+|.+++++|+|||||||||||+||+++|+|+||
T Consensus       138 KP------RTsPysFqGlG-eeGL~~L~~ak~e~GLpvvTEV~~~~~ve~v~~~~DilQIGARn~qNf~LL~~~g~t~kP  210 (352)
T PRK13396        138 KP------RTSPYAFQGHG-ESALELLAAAREATGLGIITEVMDAADLDKIAEVADVIQVGARNMQNFSLLKKVGAQDKP  210 (352)
T ss_pred             CC------CCCCCCCCCCC-HHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCEEEECCHHHCCHHHHHHHHCCCCE
T ss_conf             47------89985435870-879999999999869972688679999999986588899892540599999998546980


Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCC-CCC--CHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCC
Q ss_conf             998367778999999999999725878089951465-444--0100000001068885-187168711777421223453
Q gi|254780669|r  161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGT-SFG--YNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGN  236 (301)
Q Consensus       161 V~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~-~fg--y~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~  236 (301)
                      |+||||++++++||++|+||+.+.||+||+|||||+ +|+  |.++.+|++++|+||+ +++|||+||||++        
T Consensus       211 VllKrg~~~ti~ewl~AaEyi~~~Gn~~viLcERGirtfe~~~~RntlDl~aip~~k~~thlPVi~DPSH~~--------  282 (352)
T PRK13396        211 VLLKRGMSATIDEWLMAAEYILAAGNPNVILCERGIRTFDRQYTRNTLDLSVIPVLRSLTHLPIMIDPSHGT--------  282 (352)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCCEEECCCCCC--------
T ss_conf             797378889999998699999976998589994897756676546775578879997489998897898645--------


Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             212638899999999997189889998369833479782018688999999999999999885
Q gi|254780669|r  237 CSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK  299 (301)
Q Consensus       237 ~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~vk  299 (301)
                         |+|+||++||+||+|+|+|||||||||||++|||||+|||+|++|++|++++++|++++.
T Consensus       283 ---G~r~~V~~la~AAva~GaDGL~iEvHp~P~~AlSDg~Q~l~p~~f~~l~~~l~~i~~~vg  342 (352)
T PRK13396        283 ---GKSEYVPSMAMAAIAAGTDSLMIEVHPNPAKALSDGPQSLTPERFDRLMQELAVIGKTVG  342 (352)
T ss_pred             ---CCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             ---787279999999998399889998468801157875235899999999999999999967


No 7  
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed
Probab=100.00  E-value=0  Score=665.30  Aligned_cols=269  Identities=30%  Similarity=0.526  Sum_probs=251.0

Q ss_pred             CCCCCCCHHHHHHCCCCCCEEEECCCEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             97775203445430468761783177068357877279769970699954863499999999999999965533997066
Q gi|254780669|r    1 MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY   80 (301)
Q Consensus         1 ~~i~~pykl~~~~~~i~~~~~~~~~~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~if   80 (301)
                      ++|++||||++|+++.+.       ..+++    +++.|||++ +++||||||+||+||++++|+.+|+.|++++|+|+|
T Consensus        62 ~~i~~pykl~sr~~~~~~-------t~i~v----~~~~iGg~~-~~iiAGPCsvEs~eq~~~~A~~vk~~ga~~lRgGa~  129 (335)
T PRK08673         62 VPVLKPYKLASREFKPEP-------TIVKV----GDVEIGGGK-PVVIAGPCSVESEEQILEIARAVKEAGAQILRGGAF  129 (335)
T ss_pred             EECCCCCEECCCCCCCCC-------CEEEE----CCEEECCCC-EEEEEECCCCCCHHHHHHHHHHHHHCCCCEECCCCC
T ss_conf             654875310126648889-------77997----999988985-369961786787999999999999779968806665


Q ss_pred             ECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCE
Q ss_conf             01557688666322245671248889998866528768852288999987650215788225762899999998505977
Q gi|254780669|r   81 KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV  160 (301)
Q Consensus        81 K~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kp  160 (301)
                      ||      |||||||||+| ++||+||+++|++||+||+||||+++|+|.+++++|||||||||||||+||+++|+++||
T Consensus       130 KP------RTsPysFqGlg-~eGL~~L~~~~~e~GlpvvTEV~~~~~ve~v~~~vDilQIGARnmqN~~LL~evg~~~kP  202 (335)
T PRK08673        130 KP------RTSPYSFQGLG-EEGLKLLAEAREETGLPIVTEVMDPRDVELVAEYADILQIGARNMQNFDLLKEVGKTNKP  202 (335)
T ss_pred             CC------CCCCCCCCCCC-HHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCEEEECHHHHCCHHHHHHHHHHCCE
T ss_conf             78------99985414551-669999999999869952899668999999996497999891550599999999972994


Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCC-CC-CCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCC
Q ss_conf             998367778999999999999725878089951465-44-40100000001068885-1871687117774212234532
Q gi|254780669|r  161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGT-SF-GYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNC  237 (301)
Q Consensus       161 V~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~-~f-gy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~  237 (301)
                      |+||||++++++||++|+||+.+.||+||+|||||+ +| .|.++..|++++|.||+ +++|||+||||++         
T Consensus       203 VllKrg~~~ti~ewl~AaEyi~~~Gn~~ViLcERGirtfe~~tRntlDl~aip~~k~~thlPVI~DPSH~~---------  273 (335)
T PRK08673        203 VLLKRGMSATIEEWLMAAEYILAEGNPNVILCERGIRTFETATRNTLDLSAVPVLKKLTHLPVIVDPSHAT---------  273 (335)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCEEECCCCCC---------
T ss_conf             89737887889999878999997699867999346545676667877878889997188988898882203---------


Q ss_pred             CCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             12638899999999997189889998369833479782018688999999999999999885
Q gi|254780669|r  238 SGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK  299 (301)
Q Consensus       238 ~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~vk  299 (301)
                        |+|+||++||+||+|+|+|||||||||||++|||||+|||+|++|+.|++++++|.+++.
T Consensus       274 --G~r~~V~~la~aAiAaGaDGL~iEvHp~P~~AlSDg~Q~l~p~~f~~l~~~l~~i~~~~~  333 (335)
T PRK08673        274 --GKRDLVEPLALAAVAAGADGLIVEVHPDPEKALSDGPQSLTPEEFEELMKKLRAIAEALG  333 (335)
T ss_pred             --CCHHHHHHHHHHHHHCCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             --633228999999998099889999568812146874236899999999999999999858


No 8  
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional
Probab=100.00  E-value=0  Score=663.97  Aligned_cols=253  Identities=29%  Similarity=0.573  Sum_probs=242.7

Q ss_pred             ECCCEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             31770683578772797699706999548634999999999999999655339970660155768866632224567124
Q gi|254780669|r   23 HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK  102 (301)
Q Consensus        23 ~~~~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~  102 (301)
                      ..++.+++    ++++|||++ +++|||||++||+||++++|+.+|++|.++.|+++|||      |||++||||+| ++
T Consensus        11 ~~~~~i~i----~~i~iG~~~-~~~IAGPC~iEs~e~~~~~A~~lk~~g~~~~r~~~fK~------RTs~~sfrG~G-~e   78 (266)
T PRK13398         11 GEKTIVKI----GDVVIGGEE-KIIIAGPCAVESEEQMVKVAEKLKELGVHMLRGGAFKP------RTSPYSFQGLG-EE   78 (266)
T ss_pred             CCCCEEEE----CCEEECCCC-EEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCEECC------CCCCCCCCCCC-HH
T ss_conf             98887997----999988995-48997577207999999999999983334333754158------99985556885-88


Q ss_pred             HHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             88899988665287688522889999876502157882257628999999985059779983677789999999999997
Q gi|254780669|r  103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLH  182 (301)
Q Consensus       103 gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~  182 (301)
                      ||+||+++|++||+||+||||+++|++.+++++||||||||||||||||+|+|+|+||||||||||+++++|++++||+.
T Consensus        79 gL~~L~~vk~~~glpi~TdVh~~~q~~~v~~~vDvlQIpAfl~rqtdLl~a~a~t~kpV~iKkg~~~s~~~~~~a~eki~  158 (266)
T PRK13398         79 GLKILKEVGDKYNMPVVTEVMDTRDVEEVADYIDMLQIGSRNMQNFELLKEVGKTKKPILLKRGMSATIEEWLYAAEYIM  158 (266)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHEEECCHHCCCHHHHHHHHHHCCCEEECCCCCCCHHHHHHHHHHHH
T ss_conf             99999999987299547774583769999975101122504227989999999709966734876688899999999998


Q ss_pred             HCCCCCEEEEECCC-CC-CCHHHCCCCCCCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCE
Q ss_conf             25878089951465-44-401000000010688851-8716871177742122345321263889999999999718988
Q gi|254780669|r  183 AHGAKDVLFCERGT-SF-GYNTLVTDMRSIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG  259 (301)
Q Consensus       183 ~~Gn~~i~lcERG~-~f-gy~~lvvD~~~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dG  259 (301)
                      +.||+|||+||||+ || ||+++++||+++++||+. ++|||+|||||+           |+|+|++++||||+++|+||
T Consensus       159 ~~Gn~~v~l~ERG~~t~~gy~~~v~D~~~i~~mk~~~~lPVi~D~SHs~-----------G~r~~v~~la~aAva~G~dG  227 (266)
T PRK13398        159 SEGNENVVLCERGIRTFETYTRNTLDLAAVAVIKELSHLPIIVDPSHAT-----------GRRELVIPMAKAAIAAGADG  227 (266)
T ss_pred             HCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEECCCCCC-----------CCHHHHHHHHHHHHHCCCCE
T ss_conf             4799838998425245777443521367799998577999898885335-----------67999999999999839988


Q ss_pred             EEEEECCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             999836983347978201868899999999999999988
Q gi|254780669|r  260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKII  298 (301)
Q Consensus       260 lfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~v  298 (301)
                      ||+||||||++|||||+|||+|++|++|++++++|+++|
T Consensus       228 lfiE~Hp~P~~AlSD~~q~l~l~~l~~ll~~l~~i~~av  266 (266)
T PRK13398        228 LMIEVHPEPEKALSDARQTLNFEEMKELVDELKPMAKAL  266 (266)
T ss_pred             EEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             999826980207897011579999999999999999649


No 9  
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional
Probab=100.00  E-value=0  Score=635.94  Aligned_cols=240  Identities=31%  Similarity=0.525  Sum_probs=228.6

Q ss_pred             CCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             72797699706999548634999999999999999655339970660155768866632224567124888999886652
Q gi|254780669|r   35 NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY  114 (301)
Q Consensus        35 ~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~  114 (301)
                      .++++.+++++++|||||++||+||++++|+.+++++.++.|+++|||      |||++||||+|+ +||+||+++|++|
T Consensus         6 ~~f~~~~~~k~~lIAGPC~iES~e~~~~~A~~lk~~g~~~~r~~~~K~------RTs~~sfrG~G~-egL~~L~~vk~~~   78 (250)
T PRK13397          6 SDFQNKTCSKNNFIVGPCSIESYDHIRLAASSAKKLGYNYFRGGAYKP------RTSAASFQGLGL-QGIRYLHEVCQEF   78 (250)
T ss_pred             HHHCCCCCCCCCEEECCCHHCCHHHHHHHHHHHHHCCCCEEECCCCCC------CCCCCCCCCCCH-HHHHHHHHHHHHC
T ss_conf             654046888887885587330999999999999984988575362688------899977678888-8999999999983


Q ss_pred             CCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             87688522889999876502157882257628999999985059779983677789999999999997258780899514
Q gi|254780669|r  115 GFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       115 glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      |+||+||||+++|++.++++|||||||||||||||||+|+|+|+||||||||||+|+++|++++||+.+.||++|++|||
T Consensus        79 glpi~TdVh~~~q~e~v~~~vDilQIpAfl~rqtdLl~a~a~t~kpV~iKkgq~~s~~~~~~a~eki~~~Gn~~i~l~ER  158 (250)
T PRK13397         79 GLLSVSEIMSERQLEEAYDYLDVIQVGARNMQNFEFLKTLSHIDKPILFKRGLMATIEEYLGALSYLQDTGKSNIILCER  158 (250)
T ss_pred             CCCEEEECCCHHHHHHHHHHCCEEEECHHHHCCHHHHHHHHHHCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             99748847999999999844748987726404989999987309808978877799999999999999659982899828


Q ss_pred             CCCCCCH---HHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             6544401---00000001068885-1871687117774212234532126388999999999971898899983698334
Q gi|254780669|r  195 GTSFGYN---TLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDN  270 (301)
Q Consensus       195 G~~fgy~---~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~  270 (301)
                      |++ ||+   ++++|++++|+||+ +++|||+|||||+           |+|+||+++||||+++|+||||+||||||++
T Consensus       159 G~~-gy~~~~rn~~d~~~ip~~~~~~~~PVi~D~SHs~-----------G~r~~v~~la~aA~a~G~dGlfiE~HpdP~~  226 (250)
T PRK13397        159 GVR-GYDVETRNMLDIMAVPIIQQKTDLPIIVDVSHST-----------GRRDLLLPAAKIAKAVGANGIMMEVHPDPDH  226 (250)
T ss_pred             CCC-CCCCCCCCCHHHHHHHHHHHHCCCCEEEECCCCC-----------CCCCHHHHHHHHHHHHCCCEEEEEECCCCCC
T ss_conf             987-5556312570077779999615999899287547-----------8825289999999983999899982798243


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             79782018688999999999999
Q gi|254780669|r  271 APSDGPNMINIKDLPKLLSQLLA  293 (301)
Q Consensus       271 AlsD~~q~l~l~~l~~ll~~l~~  293 (301)
                      |||||+|||+|++|++|+++|.+
T Consensus       227 AlSDg~q~l~~~~l~~Ll~~L~q  249 (250)
T PRK13397        227 ALSDAAQQIDYKQLEQLGQELWQ  249 (250)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             78860016799999999999831


No 10 
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed
Probab=100.00  E-value=0  Score=622.79  Aligned_cols=260  Identities=26%  Similarity=0.483  Sum_probs=240.6

Q ss_pred             HHHHHCCCCCCEEEECCCEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             44543046876178317706835787727976997069995486349999999999999996553399706601557688
Q gi|254780669|r    9 LEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKAN   88 (301)
Q Consensus         9 l~~~~~~i~~~~~~~~~~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKan   88 (301)
                      |+||+++.+       ++.+++    +++.|||++ +++||||||+||+||++++|+.+|+.|.+++|||+|||      
T Consensus        95 lvsr~~~~~-------~t~v~v----~~~~iG~~~-~~iIAGPCsvES~eQi~~~A~~vk~~G~~~lRgGa~KP------  156 (360)
T PRK12595         95 LVSRKKKPE-------DTIVDV----KGEIIGDGN-QSFIFGPCAVESYEQVAAVAQALKAKGLKLLRGGAFKP------  156 (360)
T ss_pred             EEECCCCCC-------CCEEEE----CCEEECCCC-EEEEECCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCC------
T ss_conf             874576888-------877987----999977996-43895688367899999999999975975572555689------


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCC
Q ss_conf             66632224567124888999886652876885228899998765021578822576289999999850597799836777
Q gi|254780669|r   89 RSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQF  168 (301)
Q Consensus        89 RtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~  168 (301)
                      |||||||||+| ++||+||++++++||+||+||||+++|+|.+++|+|||||||||||||+||+++|+++|||++|||+.
T Consensus       157 RTsPysFqGlG-~eGL~~L~~a~~e~gl~vvTEV~~~~~ve~~~~yvDilqIGARnmqNf~LLk~vg~~~kPVLlKrg~~  235 (360)
T PRK12595        157 RTSPYDFQGLG-VEGLKILKQVADEYDLAVISEIVNPNDVEVALDYVDVIQIGARNMQNFELLKAAGRVNKPVLLKRGLS  235 (360)
T ss_pred             CCCCCCCCCCC-HHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCEEEECCHHCCCHHHHHHHHCCCCCEEEECCCC
T ss_conf             99997657684-57999999999985997279857888999999748689888410359999999861399379607999


Q ss_pred             CCHHHHHHHHHHHHHCCCCCEEEEECCC-CCC-CHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHH
Q ss_conf             8999999999999725878089951465-444-0100000001068885-187168711777421223453212638899
Q gi|254780669|r  169 LSPWEMHNILQKLHAHGAKDVLFCERGT-SFG-YNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYI  245 (301)
Q Consensus       169 ~s~~e~~~a~eki~~~Gn~~i~lcERG~-~fg-y~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v  245 (301)
                      ++++||++|+|||.+.||++|+|||||+ +|. |.++..|+.++|++|+ +++|||+||||++           |+|++|
T Consensus       236 ati~ewl~AaEyi~~~Gn~~vilceRGirT~e~~tRntldl~avp~~k~~thLPVivDPSH~~-----------G~r~lv  304 (360)
T PRK12595        236 ATIEEFIYAAEYIMSQGNDQIILCERGIRTYEKATRNTLDISAVPILKQETHLPVMVDVTHST-----------GRRDLL  304 (360)
T ss_pred             CCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHCCCCCCEEECCCCCC-----------CCHHHH
T ss_conf             999999999999986799878999177567787668898867889986499999898996521-----------557589


Q ss_pred             HHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999718988999836983347978201868899999999999999988
Q gi|254780669|r  246 VPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKII  298 (301)
Q Consensus       246 ~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~v  298 (301)
                      +++|+||+|+|+|||||||||||++||||++|||++++|+.|+++++++.+.-
T Consensus       305 ~~~a~aa~a~GaDGlmIEvHp~P~~AlSD~~Qql~~~~f~~l~~~l~~~~~~~  357 (360)
T PRK12595        305 LPTAKAALAIGADGVMAEVHPDPAVALSDSAQQMDIPEFDRFYDELKPLADKL  357 (360)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             99999999749997999866882321587100489999999999999999985


No 11 
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]
Probab=100.00  E-value=0  Score=585.11  Aligned_cols=246  Identities=30%  Similarity=0.513  Sum_probs=233.7

Q ss_pred             CCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             72797699706999548634999999999999999655339970660155768866632224567124888999886652
Q gi|254780669|r   35 NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY  114 (301)
Q Consensus        35 ~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~  114 (301)
                      .++.+|++.++.+||||||+||+||+..+|+.+|+.|++++||++|||      |||||||||+| ++||+||+++++++
T Consensus        36 ~~~~~g~~~~~~viAGPCsvEs~E~i~~~A~~vk~~Ga~~lRGgafKP------RTSPYsFQGlg-e~gL~~l~~a~~~~  108 (286)
T COG2876          36 GDVVIGEGRALRVIAGPCSVESEEQVRETAESVKAAGAKALRGGAFKP------RTSPYSFQGLG-EEGLKLLKRAADET  108 (286)
T ss_pred             CCCEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCHHHCCCCCCCC------CCCCCCCCCCC-HHHHHHHHHHHHHC
T ss_conf             552005886138995474247799999999999873622313776788------89953336657-78899999988872


Q ss_pred             CCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             87688522889999876502157882257628999999985059779983677789999999999997258780899514
Q gi|254780669|r  115 GFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       115 glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      |+||+||||+++|+|.+++|+|||||||||||||+||+++|+++|||++|||+.+|++||++|+|||.+.||.|||||||
T Consensus       109 Gl~vvtEvm~~~~~e~~~~y~DilqvGARNMQNF~LLke~G~~~kPvLLKRg~~aTieEwL~AAEYI~s~GN~~vILCER  188 (286)
T COG2876         109 GLPVVTEVMDVRDVEAAAEYADILQVGARNMQNFALLKEVGRQNKPVLLKRGLSATIEEWLNAAEYILSHGNGNVILCER  188 (286)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             99058895489899999866169886332005169999823559976972474124999999999999679995799714


Q ss_pred             CC-CCC-CHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHC
Q ss_conf             65-444-0100000001068885-18716871177742122345321263889999999999718988999836983347
Q gi|254780669|r  195 GT-SFG-YNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA  271 (301)
Q Consensus       195 G~-~fg-y~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~A  271 (301)
                      |+ +|. |.+...|+.++|++|+ +|+|||+||||++           |+|++++++|+||+|+|+||+|+||||||++|
T Consensus       189 GIRtfe~~TRntLDi~aV~~~kq~THLPVivDpSH~~-----------Grr~lv~pla~AA~AaGAdglmiEVHp~P~~A  257 (286)
T COG2876         189 GIRTFEKATRNTLDISAVPILKQETHLPVIVDPSHAT-----------GRRDLVEPLAKAAIAAGADGLMIEVHPDPEKA  257 (286)
T ss_pred             CCCCCCCCCCCEECHHHHHHHHHHCCCCEEECCCCCC-----------CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCC
T ss_conf             4334555666422368888887615787798787765-----------53135788899998616773699964795434


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             978201868899999999999999988
Q gi|254780669|r  272 PSDGPNMINIKDLPKLLSQLLAIDKII  298 (301)
Q Consensus       272 lsD~~q~l~l~~l~~ll~~l~~i~~~v  298 (301)
                      |||++|||+|++|+.|+++++.+.++.
T Consensus       258 lsD~~Qql~~~~f~~l~~~~~~~~~~~  284 (286)
T COG2876         258 LSDAKQQLTPEEFEELVKELRALADAL  284 (286)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             576000179999999999998776540


No 12 
>pfam00793 DAHP_synth_1 DAHP synthetase I family. Members of this family catalyse the first step in aromatic amino acid biosynthesis from chorismate. E-coli has three related synthetases, which are inhibited by different aromatic amino acids. This family also includes KDSA which has very similar catalytic activity but is involved in the first step of liposaccharide biosynthesis.
Probab=100.00  E-value=0  Score=556.22  Aligned_cols=247  Identities=34%  Similarity=0.549  Sum_probs=235.9

Q ss_pred             CCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             77279769970699954863499999999999999965533997066015576886663222456712488899988665
Q gi|254780669|r   34 KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKK  113 (301)
Q Consensus        34 ~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~  113 (301)
                      .++|.+|+++||++||||||+||+++++++|+.|+++++++.+.++||+||||| |||++||||+|+++||+||.+++++
T Consensus         7 ~~~I~~G~d~~l~vIaGPCsies~~~~~~~A~~lk~~~~~~~i~~i~ra~f~Kp-rts~~~~~G~g~~~gL~~l~~i~~~   85 (271)
T pfam00793         7 ESDILIGEDDRLLVIAGPCSIESPEAAMEYAERLKELGAKLKLPIIMRAYFEKP-RTSPVGFKGLGNDPGLKILFRVKDG   85 (271)
T ss_pred             CCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCCCC-CCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             622478799965899678804399999999999999998709508998434468-9999675188877560267757765


Q ss_pred             HCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCC-CCCEEEE
Q ss_conf             287688522889999876502157882257628999999985059779983677789999999999997258-7808995
Q gi|254780669|r  114 YGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHG-AKDVLFC  192 (301)
Q Consensus       114 ~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~G-n~~i~lc  192 (301)
                      ||+|++||||++.|++.++++||++||||||||||+|+++++++++||++|||||+++++|++|+||+...| |+++++|
T Consensus        86 ~glpv~TEv~~~~~~~~~~d~vd~~qIgAr~~~~~~l~~~as~~~~pV~~Kng~~~a~~~~~~a~e~~~~~G~~~~~~~~  165 (271)
T pfam00793        86 LGLPIATEVLDPIDPQYVAEVADIGQIGARTTESQDLLEAASGTSKPVGLKRGTDLAIDEMLAAAEYHLFLGNTPGNILC  165 (271)
T ss_pred             CCCCHHHHHCCHHHHHHHHHHCCEEEECCCCCCCHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCE
T ss_conf             29954656527466999984176553455112589999998526984782587768999999999999985687898414


Q ss_pred             ECCCCCCC--HHHCCCCCCCHHHHHHC--CCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             14654440--10000000106888518--716871177742122345321263889999999999718988999836983
Q gi|254780669|r  193 ERGTSFGY--NTLVTDMRSIPIMTSMG--VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP  268 (301)
Q Consensus       193 ERG~~fgy--~~lvvD~~~i~~lk~~~--~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P  268 (301)
                      |||++|||  |++++|+++++.||+.+  +|||+|||||+|+++      +|++++|+.++++|+++|+||||+|+||+|
T Consensus       166 erg~r~g~~~n~~~~d~~~~~~lk~~~~~~pVivD~SH~~~~k~------~~~q~~V~~~~~aaia~Gi~GlmiEsH~~p  239 (271)
T pfam00793       166 ERGIRGGYGPNRLTLDVSAVPILKEETGHLPVMVDPSHSNGRKD------GGRQPLVPPLARAAIAVGADGLMIEVHPNP  239 (271)
T ss_pred             EEEECCCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCC------CCCHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             68974788877776889999999973789983773643234778------766789999999999809988999803795


Q ss_pred             HHCCCCCCCCCCHHHHHHH
Q ss_conf             3479782018688999999
Q gi|254780669|r  269 DNAPSDGPNMINIKDLPKL  287 (301)
Q Consensus       269 ~~AlsD~~q~l~l~~l~~l  287 (301)
                      ++|+||++|||++.+....
T Consensus       240 ~~a~sD~~~~l~yg~sitd  258 (271)
T pfam00793       240 GNALSDGPQQLKYGVSETD  258 (271)
T ss_pred             CCCCCCCCCCCCCCCCCCC
T ss_conf             5378998646779853231


No 13 
>PRK12756 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional
Probab=99.84  E-value=3.3e-19  Score=147.20  Aligned_cols=251  Identities=20%  Similarity=0.301  Sum_probs=183.0

Q ss_pred             CCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCC--CCEEEECCCCCCCCCCCCCCCCC--------------
Q ss_conf             72797699706999548634999999999999999655339--97066015576886663222456--------------
Q gi|254780669|r   35 NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN--IGLVYKSSFDKANRSSLAGKRGV--------------   98 (301)
Q Consensus        35 ~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~--~~~ifK~sfdKanRtS~~sfrG~--------------   98 (301)
                      .+|--|.|.+|++|.||||+...+.+++.|+.|+++..++.  .-.+....|.|+ ||. -+|+|+              
T Consensus        44 ~~Il~g~D~RllvIvGPCSIHD~~aaleYA~rL~~l~~~~~d~l~IVMRvYfEKP-RTt-vGWKGli~DP~ldgs~~i~~  121 (349)
T PRK12756         44 EKILNGEDKRLLVIIGPCSIHDTDAALDYATRLQALREQYQDRLEIVMRTYFEKP-RTV-VGWKGLISDPDLDGSYRVNH  121 (349)
T ss_pred             HHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCEEEEEEEEECCC-CCC-CCCCEECCCCCCCCCCCHHH
T ss_conf             9996699972899971787789799999999999999972266499986420478-646-67540045889889857767


Q ss_pred             CCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             71248889998866528768852288999987650215788225762899999998505977998367778999999999
Q gi|254780669|r   99 GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNIL  178 (301)
Q Consensus        99 Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~  178 (301)
                      |+..+.++|.++ .+.|+|+.||..++.-...+++.+.+--||||..-..-=-+-++....||-+|+|..-++.-.++|+
T Consensus       122 Gl~~aR~ll~~i-~~lGlp~AtE~Ldp~~pqY~~DliSw~AIGARTtESQ~HRelaSgLs~PVGfKN~TdG~i~vaidai  200 (349)
T PRK12756        122 GLELARKLLLQV-NELGLPTATEFLDMVTGQYIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNIRIAVDAI  200 (349)
T ss_pred             HHHHHHHHHHHH-HHCCCCCHHHHHCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCCCCEEECCCCCCCHHHHHHHH
T ss_conf             899999999999-8739961134525542444332454433055643227889885168875022368987489999999


Q ss_pred             HH------------------HHHCCCCCEEEEECCCCCCCHHHCCCC-CCCHHHHHHCCC--EEECHHHHHHHCCCCCCC
Q ss_conf             99------------------972587808995146544401000000-010688851871--687117774212234532
Q gi|254780669|r  179 QK------------------LHAHGAKDVLFCERGTSFGYNTLVTDM-RSIPIMTSMGVP--VIFDASHSVQQPGIHGNC  237 (301)
Q Consensus       179 ek------------------i~~~Gn~~i~lcERG~~fgy~~lvvD~-~~i~~lk~~~~P--Vi~D~SHs~q~p~~~~~~  237 (301)
                      .-                  +...||.+--+.-||-. +.|.---+. .+...|++.++|  |++||||+      ++++
T Consensus       201 ~aa~~~H~Fl~i~~~G~~~iv~T~GN~~~HiILRGG~-~PNY~~~~v~~~~~~l~~~~l~~~imIDcSHg------NS~K  273 (349)
T PRK12756        201 RAARASHMFLSPDKDGQMTIYQTSGNPYGHIIMRGGK-KPNYHAEDIAAACDTLHEFDLPEHLVVDFSHG------NCQK  273 (349)
T ss_pred             HHHHCCCEEEEECCCCCEEEEEECCCCCCEEEEECCC-CCCCCHHHHHHHHHHHHHCCCCCCEEEECCCC------CCCC
T ss_conf             9973897357556998589998079987248985699-89999899999999999769997347535666------5567


Q ss_pred             C-CCCHHHHHHHHHHHHHH---CCCEEEEEECCCHHHC-CCCC----------CCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             1-26388999999999971---8988999836983347-9782----------018688999999999999999885
Q gi|254780669|r  238 S-GGERQYIVPLAKAAVAI---GIAGIFLETHQDPDNA-PSDG----------PNMINIKDLPKLLSQLLAIDKIIK  299 (301)
Q Consensus       238 ~-gG~r~~v~~la~aa~a~---G~dGlfiE~Hp~P~~A-lsD~----------~q~l~l~~l~~ll~~l~~i~~~vk  299 (301)
                      - --+..-+..++. -+..   .+-|+|+|.|-++-+. +.|+          .-.|..++-+.+|.+|   .+.|+
T Consensus       274 d~~~Q~~V~~~V~~-Qi~~G~~~I~GvMiES~L~eG~Q~i~~~~~L~YG~SITDaCi~We~Te~lL~~L---a~av~  346 (349)
T PRK12756        274 QHRRQLEVAEDICQ-QIRAGSTAIAGIMAESFLREGTQKIVAGQPLTYGQSITDPCLGWEDTETLLEKL---ASAVD  346 (349)
T ss_pred             CHHHHHHHHHHHHH-HHHCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH---HHHHH
T ss_conf             97785899999999-997487727999985124345788999998869873364778968999999999---99998


No 14 
>PRK12755 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional
Probab=99.84  E-value=5.5e-19  Score=145.77  Aligned_cols=251  Identities=22%  Similarity=0.340  Sum_probs=180.5

Q ss_pred             CEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCC--CCEEEECCCCCCCCCCCCCCCCC--------------C
Q ss_conf             2797699706999548634999999999999999655339--97066015576886663222456--------------7
Q gi|254780669|r   36 QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN--IGLVYKSSFDKANRSSLAGKRGV--------------G   99 (301)
Q Consensus        36 ~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~--~~~ifK~sfdKanRtS~~sfrG~--------------G   99 (301)
                      +|--|.|.+|++|.|||||...+.+++.|+.|+++..++.  .-.+....|.|+ ||.. +|+|+              |
T Consensus        46 ~Il~g~D~RllvivGPCSIHD~~aaleYA~rL~~l~~~~~d~l~IVMRvYfEKP-RTtv-GWKGli~DP~ldgs~~i~~G  123 (352)
T PRK12755         46 DILHGRDDRLLVVVGPCSIHDPEAALEYARRLKALADELSDSLLIVMRVYFEKP-RTTV-GWKGLINDPHLDGSFDIEEG  123 (352)
T ss_pred             HHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCC-CCCC-CCCCCCCCCCCCCCCCHHHH
T ss_conf             996699983699972786789899999999999999986375799986410477-5456-75311558898998577778


Q ss_pred             CHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             12488899988665287688522889999876502157882257628999999985059779983677789999999999
Q gi|254780669|r  100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQ  179 (301)
Q Consensus       100 le~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~e  179 (301)
                      +..+.++|.++- +.|+|+.||+.+|.-...+++.+-+--||||..-..-=-+-++....||-+|+|..-++.-.+.|+.
T Consensus       124 l~~aR~ll~~i~-~lGlP~AtE~Ldp~~pqY~~DLiSWgAIGARTtESQ~HRelASgLs~PVGFKN~TdG~i~vAidai~  202 (352)
T PRK12755        124 LRIARRLLLDLA-ELGLPLATEALDPISPQYLGDLISWGAIGARTTESQTHREMASGLSMPVGFKNGTDGSLKVAINAIR  202 (352)
T ss_pred             HHHHHHHHHHHH-HCCCCCCHHHCCCCCHHHHHHHHHEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             999999999998-7389641011367763566554410222355322577888852788762003688875899999999


Q ss_pred             H------------------HHHCCCCCEEEEECCCCCCCHHHCCCC-CCCHHHHHHCCC--EEECHHHHHHHCCCCCCCC
Q ss_conf             9------------------972587808995146544401000000-010688851871--6871177742122345321
Q gi|254780669|r  180 K------------------LHAHGAKDVLFCERGTSFGYNTLVTDM-RSIPIMTSMGVP--VIFDASHSVQQPGIHGNCS  238 (301)
Q Consensus       180 k------------------i~~~Gn~~i~lcERG~~fgy~~lvvD~-~~i~~lk~~~~P--Vi~D~SHs~q~p~~~~~~~  238 (301)
                      -                  +...||.+--+.-||-.-|.|.--.+. .+...|++.++|  |++||||+      ++++-
T Consensus       203 aa~~~H~fl~i~~~G~~~iv~T~GN~~~HiILRGG~~~pNY~~~~v~~a~~~L~~~~l~~~ImIDcSHg------NS~Kd  276 (352)
T PRK12755        203 AAAQPHRFLGINQEGQVALLETRGNPDGHVILRGGKKGPNYDAASVAECEAALEKAGLRPRLMVDCSHA------NSGKD  276 (352)
T ss_pred             HHHCCCEEEEECCCCCEEEEEECCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCC------CCCCC
T ss_conf             961897778777999788998179987348986799999899999999999999749997358545666------55777


Q ss_pred             -CCCHHHHHHHHHHHHH---HCCCEEEEEECCCHHHCCCCC----------CCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             -2638899999999997---189889998369833479782----------018688999999999999999885
Q gi|254780669|r  239 -GGERQYIVPLAKAAVA---IGIAGIFLETHQDPDNAPSDG----------PNMINIKDLPKLLSQLLAIDKIIK  299 (301)
Q Consensus       239 -gG~r~~v~~la~aa~a---~G~dGlfiE~Hp~P~~AlsD~----------~q~l~l~~l~~ll~~l~~i~~~vk  299 (301)
                       --+..-+..++. -++   -.+-|+|+|.|-.+-+..-+.          .-.|..++-+.+|.++   ++.||
T Consensus       277 ~~~Q~~V~~~i~~-Qi~~G~~~I~GvMiES~L~eG~Q~i~~~~L~YG~SITDaCi~We~Te~lL~~l---a~av~  347 (352)
T PRK12755        277 YRRQPAVAEDVVA-QIAAGNRSIIGVMIESHLEEGNQSSPQPRLKYGVSITDACIGWETTEALLREL---AQALR  347 (352)
T ss_pred             HHHHHHHHHHHHH-HHHCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH---HHHHH
T ss_conf             6777799999999-99729871799999613545678899987658870244778968999999999---99999


No 15 
>PRK12822 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional
Probab=99.84  E-value=6.1e-19  Score=145.46  Aligned_cols=246  Identities=20%  Similarity=0.297  Sum_probs=178.6

Q ss_pred             CEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCC--CCEEEECCCCCCCCCCCCCCCCC--------------C
Q ss_conf             2797699706999548634999999999999999655339--97066015576886663222456--------------7
Q gi|254780669|r   36 QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN--IGLVYKSSFDKANRSSLAGKRGV--------------G   99 (301)
Q Consensus        36 ~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~--~~~ifK~sfdKanRtS~~sfrG~--------------G   99 (301)
                      +|--|.|.+|++|.|||||...+.+++.|+.|+++..++.  .-.+....|.|+ ||.. +|+|+              |
T Consensus        45 ~Il~G~D~RllvIvGPCSIHD~~aa~eYA~rL~~l~~~~~d~l~IVMRvYfEKP-RTtv-GWKGlinDP~ldgs~~I~~G  122 (356)
T PRK12822         45 NILLGKDPRLLVIIGPCSIHDPQAALEYAKRLAVLQHQYLDQLYIVMRTYFEKP-RTRK-GWKGLIFDPDLDGSNDIEKG  122 (356)
T ss_pred             HHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCC-CCCC-CCCCCCCCCCCCCCCCHHHH
T ss_conf             996599983799975887688699999999999999985275799985402588-4256-75400558999999487788


Q ss_pred             CHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             12488899988665287688522889999876502157882257628999999985059779983677789999999999
Q gi|254780669|r  100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQ  179 (301)
Q Consensus       100 le~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~e  179 (301)
                      +..+.++|.++ .+.|+|+.||..++.....+++.+-+--||||.....-=-+-++...-||-+|+|..-++.-.++|+.
T Consensus       123 l~~aR~lL~~i-~~lGlP~atE~Ldp~~pqY~~DLiSW~AIGARTtESQ~HRelASgLs~PVGFKN~T~G~i~vAidAi~  201 (356)
T PRK12822        123 LRLARQLLLSI-NTLGLATATEFLDTTSFPYIADLICWGAIGARTTESQVHRQLASALPCPVGFKNGTDGNIRIAIDAIL  201 (356)
T ss_pred             HHHHHHHHHHH-HHCCCCCCHHHCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHH
T ss_conf             99999999998-86499740021465677888877614201257542578999864899852430589874889999999


Q ss_pred             H------------------HHHCCCCCEEEEECCCCCCCHHHCCCC-CCCHHHHHHCCC--EEECHHHHHHHCCCCCCCC
Q ss_conf             9------------------972587808995146544401000000-010688851871--6871177742122345321
Q gi|254780669|r  180 K------------------LHAHGAKDVLFCERGTSFGYNTLVTDM-RSIPIMTSMGVP--VIFDASHSVQQPGIHGNCS  238 (301)
Q Consensus       180 k------------------i~~~Gn~~i~lcERG~~fgy~~lvvD~-~~i~~lk~~~~P--Vi~D~SHs~q~p~~~~~~~  238 (301)
                      -                  +...||.+--+.-||-.. .|.---+. .+...|++.++|  |++||||+      ++++-
T Consensus       202 aa~~~H~Fl~i~~~G~~~iv~T~GN~~~HvILRGG~~-PNY~~~~v~~~~~~l~~~~l~~~imVDcSHg------NS~Kd  274 (356)
T PRK12822        202 AARSPHLVTVPGLTGCISTLLSDGNPHGHIILRGGRE-PNYGLSDVTKASKLLHDEGLNHRLIIDCSHG------NSQKV  274 (356)
T ss_pred             HHHCCCEEEEECCCCCEEEEECCCCCCCEEEEECCCC-CCCCHHHHHHHHHHHHHCCCCCCEEEECCCC------CCCCC
T ss_conf             9843987898679996899981799872489867999-9989999999999999769894156404466------55546


Q ss_pred             -CCCHHHHHHHHHHHHHHC---CCEEEEEECCCHHHCCCCCC----------CCCCHHHHHHHHHHHH
Q ss_conf             -263889999999999718---98899983698334797820----------1868899999999999
Q gi|254780669|r  239 -GGERQYIVPLAKAAVAIG---IAGIFLETHQDPDNAPSDGP----------NMINIKDLPKLLSQLL  292 (301)
Q Consensus       239 -gG~r~~v~~la~aa~a~G---~dGlfiE~Hp~P~~AlsD~~----------q~l~l~~l~~ll~~l~  292 (301)
                       --+..-+..++. -+..|   +-|+|+|.|-++-+...|..          -.|..++-+.+|.+|-
T Consensus       275 ~~~Q~~V~~~V~~-Qi~~G~~~I~GvMiES~L~eG~Q~~~~~~L~YG~SITDaCI~We~Te~lL~~La  341 (356)
T PRK12822        275 AKNQISVARELCD-QLKEGEGAIAGVMVESFLQGGSQKADSAPLEYGQSVTDECLSWQDTEQLLNTLA  341 (356)
T ss_pred             HHHHHHHHHHHHH-HHHCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             7778999999999-997298717999996214345799988888688613738889689999999999


No 16 
>PRK09261 phospho-2-dehydro-3-deoxyheptonate aldolase; Validated
Probab=99.84  E-value=1e-18  Score=143.98  Aligned_cols=247  Identities=21%  Similarity=0.314  Sum_probs=180.1

Q ss_pred             CEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCC--CCEEEECCCCCCCCCCCCCCCCC--------------C
Q ss_conf             2797699706999548634999999999999999655339--97066015576886663222456--------------7
Q gi|254780669|r   36 QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN--IGLVYKSSFDKANRSSLAGKRGV--------------G   99 (301)
Q Consensus        36 ~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~--~~~ifK~sfdKanRtS~~sfrG~--------------G   99 (301)
                      +|--|.|.+|++|.||||+...+.+++.|+.|+++.+++.  .-.+....|.|+ ||.. +|+|+              |
T Consensus        45 ~Il~g~D~RllvivGPCSiHD~~aaleYA~rL~~l~~~~~d~l~IVMRvYfEKP-RTtv-GWKGli~DP~ldgs~~i~~G  122 (351)
T PRK09261         45 NILHGKDDRLLVVVGPCSIHDPKAALEYARRLAKLREELKDKLEIVMRVYFEKP-RTTV-GWKGLINDPDLDGSFDINKG  122 (351)
T ss_pred             HHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCC-CCCC-CCCCCCCCCCCCCCCCHHHH
T ss_conf             996599983699971786689899999999999999986375799986410477-5456-75311458898898567778


Q ss_pred             CHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             12488899988665287688522889999876502157882257628999999985059779983677789999999999
Q gi|254780669|r  100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQ  179 (301)
Q Consensus       100 le~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~e  179 (301)
                      +..+.++|-++ .+.|+|+.||..+|.-...+++.+-+--||||..-..-=-+-++....||-+|+|..-++.-.++|+.
T Consensus       123 l~~aR~ll~~i-~~lGlp~AtE~Ldp~~pqY~~DliSw~AIGART~ESQ~HRelASgLs~PVGfKN~TdG~i~vAidai~  201 (351)
T PRK09261        123 LRIARKLLLDI-NELGLPAATEFLDPITPQYIADLISWGAIGARTTESQVHRELASGLSCPVGFKNGTDGNIKVAIDAII  201 (351)
T ss_pred             HHHHHHHHHHH-HHCCCCCHHHHHCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHH
T ss_conf             99999999999-86599720556432343777666665431455333478898853788750113689874899999999


Q ss_pred             HH------------------HHCCCCCEEEEECCCCCCCHHHCCCCC-CCHHHHHHCC--CEEECHHHHHHHCCCCCCCC
Q ss_conf             99------------------725878089951465444010000000-1068885187--16871177742122345321
Q gi|254780669|r  180 KL------------------HAHGAKDVLFCERGTSFGYNTLVTDMR-SIPIMTSMGV--PVIFDASHSVQQPGIHGNCS  238 (301)
Q Consensus       180 ki------------------~~~Gn~~i~lcERG~~fgy~~lvvD~~-~i~~lk~~~~--PVi~D~SHs~q~p~~~~~~~  238 (301)
                      -.                  ...||.+--+.-||-.-|.|.-..+.. +...|++.++  .|++||||+      ++++-
T Consensus       202 aa~~~H~fl~i~~~G~~~~v~T~GN~~~HiILRGG~~gPNY~~~~V~~a~~~L~~~gl~~~imIDcSHg------NS~Kd  275 (351)
T PRK09261        202 AASAPHHFLGITKDGHSAIVSTTGNPDCHVILRGGNKGPNYDAESVAEAEERLEKAGLPPRIMIDCSHA------NSGKD  275 (351)
T ss_pred             HHHCCCEEEEECCCCCEEEEEECCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCC------CCCCC
T ss_conf             972897678876999788998279987259985798999989899999999999779897436535676------65777


Q ss_pred             C-CCHHHHHHHHHHHHHH---CCCEEEEEECCCHHHCCCCC-----------CCCCCHHHHHHHHHHHH
Q ss_conf             2-6388999999999971---89889998369833479782-----------01868899999999999
Q gi|254780669|r  239 G-GERQYIVPLAKAAVAI---GIAGIFLETHQDPDNAPSDG-----------PNMINIKDLPKLLSQLL  292 (301)
Q Consensus       239 g-G~r~~v~~la~aa~a~---G~dGlfiE~Hp~P~~AlsD~-----------~q~l~l~~l~~ll~~l~  292 (301)
                      - -+..-+..++. -+..   .+-|+|+|.|-++-+..-+.           .-.|..++=+.+|.++-
T Consensus       276 ~~~Q~~V~~~i~~-Qi~~G~~~I~GvMlES~L~eG~Q~~~~~~~L~YG~SITD~Ci~W~~Te~lL~~la  343 (351)
T PRK09261        276 HKRQPEVVRDVLE-QIAAGNKSIIGVMIESHLVEGNQDLPEGSPLTYGQSITDACIGWEDTEALLRELA  343 (351)
T ss_pred             HHHHHHHHHHHHH-HHHCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             6676699999999-9980987179999961353457899999988588602557789689999999999


No 17 
>TIGR00034 aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR006219   Members of this group catalyze the first enzymatic reaction of the shikimate pathway. The common (shikimate) pathway links metabolism of carbohydrates to biosynthesis of aromatic amino acids phenylalanine, tyrosine, tryptophan, and derivatives in microorganisms and in plants. In a sequence of seven enzymatic reactions, D-erythrose 4-phosphate (E4P), an intermediate of the pentose phosphate pathway, and phosphoenol pyruvate (PEP), a glycolytic intermediate, are converted to chorismate. The pathway begins with the stereospecific condensation of E4P and PEP to yield 7-phospho 2-dehydro 3-deoxy-D-arabino-heptulosonate (DAHP), catalyzed by 3-deoxy-7-phosphoheptulonate synthase (DAHPS) (EC 2.5.1.54, formerly EC 4.1.2.15). The divalent metal cation requirement of this enzyme can be satisfied by a broad range of metals . A Cys residue in a Cys-X-X-His motif has been identified as part of a metal binding site . In Escherichia coli, the enzyme exists in three isoforms, each specifically inhibited by one of the three aromatic amino acids.   DAHP synthetases fall into two classes, class I (represented by this entry) and class II (represented by PIRSF015573 from PIRSF). Class I was believed to be limited to microorganisms and class II to plants. However, a more recent study showed that class II also contains enzymes from a microbial eukaryote and several bacteria . Brick and Woodard  proposed that the difference between the two classes lies in their metal ion requirement for activity. Whereas class I requires no metal cation, class II is dependent on a metal cation for activity. However, recently a class I DAHP synthase from Thermotoga maritima has been purified, characterised, and shown to be a metalloenzyme .   The three-dimentional structures of DAHP synthases have been determined , , , , . The DAHPS(Phe) monomer is a (beta/alpha)8 barrel with an additional N-terminal beta strand and helices and an extra beta sheet near the C terminus . The active site is located in a cleft at the carboxyl end of the barrel . The allosteric feedback inhibition binding site of DAHPS(Phe) is composed of residues from two adjacent subunits of a tight dimer and is at least 20 angstroms away from the closest active site .   The absence of the shikimate pathway in animals makes it an attractive target for nontoxic herbicidal, antimicrobial, and antifungal agents. The nontoxic herbicide glyphosphate competitively inhibits 3-phosphoshikimate 1-carboxyvinyltransferase, the sixth enzymatic reaction of the pathway.; GO: 0003849 3-deoxy-7-phosphoheptulonate synthase activity, 0009073 aromatic amino acid family biosynthetic process.
Probab=99.80  E-value=1.5e-19  Score=149.52  Aligned_cols=244  Identities=24%  Similarity=0.374  Sum_probs=175.9

Q ss_pred             CCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCC--CCEEEECCCCCCCCCCCCCCCCC--------------
Q ss_conf             72797699706999548634999999999999999655339--97066015576886663222456--------------
Q gi|254780669|r   35 NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN--IGLVYKSSFDKANRSSLAGKRGV--------------   98 (301)
Q Consensus        35 ~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~--~~~ifK~sfdKanRtS~~sfrG~--------------   98 (301)
                      .+|--|.|.+|+||-|||||...+-+++.|..|+++.+++.  .-.|.+..|.|+ ||.+ +|.|+              
T Consensus        42 ~~I~~G~D~RLLVViGPCSiHDP~AA~eYA~RL~~L~~~l~~~L~IvMRvYfEKP-RTtV-GWKGLINDP~ln~sf~in~  119 (348)
T TIGR00034        42 ADILAGKDDRLLVVIGPCSIHDPEAAIEYATRLKKLREKLKDDLEIVMRVYFEKP-RTTV-GWKGLINDPDLNGSFRINK  119 (348)
T ss_pred             HHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCC-CCCC-CCCCCCCCCCCCCCCCHHH
T ss_conf             9985799976899975888574689999999999999875037607876431698-7010-3444458888888522025


Q ss_pred             CCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHH--HHH-HHHH-CCCEEEEECCCCCCHHHH
Q ss_conf             712488899988665287688522889999876502157882257628999--999-9850-597799836777899999
Q gi|254780669|r   99 GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTD--LLT-AAAQ-TGRVINVKKGQFLSPWEM  174 (301)
Q Consensus        99 Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtd--Ll~-a~a~-t~kpV~iKkgq~~s~~e~  174 (301)
                      ||.-+.++|-++ .+.|||+-+|..|+---+.+||.+-+=-|||   |+||  +=+ ++|- ---||-.|||---++.--
T Consensus       120 GL~iARkLL~~~-~~~GlP~a~EfLD~~sPQylADl~SwGAIGA---RTTESQ~HRrElASGLS~PVGFKNGTDG~~~vA  195 (348)
T TIGR00034       120 GLRIARKLLLDL-NNLGLPIAGEFLDMISPQYLADLVSWGAIGA---RTTESQVHRRELASGLSCPVGFKNGTDGNLKVA  195 (348)
T ss_pred             HHHHHHHHHHHH-HHCCCCCCCCCCCCCCHHHHHHHHHHHCCCC---CCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHH
T ss_conf             689999999888-6315763443124666378999997513220---122116679998754566334313578748899


Q ss_pred             HHHH------------------HHHHHCCCCCEEEEECCCCCCCHHHCCCCCCC-HHHHHHCCC--EEECHHHHHHHCCC
Q ss_conf             9999------------------99972587808995146544401000000010-688851871--68711777421223
Q gi|254780669|r  175 HNIL------------------QKLHAHGAKDVLFCERGTSFGYNTLVTDMRSI-PIMTSMGVP--VIFDASHSVQQPGI  233 (301)
Q Consensus       175 ~~a~------------------eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i-~~lk~~~~P--Vi~D~SHs~q~p~~  233 (301)
                      +.|+                  -=+...||++-.++-||=.-|.|.---|...+ ..|.+.+++  +++|+||+      
T Consensus       196 iDA~~AA~~~H~Fls~~k~G~~ai~~T~GN~~~HiILRGG~~GPNY~a~~V~~~~~~l~~~g~~~~lMiD~SHg------  269 (348)
T TIGR00034       196 IDAIRAAAAPHYFLSVTKDGQMAIVQTSGNPDGHIILRGGKKGPNYDAADVAEVKKQLEKAGLPEHLMIDFSHG------  269 (348)
T ss_pred             HHHHHHHHCCCEEECCCCCCCEEEEECCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCC------
T ss_conf             99999960698373126877367875267985248861687676889888999999997358998468871136------


Q ss_pred             CCCCC-CCCHHHHHHHHHHHHHHC---CCEEEEEECCCHHHCCC------CC----CCCCCHHHHHHHHHHH
Q ss_conf             45321-263889999999999718---98899983698334797------82----0186889999999999
Q gi|254780669|r  234 HGNCS-GGERQYIVPLAKAAVAIG---IAGIFLETHQDPDNAPS------DG----PNMINIKDLPKLLSQL  291 (301)
Q Consensus       234 ~~~~~-gG~r~~v~~la~aa~a~G---~dGlfiE~Hp~P~~Als------D~----~q~l~l~~l~~ll~~l  291 (301)
                      +.++- -=+.+-+...+. =++.|   +-|+|||.|-+--.--.      =|    +..|.-+.=+.||.+|
T Consensus       270 NS~Kd~~rQ~~V~~~v~~-QI~~G~~~i~GvMiES~l~EG~Q~~~~~~L~YG~SiTDaCigWe~t~~lL~~L  340 (348)
T TIGR00034       270 NSNKDFRRQPDVAEDVCE-QIANGSKAIIGVMIESFLVEGNQSIPGEGLKYGQSITDACIGWEDTEALLRQL  340 (348)
T ss_pred             CCCCCCCCHHHHHHHHHH-HHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHH
T ss_conf             775000231789999999-97353514787787875137622678877415621204768841089999999


No 18 
>COG0722 AroG 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]
Probab=99.72  E-value=2.6e-16  Score=128.19  Aligned_cols=247  Identities=21%  Similarity=0.326  Sum_probs=169.6

Q ss_pred             CCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCC--CCEEEECCCCCCCCCCCCCCCCC--------------
Q ss_conf             72797699706999548634999999999999999655339--97066015576886663222456--------------
Q gi|254780669|r   35 NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN--IGLVYKSSFDKANRSSLAGKRGV--------------   98 (301)
Q Consensus        35 ~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~--~~~ifK~sfdKanRtS~~sfrG~--------------   98 (301)
                      ..|.-|.|.+|+++-||||+..++.+++.|+.|++..+++.  .-.+.+..|.|+ ||. -+|+|+              
T Consensus        44 ~~Il~G~DdRLlvViGPCSiHD~~AAleYA~RL~~L~e~~~d~L~iVMRvYfeKP-RTt-VGWKGLInDP~ldgsf~i~~  121 (351)
T COG0722          44 EDILHGEDDRLLVVIGPCSIHDPEAALEYARRLKALREELKDRLEIVMRVYFEKP-RTT-VGWKGLINDPDLDGSFDINK  121 (351)
T ss_pred             HHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCEEEEEEEEECCC-CCC-CCCCCCCCCCCCCCCCCHHH
T ss_conf             9985699982799984786689799999999999999985275799988730378-666-66330146888889743778


Q ss_pred             CCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             71248889998866528768852288999987650215788225762899999998505977998367778999999999
Q gi|254780669|r   99 GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNIL  178 (301)
Q Consensus        99 Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~  178 (301)
                      |+.-+.++|..+ .++|+|+.||..++.-...+++.+-+--||||..-..--=+-++....||-+|+|..-++.-+..|+
T Consensus       122 GL~~aR~Ll~~v-~e~Glp~AtE~Ld~ispqy~aDLiSwgAIGARTtESQ~HRe~ASGLs~PvGFKNgTdGnl~vAidAi  200 (351)
T COG0722         122 GLRIARKLLLDV-NELGLPTATEFLDPISPQYLADLISWGAIGARTTESQIHRELASGLSCPVGFKNGTDGNLKVAIDAI  200 (351)
T ss_pred             HHHHHHHHHHHH-HHCCCCHHHHHHCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             999999999999-8639841677735676789999987762045510648899886205887645578986599999999


Q ss_pred             HH------------------HHHCCCCCEEEEECCCCCCCHHHCCCC-CCCHHHHHHCCC--EEECHHHHHHHCCCCCCC
Q ss_conf             99------------------972587808995146544401000000-010688851871--687117774212234532
Q gi|254780669|r  179 QK------------------LHAHGAKDVLFCERGTSFGYNTLVTDM-RSIPIMTSMGVP--VIFDASHSVQQPGIHGNC  237 (301)
Q Consensus       179 ek------------------i~~~Gn~~i~lcERG~~fgy~~lvvD~-~~i~~lk~~~~P--Vi~D~SHs~q~p~~~~~~  237 (301)
                      .-                  +...||++--++-||-.-+.|.-..+. .+...+.+.++|  +++||||+-      +++
T Consensus       201 ~AA~~~H~Fl~~~k~G~~aiv~T~GNp~~HvILRGG~~~PNYda~~v~~~~~~l~~~gl~~~lmID~SH~N------S~K  274 (351)
T COG0722         201 RAAAHPHHFLSVTKDGQVAIVETSGNPDGHVILRGGKKGPNYDAASVAAACEQLEKAGLPPRLMIDCSHAN------SGK  274 (351)
T ss_pred             HHHCCCCEEEECCCCCCEEEEECCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCC------CCC
T ss_conf             98508865761177871689975689873599317988999898999999999997699974898646775------664


Q ss_pred             -CCCCHHHHHHHHHHHHHHC---CCEEEEEECCCHHHCCCCC-----------CCCCCHHHHHHHHHHH
Q ss_conf             -1263889999999999718---9889998369833479782-----------0186889999999999
Q gi|254780669|r  238 -SGGERQYIVPLAKAAVAIG---IAGIFLETHQDPDNAPSDG-----------PNMINIKDLPKLLSQL  291 (301)
Q Consensus       238 -~gG~r~~v~~la~aa~a~G---~dGlfiE~Hp~P~~AlsD~-----------~q~l~l~~l~~ll~~l  291 (301)
                       ---+.+.+...+. -+++|   +-|+|||.|-.--.--.+.           .-.|.-++-+.||.++
T Consensus       275 ~~~~Q~~V~~~v~~-Qi~~G~~~I~GvMiES~L~eG~Q~~~~~~~l~yG~SITDaCigWe~Te~ll~~l  342 (351)
T COG0722         275 DYRRQPKVARDVCQ-QIAAGERAIRGVMIESHLVEGRQDLVQGQPLKYGVSITDACIGWEDTEALLREL  342 (351)
T ss_pred             CHHHHHHHHHHHHH-HHHCCCCEEEEEEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             76673899999999-986687605899870124316757788988726752344447826699999999


No 19 
>TIGR03586 PseI pseudaminic acid synthase.
Probab=99.37  E-value=2.2e-10  Score=89.17  Aligned_cols=231  Identities=19%  Similarity=0.241  Sum_probs=160.7

Q ss_pred             EEEEE--CCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC----------CCCC-----CCCCCCCCCCCCCCHHHHHH
Q ss_conf             69995--48634999999999999999655339-9706601----------5576-----88666322245671248889
Q gi|254780669|r   45 FVLIA--GPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS----------SFDK-----ANRSSLAGKRGVGLKKGREI  106 (301)
Q Consensus        45 l~iIA--GPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~----------sfdK-----anRtS~~sfrG~Gle~gL~i  106 (301)
                      .+|||  |.+---+.+++.++.+..++.|++.. .. .|++          .|..     .+++-..-|+..  +-.++|
T Consensus         2 p~IIAEIG~NHnGdl~~Ak~LI~~A~~sGaDaVKFQ-~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~l~~e~   78 (327)
T TIGR03586         2 PFIIAELSANHNGSLERALAMIEAAAAAGADAIKLQ-TYTADTITLDSDRPDFIIKGGLWDGRTLYELYQEA--HTPWEW   78 (327)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEC-CCCHHHEECCCCCHHHHCCCCCCCCEEHHHHHHHH--HCCHHH
T ss_conf             999998157867829999999999999299999933-60666603566546541147877880899999986--478999


Q ss_pred             ---HHHHHHHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             ---9988665287688522889999876502-157882257628999999985059779983677789999999999997
Q gi|254780669|r  107 ---FRDLKKKYGFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLH  182 (301)
Q Consensus       107 ---l~e~k~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~  182 (301)
                         |.+-.++.|+...+.+-+...++.+.+. +|.+-|++..+.|+.|+++++++++||.+=-|+ .+.+|...+++.+.
T Consensus        79 ~~~L~~~~k~~gI~f~~t~fd~~s~~~l~~l~~~~~KIaS~d~~n~~Li~~iak~~kpviiStG~-s~~~EI~~av~~~~  157 (327)
T TIGR03586        79 HKELFERAKELGLTIFSSPFDETAVDFLESLDVPAYKIASFEITDLPLIRYVAKTGKPIIMSTGI-ATLEEIEEAVEAAR  157 (327)
T ss_pred             HHHHHHHHHHCCCEEEECCCCHHHHHHHHHCCCCEEEECCHHHCCHHHHHHHHCCCCCEEEECCC-CCHHHHHHHHHHHH
T ss_conf             99999999985997997889979999998707995998941536656999986648867996888-75456788888776


Q ss_pred             HCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEE
Q ss_conf             258780899514654440100000001068885-1871687117774212234532126388999999999971898899
Q gi|254780669|r  183 AHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF  261 (301)
Q Consensus       183 ~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlf  261 (301)
                      ..||+++++-+=-+.+.-..--+.++.+..||+ +++||=+ -.|+           .|.     ..+.+|++.||.  .
T Consensus       158 ~~~~~~i~llhC~s~YPt~~~~~nL~~I~~lk~~f~~~vG~-SDHt-----------~g~-----~~~~~Ava~GA~--i  218 (327)
T TIGR03586       158 EAGCKDLVLLKCTSSYPAPLEDANLRTIPDLAERFNVPVGL-SDHT-----------LGI-----LAPVAAVALGAC--V  218 (327)
T ss_pred             HHCCCCEEECCCCCCCCCCHHHCCHHHHHHHHHHCCCCEEE-CCCC-----------CCC-----HHHHHHHHCCCE--E
T ss_conf             50255715652585899893774367899999974997583-8989-----------982-----679999986994--9


Q ss_pred             EEECCCHHHCCC--CCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             983698334797--8201868899999999999999988
Q gi|254780669|r  262 LETHQDPDNAPS--DGPNMINIKDLPKLLSQLLAIDKII  298 (301)
Q Consensus       262 iE~Hp~P~~Als--D~~q~l~l~~l~~ll~~l~~i~~~v  298 (301)
                      ||-|-..++.+.  |-.-+++|++|..+++.++.+..+.
T Consensus       219 IEKHfTld~~~~g~Dh~~Sl~p~e~~~~v~~ir~~~~~l  257 (327)
T TIGR03586       219 IEKHFTLDRSDGGVDSAFSLEPDEFKALVKETRNAWLAL  257 (327)
T ss_pred             EEEEEECCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHC
T ss_conf             998777689999986676099999999999999999981


No 20 
>pfam03102 NeuB NeuB family. NeuB is the prokaryotic N-acetylneuraminic acid (Neu5Ac) synthase. It catalyses the direct formation of Neu5Ac (the most common sialic acid) by condensation of phosphoenolpyruvate (PEP) and N-acetylmannosamine (ManNAc). This reaction has only been observed in prokaryotes; eukaryotes synthesize the 9-phosphate form, Neu5Ac-9-P, and utilize ManNAc-6-P instead of ManNAc. Such eukaryotic enzymes are not present in this family. This family also contains SpsE spore coat polysaccharide biosynthesis proteins.
Probab=99.37  E-value=1.4e-10  Score=90.47  Aligned_cols=176  Identities=20%  Similarity=0.326  Sum_probs=139.0

Q ss_pred             HHHHHHHHHHHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             88899988665287688522889999876502-15788225762899999998505977998367778999999999999
Q gi|254780669|r  103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKL  181 (301)
Q Consensus       103 gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki  181 (301)
                      -..-|.+-.++.|+...+.+-+.+.++.+.+. +|.+-|++..+.|.+|+++++++++||.|--| ..+.+|...+++.+
T Consensus        57 ~~~~l~~~~kk~gi~f~~t~fd~~s~~~l~~l~~~~~KIaS~d~~n~~Li~~i~k~~kpiiiSTG-~s~~~eI~~~i~~~  135 (240)
T pfam03102        57 WHKELFEYCKEKGIEFFSTPFDLESVDFLESLGVPAYKIASGEITNLPLLRYIAKTGKPVILSTG-MATLEEIEEAVETL  135 (240)
T ss_pred             HHHHHHHHHHHCCCCEEECCCCHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHH
T ss_conf             99999999998299689898989999988755888699898864658999999973996899579-88899999999999


Q ss_pred             HHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEE
Q ss_conf             7258780899514654440100000001068885-187168711777421223453212638899999999997189889
Q gi|254780669|r  182 HAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI  260 (301)
Q Consensus       182 ~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGl  260 (301)
                      ...+++++++-+==+.+.-..--+.++.+..||+ +.+||=+- .|+.           |     ...+.+|++.||.  
T Consensus       136 ~~~~~~~i~llhCvS~YPt~~~~~nL~~I~~lk~~f~~~iG~S-dHs~-----------g-----~~~~~~A~~~GA~--  196 (240)
T pfam03102       136 REAGNEDITLLHCTSEYPAPFEDVNLRAIPTLKEAFGVPVGYS-DHTL-----------G-----IEAPIAAVALGAS--  196 (240)
T ss_pred             HHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEC-CCCC-----------C-----CHHHHHHHHCCCC--
T ss_conf             9634567768665888999746600999889998679968847-9889-----------7-----0777999982993--


Q ss_pred             EEEECCCHHHCC--CCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             998369833479--78201868899999999999999988
Q gi|254780669|r  261 FLETHQDPDNAP--SDGPNMINIKDLPKLLSQLLAIDKII  298 (301)
Q Consensus       261 fiE~Hp~P~~Al--sD~~q~l~l~~l~~ll~~l~~i~~~v  298 (301)
                      +||-|-..++.+  .|...+++|++|+.+++.++.+..+.
T Consensus       197 iiEKH~tl~~~~~g~D~~~Sl~~~e~~~~v~~ir~~~~~l  236 (240)
T pfam03102       197 VIEKHFTLDRNLPGPDHKASLEPDELKELVKDIRNVEKAL  236 (240)
T ss_pred             EEEEEEECCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHC
T ss_conf             9998765589999995564399999999999999999970


No 21 
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase. This family is a subset of the pfam03102 and is believed to include only authentic NeuB N-acetylneuraminate (sialic acid) synthase enzymes. The majority of the genes identified by this model are observed adjacent to both the NeuA and NeuC genes which together effect the biosynthesis of CMP-N-acetylneuraminate from UDP-N-acetylglucosamine.
Probab=99.27  E-value=5.9e-09  Score=79.80  Aligned_cols=227  Identities=17%  Similarity=0.260  Sum_probs=159.2

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC-----------CCCCCC----CCCCCCCCC--CCCHHHHHHHHHHH
Q ss_conf             48634999999999999999655339-9706601-----------557688----666322245--67124888999886
Q gi|254780669|r   50 GPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS-----------SFDKAN----RSSLAGKRG--VGLKKGREIFRDLK  111 (301)
Q Consensus        50 GPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~-----------sfdKan----RtS~~sfrG--~Gle~gL~il~e~k  111 (301)
                      |.+---+.+++.++.+..++.|++.. .. .|.+           .|.+.+    ++...-|+.  +..+ -..-|.+-.
T Consensus         8 g~NH~Gdl~~Ak~LI~~A~~sGadaVKFQ-~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~kk~els~~-~~~~L~~~~   85 (329)
T TIGR03569         8 GVNHNGSLELAKKLVDAAAEAGADAVKFQ-TFKAEDLVSKNAPKAEYQKINTGAEESQLEMLKKLELSEE-DHRELKEYC   85 (329)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCEEEEE-CCCCCHHCCCCCCHHHCCCCCCCCCCCHHHHHHHHCCCHH-HHHHHHHHH
T ss_conf             78767809999999999999496999930-7871132781103033012689888619999987148999-999999999


Q ss_pred             HHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCC--CC
Q ss_conf             65287688522889999876502-1578822576289999999850597799836777899999999999972587--80
Q gi|254780669|r  112 KKYGFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGA--KD  188 (301)
Q Consensus       112 ~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn--~~  188 (301)
                      ++.|+...+.+-+...++.+.+. +|.+-|++..+.|.+||++++++++||.+=-|+. +.+|...|++.+...|+  .+
T Consensus        86 ~~~gi~~~~s~fd~~s~~~l~~~~~~~~KIaS~d~~n~~Li~~i~~~~kpiiiStG~s-~~~EI~~av~~~~~~~~~~~~  164 (329)
T TIGR03569        86 ESKGIEFLSTPFDLESADFLEDLGVPRFKIPSGEITNAPLLKKIARFGKPVILSTGMA-TLEEIEAAVGVLRDAGTPDSN  164 (329)
T ss_pred             HHHCCEEEECCCCHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHCCCEEEECCCC-HHHHHHHHHHHHHHCCCCCCC
T ss_conf             9729929989698999999986499979979231054899999997489789967862-399999999999974886557


Q ss_pred             EEEEECCCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             899514654440100000001068885-1871687117774212234532126388999999999971898899983698
Q gi|254780669|r  189 VLFCERGTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD  267 (301)
Q Consensus       189 i~lcERG~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~  267 (301)
                      ++|-+=-+.+.-..--+.++.+..||+ +++||=+ -.|+.           |     ...+.+|++.||.  +||-|-.
T Consensus       165 i~llhC~s~YP~~~~~~nL~~i~~lk~~f~~~iG~-SDHt~-----------g-----~~~~~~Ava~GA~--vIEKHfT  225 (329)
T TIGR03569       165 ITLLHCTTEYPAPFEDVNLNAMDTLKEAFDLPVGY-SDHTL-----------G-----IEAPIAAVALGAT--VIEKHFT  225 (329)
T ss_pred             EEEEEECCCCCCCHHHCCHHHHHHHHHHCCCCEEE-CCCCC-----------C-----CHHHHHHHHCCCE--EEEEEEE
T ss_conf             68864378899993764789999999985998684-79789-----------8-----3679999986996--9998777


Q ss_pred             HHHCCC--CCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             334797--8201868899999999999999988
Q gi|254780669|r  268 PDNAPS--DGPNMINIKDLPKLLSQLLAIDKII  298 (301)
Q Consensus       268 P~~Als--D~~q~l~l~~l~~ll~~l~~i~~~v  298 (301)
                      .++.+.  |-.-+++|++|..+++.++.+..+.
T Consensus       226 ldk~~~g~D~~~Sl~p~e~k~lv~~i~~~~~~l  258 (329)
T TIGR03569       226 LDKNLPGPDHKASLEPDELKEMVQGIRNVEKAL  258 (329)
T ss_pred             CCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHC
T ss_conf             689999996787099999999999999999981


No 22 
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane]
Probab=99.26  E-value=1.4e-08  Score=77.26  Aligned_cols=237  Identities=15%  Similarity=0.212  Sum_probs=168.6

Q ss_pred             CCEEECCCCCEEEEE--CCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCCCCCCCCCCCC-------------
Q ss_conf             727976997069995--48634999999999999999655339-97066015576886663222456-------------
Q gi|254780669|r   35 NQVTFSNEQRFVLIA--GPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGV-------------   98 (301)
Q Consensus        35 ~~i~ig~~~~l~iIA--GPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKanRtS~~sfrG~-------------   98 (301)
                      ++-+||.+++.++||  |-+---|-|.+.++-+..++.|++.. ..-.|-     +..-|+.+++.+             
T Consensus         5 g~r~i~~~~~~~iIAEig~NHnG~le~A~~lIdaAk~aGADavKfQt~~~-----~d~~t~~~~~~~~~i~~~~~~~sly   79 (347)
T COG2089           5 GNRTIGKDKKPFIIAEIGANHNGDLERAKELIDAAKEAGADAVKFQTFYT-----PDIMTLESKNVPFKIKTLWDKVSLY   79 (347)
T ss_pred             CCEEECCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCC-----CCCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             76433589995799641455657589999999999973866555320356-----3100403357765555565666399


Q ss_pred             --------CCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCC
Q ss_conf             --------712488899988665287688522889999876502-15788225762899999998505977998367778
Q gi|254780669|r   99 --------GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFL  169 (301)
Q Consensus        99 --------Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~  169 (301)
                              -+++-..+++.+ ++-|+-+.|-.-+..-++.+... ++.+-|+.+-+-+++||+-+|+.+||+.+--|+ .
T Consensus        80 el~e~~~~p~e~~~~Lke~a-~~~Gi~~~SSPfd~~svd~l~~~~~~ayKIaS~E~~~~plik~iA~~~kPiIlSTGm-a  157 (347)
T COG2089          80 ELYEEAETPLEWHAQLKEYA-RKRGIIFFSSPFDLTAVDLLESLNPPAYKIASGEINDLPLIKYIAKKGKPIILSTGM-A  157 (347)
T ss_pred             HHHHHHCCCHHHHHHHHHHH-HHCCEEEEECCCCHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCCEEEECCC-C
T ss_conf             99998449999999999999-872938981678878899998569983773474335758999999639977997466-4


Q ss_pred             CHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHH
Q ss_conf             9999999999997258780899514654440100000001068885-187168711777421223453212638899999
Q gi|254780669|r  170 SPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPL  248 (301)
Q Consensus       170 s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~l  248 (301)
                      +..|+..|++-+...||.+++|-+--+++.-..--+.+..++-|++ ++.+|=+ --|+.           |  -+   .
T Consensus       158 ~~~ei~~av~~~r~~g~~~i~LLhC~s~YPap~ed~nL~~i~~l~~~Fn~~vGl-SDHT~-----------g--~~---a  220 (347)
T COG2089         158 TIEEIEEAVAILRENGNPDIALLHCTSAYPAPFEDVNLKAIPKLAEAFNAIVGL-SDHTL-----------G--IL---A  220 (347)
T ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCC-CCCCC-----------C--HH---H
T ss_conf             077799999999966998769998357899977773488799999996876156-66765-----------3--16---7


Q ss_pred             HHHHHHHCCCEEEEEECCCHHHCC--CCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             999997189889998369833479--7820186889999999999999998
Q gi|254780669|r  249 AKAAVAIGIAGIFLETHQDPDNAP--SDGPNMINIKDLPKLLSQLLAIDKI  297 (301)
Q Consensus       249 a~aa~a~G~dGlfiE~Hp~P~~Al--sD~~q~l~l~~l~~ll~~l~~i~~~  297 (301)
                      ..+|+|+|+.  .||-|-.=++.+  -|...++.|++|+.++..++.+..+
T Consensus       221 ~l~AvALGA~--viEKHFtldk~~~GpD~afSldP~efk~mv~~ir~~~~a  269 (347)
T COG2089         221 PLAAVALGAS--VIEKHFTLDKSREGPDHAFSLDPDEFKEMVDAIRQVEKA  269 (347)
T ss_pred             HHHHHHHCCC--CEEEEEEECCCCCCCCCCEECCHHHHHHHHHHHHHHHHH
T ss_conf             8999872100--100003214777899711113889999999999999998


No 23 
>pfam03599 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit.
Probab=96.89  E-value=0.048  Score=34.34  Aligned_cols=220  Identities=15%  Similarity=0.119  Sum_probs=133.3

Q ss_pred             EEECCCCCCEEECCCCC-----------EEEEECCCCCCCHHHHHHHHHHHHHHHHH--CCCCEEEECCCCCCCCCCCCC
Q ss_conf             68357877279769970-----------69995486349999999999999996553--399706601557688666322
Q gi|254780669|r   28 IHLGSGKNQVTFSNEQR-----------FVLIAGPCQIESHDHAFMIAEKLYAICQS--LNIGLVYKSSFDKANRSSLAG   94 (301)
Q Consensus        28 ~~ig~~~~~i~ig~~~~-----------l~iIAGPCsiES~e~~~~~A~~lk~~~~~--~~~~~ifK~sfdKanRtS~~s   94 (301)
                      |.||.|...+++||+.=           ..+----|--.+++.+....+.++++...  .-+|-.+|.-+=- -|.    
T Consensus         2 V~iG~G~~~~~iGGE~VLyRHektf~npt~ia~dv~D~m~~~ei~a~~~~i~~v~~~~~~rVG~~l~~D~ia-v~~----   76 (384)
T pfam03599         2 VVFGAGEKAVVIGGEEVLYRFELPFPNPTAITIDVFDNLSPELLKARRERIEDVMFDPKKRVGEKLTLDMIA-IRL----   76 (384)
T ss_pred             EEECCCCEEEEECCEEEEEECCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHHHHHHCCCCEEE-EEE----
T ss_conf             586679636998783688746625679982699953887767799999998752132222221220233899-990----


Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCC---EEEECHHHCCCH-HHHHHHHHCCCEEEEECCCCCC
Q ss_conf             245671248889998866528768852288999987650215---788225762899-9999985059779983677789
Q gi|254780669|r   95 KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD---ILQIPALLCRQT-DLLTAAAQTGRVINVKKGQFLS  170 (301)
Q Consensus        95 frG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vD---ilQIgA~~~rqt-dLl~a~a~t~kpV~iKkgq~~s  170 (301)
                      -.|-. ++-.+..+++.+..++|++----++.-++..++++-   -|=-+|-.- |+ ++...+.+.+.||.++-+  .+
T Consensus        77 ~s~dp-~~fa~~vk~V~~~~~~pliL~~~dp~vl~aale~~~~~rPLlyaAt~~-N~~~m~~lA~~~~~Pv~v~a~--~d  152 (384)
T pfam03599        77 ISTDP-KEFAKAVEKVLQAVDVPLVIGGSDPEVLKAALEVAEDERPLLYAATLD-NYKEIAELALEYKHPVLLWSI--ND  152 (384)
T ss_pred             CCCCH-HHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHCCCCCEEEECCHH-HHHHHHHHHHHCCCCEEEECC--CC
T ss_conf             78999-999999999996469988998089999999999746589778548998-999999999974982899748--88


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEE------ECCCCCCCHHHCCCCCCCHHHH--HHCCCEEECHHHHHHHCCCCCCCCCCCH
Q ss_conf             9999999999972587808995------1465444010000000106888--5187168711777421223453212638
Q gi|254780669|r  171 PWEMHNILQKLHAHGAKDVLFC------ERGTSFGYNTLVTDMRSIPIMT--SMGVPVIFDASHSVQQPGIHGNCSGGER  242 (301)
Q Consensus       171 ~~e~~~a~eki~~~Gn~~i~lc------ERG~~fgy~~lvvD~~~i~~lk--~~~~PVi~D~SHs~q~p~~~~~~~gG~r  242 (301)
                      ++++..-++++.+.|.+++.|=      .+|....+.|+ +-+|-..+.+  .+++|++.=|+-+-           +.+
T Consensus       153 l~~l~~L~~~l~~~GikdlVLDPgT~~~g~~l~~t~~n~-~~IRRaAlkgdr~lgyPi~~~~~~a~-----------~~~  220 (384)
T pfam03599       153 LNELKNLNRKLLKAGVKDIVLDPTTEALGYGIKDTIDNF-VRIRRAAIKGDKDLGFPISSGTTNAW-----------GAR  220 (384)
T ss_pred             HHHHHHHHHHHHHCCCCCEEECCCCCCCCCCHHHHHHHH-HHHHHHHHCCCCCCCCCEEECCCCCC-----------HHH
T ss_conf             999999999999769854898898866674689999999-99999986579778885551456664-----------036


Q ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCHHHCC
Q ss_conf             899999999997189889998369833479
Q gi|254780669|r  243 QYIVPLAKAAVAIGIAGIFLETHQDPDNAP  272 (301)
Q Consensus       243 ~~v~~la~aa~a~G~dGlfiE~Hp~P~~Al  272 (301)
                      +.    --+....-+.++++=-..+|..++
T Consensus       221 ~~----~~~~~~~kYa~i~vl~~~~~~~~l  246 (384)
T pfam03599       221 ES----WMVNLMNRYADILILRGDDIWELM  246 (384)
T ss_pred             HH----HHHHHHHHHCCEEEECCCCHHHHH
T ss_conf             88----999999875768997379888860


No 24 
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain.  DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively. DHPD catalyzes the first step in pyrimidine degradation: the NADPH-dependent reduction of uracil and thymine to the corresponding 5,6-dihydropyrimidines. DHPD contains two FAD, two FMN and eight [4Fe-4S] clusters, arranged in two electron transfer chains that pass its homodimeric interface twice. Two of
Probab=96.88  E-value=0.049  Score=34.30  Aligned_cols=101  Identities=15%  Similarity=0.230  Sum_probs=76.1

Q ss_pred             CCCCCCCHHHHHHHHHHHHHH-CCEEEEECCCH------HHHHHHHHH-CCEEEE---------CHHHCCCHHHHHHHHH
Q ss_conf             224567124888999886652-87688522889------999876502-157882---------2576289999999850
Q gi|254780669|r   94 GKRGVGLKKGREIFRDLKKKY-GFPILTDVHTE------QQCEAIADS-VDILQI---------PALLCRQTDLLTAAAQ  156 (301)
Q Consensus        94 sfrG~Gle~gL~il~e~k~~~-glpv~TeV~~~------~~~e~~~~~-vDilQI---------gA~~~rqtdLl~a~a~  156 (301)
                      ++...|.+.-++.+++.++++ +.|++--|.-.      +-++.+.++ +|.+.+         +..++++.+++.++.+
T Consensus        76 g~~n~g~~~~~~~l~~~~~~~~~~pli~Si~~~~~~~~~~~a~~~~~~gad~lElNiScPn~~~~~~~~~~~~~~~~i~~  155 (289)
T cd02810          76 GLPNLGLDVWLQDIAKAKKEFPGQPLIASVGGSSKEDYVELARKIERAGAKALELNLSCPNVGGGRQLGQDPEAVANLLK  155 (289)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHH
T ss_conf             46787889999999999861799539997888987899999999998479848998403675655320149999999999


Q ss_pred             -----CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             -----59779983677789999999999997258780899514
Q gi|254780669|r  157 -----TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       157 -----t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                           +++||.+|=+.+.+..+....++.+...|.+-|.++-+
T Consensus       156 ~v~~~~~~Pv~vKLsp~~~~~~~~~ia~~~~~~ga~gv~~~Nt  198 (289)
T cd02810         156 AVKAAVDIPLLVKLSPYFDLEDIVELAKAAERAGADGLTAINT  198 (289)
T ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             9986026874884278876168999999999759968999678


No 25 
>cd00423 Pterin_binding Pterin binding enzymes. This family includes dihydropteroate synthase (DHPS) and cobalamin-dependent methyltransferases such as methyltetrahydrofolate, corrinoid iron-sulfur protein methyltransferase (MeTr) and methionine synthase (MetH).  DHPS, a functional homodimer, catalyzes the condensation of p-aminobenzoic acid (pABA) in the de novo biosynthesis of folate, which is an essential cofactor in both nucleic acid and protein biosynthesis. Prokaryotes (and some lower eukaryotes) must synthesize folate de novo, while higher eukaryotes are able to utilize dietary folate and therefore lack DHPS.  Sulfonamide drugs, which are substrate analogs of pABA, target DHPS.  Cobalamin-dependent methyltransferases catalyze the transfer of a methyl group via a methyl- cob(III)amide intermediate.  These include MeTr, a functional heterodimer, and the folate binding domain of MetH.
Probab=96.80  E-value=0.056  Score=33.89  Aligned_cols=203  Identities=18%  Similarity=0.230  Sum_probs=130.8

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHH
Q ss_conf             34999999999999999655339-97066015576886663222456712488899988665287688522889999876
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAI  131 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~  131 (301)
                      ...+++.+++-|+.+.+-|++.. +|+.-  +-+.+.+-|+  -.  .++.-+..++.+++++++|+--|-..++-++.+
T Consensus        19 ~~~~~~~a~~~a~~~i~~GAdiIDIG~eS--TrPg~~~i~~--~e--E~~Rl~pvl~~i~~~~~v~iSIDT~~~~Va~~a   92 (258)
T cd00423          19 KFLSLDKALEHARRMVEEGADIIDIGGES--TRPGAEPVSV--EE--ELERVIPVLRALAGEPDVPISVDTFNAEVAEAA   92 (258)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCCC--CCCCCCCCCH--HH--HHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHH
T ss_conf             67899999999999998799999979877--8999974777--88--888850056887427996099979888999999


Q ss_pred             HH-HCCEEE-ECHHHCCCHHHHHHHHHCCCEEEEE----CCCCC-------C-HHH----HHHHHHHHHHCCC-CCEEEE
Q ss_conf             50-215788-2257628999999985059779983----67778-------9-999----9999999972587-808995
Q gi|254780669|r  132 AD-SVDILQ-IPALLCRQTDLLTAAAQTGRVINVK----KGQFL-------S-PWE----MHNILQKLHAHGA-KDVLFC  192 (301)
Q Consensus       132 ~~-~vDilQ-IgA~~~rqtdLl~a~a~t~kpV~iK----kgq~~-------s-~~e----~~~a~eki~~~Gn-~~i~lc  192 (301)
                      .+ .+|++- |-++. ...+++.-+++.+.|+.+=    +++.+       . +.+    +..-++++.+.|- .+=++.
T Consensus        93 l~~G~~iINDVsg~~-~d~~m~~~va~~~~~~ilmH~~~~p~~~~~~~~~~~~~~~v~~~~~~~i~~~~~~Gi~~~~Iii  171 (258)
T cd00423          93 LKAGADIINDVSGGR-GDPEMAPLAAEYGAPVVLMHMDGTPQTMQNNPYYADVVDEVVEFLEERVEAATEAGIPPEDIIL  171 (258)
T ss_pred             HHCCCCEEECCHHHH-CCHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHEEEE
T ss_conf             985998682400310-6557999999749988983057886556668986648999999999999999986999300887


Q ss_pred             ECCCCCCCH--HHCCCCCCCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHH--HHHHHHHCCCEEEEEECC
Q ss_conf             146544401--000000010688851-87168711777421223453212638899999--999997189889998369
Q gi|254780669|r  193 ERGTSFGYN--TLVTDMRSIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPL--AKAAVAIGIAGIFLETHQ  266 (301)
Q Consensus       193 ERG~~fgy~--~lvvD~~~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~l--a~aa~a~G~dGlfiE~Hp  266 (301)
                      .=|+-||.+  ...--++++..++++ ++|+.+-.|-=-+.....+... ..|. ..++  +..|+..|++  ++-||.
T Consensus       172 DPGiGFgK~~~~n~~ll~~l~~~~~~~g~PilvG~SRKsfi~~~~~~~~-~~Rl-~~t~a~~~~a~~~Ga~--ilRvHd  246 (258)
T cd00423         172 DPGIGFGKTEEHNLELLRRLDAFRELPGLPLLLGVSRKSFLGDLLSVGP-KDRL-AGTAAFLAAAILNGAD--IVRVHD  246 (258)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHHHHHHCCCCH-HHHH-HHHHHHHHHHHHCCCC--EEEECC
T ss_conf             4776778887889999997999972159946986029899987549986-8740-9899999999987999--999589


No 26 
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes. DHPS (dihydropteroate synthase), a functional homodimer, catalyzes the condensation of p-aminobenzoic acid (pABA) in the de novo biosynthesis of folate, which is an essential cofactor in both nucleic acid and protein biosynthesis. Prokaryotes (and some lower eukaryotes) must synthesize folate de novo, while higher eukaryotes are able to utilize dietary folate and therefore lack DHPS.  Sulfonamide drugs, which are substrate analogs of pABA, target DHPS.
Probab=96.17  E-value=0.14  Score=31.38  Aligned_cols=204  Identities=20%  Similarity=0.215  Sum_probs=129.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHH
Q ss_conf             999999999999999655339-9706601557688666322245671248889998866528768852288999987650
Q gi|254780669|r   55 ESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIAD  133 (301)
Q Consensus        55 ES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~  133 (301)
                      -+.+.+++-|+.+.+-|++.. +|+-  ++-+.+..  +....+  ++.-+.+++.+++++++++--|-..++-++.+.+
T Consensus        21 ~~~~~a~~~a~~~i~~GAdiIDIGae--STrPg~~~--is~~eE--~~Rl~pvi~~l~~~~~~~iSIDT~~~~Va~~al~   94 (257)
T cd00739          21 LSLDKAVAHAEKMIAEGADIIDIGGE--STRPGADP--VSVEEE--LERVIPVLEALRGELDVLISVDTFRAEVARAALE   94 (257)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCC--CCCCCCCC--CCHHHH--HHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHH
T ss_conf             89999999999999879989997987--58999986--998888--9889999999986079828997997599999998


Q ss_pred             -HCCEEE-ECHHHCCCHHHHHHHHHCCCEEEEECCCC-----------CC----HH-HHHHHHHHHHHCCCC-CEEEEEC
Q ss_conf             -215788-22576289999999850597799836777-----------89----99-999999999725878-0899514
Q gi|254780669|r  134 -SVDILQ-IPALLCRQTDLLTAAAQTGRVINVKKGQF-----------LS----PW-EMHNILQKLHAHGAK-DVLFCER  194 (301)
Q Consensus       134 -~vDilQ-IgA~~~rqtdLl~a~a~t~kpV~iKkgq~-----------~s----~~-e~~~a~eki~~~Gn~-~i~lcER  194 (301)
                       .+|++- |-++. .+.++++.+++.+.|+.+-.-+.           -.    .. .+..-++.+.+.|-. +=++..=
T Consensus        95 ~Ga~iINDisg~~-~d~~m~~~va~~~~~~ilmH~~g~p~~m~~~~~~~dv~~~i~~~f~~~i~~l~~~Gi~~~~IiiDP  173 (257)
T cd00739          95 AGADIINDVSGGS-DDPAMLEVAAEYGAPLVLMHMRGTPKTMQENPYYEDVVDEVLSFLEARLEAAESAGVARNRIILDP  173 (257)
T ss_pred             CCCCEEECCCCCC-CCHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEC
T ss_conf             4998997534244-777899999984999999768998422233786330999999999999999998799825199708


Q ss_pred             CCCCCCHHH--CCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             654440100--0000010688851871687117774212234532126388999999999971898899983698
Q gi|254780669|r  195 GTSFGYNTL--VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD  267 (301)
Q Consensus       195 G~~fgy~~l--vvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~  267 (301)
                      |+-||-+.-  .-=++++..++.+++|+++-.|-=-..-.-.+..... | ...++|-++.++.--.=++-||.-
T Consensus       174 G~GFgKt~~~n~~ll~~l~~f~~~~~PiLvG~SRKsfi~~~~~~~~~~-r-l~gTla~~~~~~~~Ga~ilRvHdV  246 (257)
T cd00739         174 GIGFGKTPEHNLELLRRLDELKQLGLPVLVGASRKSFIGALLGREPKD-R-DWGTLALSALAAANGADIVRVHDV  246 (257)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHCCCCHHH-H-HHHHHHHHHHHHHCCCCEEEECCH
T ss_conf             878788879999999989999528998277502989999874999688-4-289999999999879999995998


No 27 
>pfam01474 DAHP_synth_2 Class-II DAHP synthetase family. Members of this family are aldolase enzymes that catalyse the first step of the shikimate pathway.
Probab=96.04  E-value=0.11  Score=32.02  Aligned_cols=148  Identities=17%  Similarity=0.171  Sum_probs=90.1

Q ss_pred             CCEEEECHHHCCC-HHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC-CEEEEECCCCCCCHHHCCC--CCCC
Q ss_conf             1578822576289-9999998505977998367778999999999999725878-0899514654440100000--0010
Q gi|254780669|r  135 VDILQIPALLCRQ-TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAK-DVLFCERGTSFGYNTLVTD--MRSI  210 (301)
Q Consensus       135 vDilQIgA~~~rq-tdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~-~i~lcERG~~fgy~~lvvD--~~~i  210 (301)
                      .-++|||-|.-|- -.=++=+....-||-+|=|..++++|.+..++++.-.... .+.|+-|   ||.++. -+  ..-|
T Consensus       256 aH~lWIGeRTRqldgAHVef~rgI~NPIGvKvGP~~~~~el~~l~~~LnP~~epGRltLI~R---mGa~~v-~~~LP~li  331 (437)
T pfam01474       256 AHFLWIGERTRQLDGAHVEFLRGIANPIGVKVGPSTTPDELLRLIDRLNPDNEPGRLTLITR---MGADKV-REVLPPLI  331 (437)
T ss_pred             CCCCEECCCCCCCCCCHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCCCCEEEEEEC---CCHHHH-HHHHHHHH
T ss_conf             54110033335887348999860678705667999999999999997398889973999852---671789-87729999


Q ss_pred             HHHHHHCCCEE--ECHHHHHHHCCCCCCCCCCCHHHHHH---HH--HHHHHHCCCEEEEEECCCHHHCCCCCCCCCCHHH
Q ss_conf             68885187168--71177742122345321263889999---99--9999718988999836983347978201868899
Q gi|254780669|r  211 PIMTSMGVPVI--FDASHSVQQPGIHGNCSGGERQYIVP---LA--KAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD  283 (301)
Q Consensus       211 ~~lk~~~~PVi--~D~SHs~q~p~~~~~~~gG~r~~v~~---la--~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l~l~~  283 (301)
                      ...++.+.||+  |||-|.--.-.+.|-+|---.+.+..   .-  ..+...-.-|+-+|.-++.-.--.+|.+.+.-++
T Consensus       332 ~aV~~~g~~VvW~cDPMHGNT~~~~~G~KTR~f~~I~~Ev~~ff~ih~~~gt~~GGlHLE~Tg~dVTEC~gg~~~i~~~d  411 (437)
T pfam01474       332 RAVKAEGRNVVWSCDPMHGNTIKASSGYKTRHFDDILDEVRGFFEVHRAEGTHPGGVHLEMTGEDVTECLGGARGITEED  411 (437)
T ss_pred             HHHHHCCCCEEEEECCCCCCCEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCEECCCCCCCCCCCC
T ss_conf             99997799708970798786403799851576899999999999999975986675888833898304179975456100


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780669|r  284 LPK  286 (301)
Q Consensus       284 l~~  286 (301)
                      |..
T Consensus       412 L~~  414 (437)
T pfam01474       412 LSD  414 (437)
T ss_pred             CCC
T ss_conf             001


No 28 
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively.
Probab=95.68  E-value=0.22  Score=29.98  Aligned_cols=152  Identities=13%  Similarity=0.156  Sum_probs=86.3

Q ss_pred             EEECCCCCEEEEECCCCCCCHHHHHHHHHH------HHHHHHHCCCCEEEECCCCCCCCCCC--CCCCCCCCHHHHHHHH
Q ss_conf             797699706999548634999999999999------99965533997066015576886663--2224567124888999
Q gi|254780669|r   37 VTFSNEQRFVLIAGPCQIESHDHAFMIAEK------LYAICQSLNIGLVYKSSFDKANRSSL--AGKRGVGLKKGREIFR  108 (301)
Q Consensus        37 i~ig~~~~l~iIAGPCsiES~e~~~~~A~~------lk~~~~~~~~~~ifK~sfdKanRtS~--~sfrG~Gle~gL~il~  108 (301)
                      ++|-  +|+.+=|||+. .+.+........      ++.+..+ -+.+--||-+.+-.+...  .+|...|.+.-++-++
T Consensus         7 l~~~--nPi~lAAG~~~-~~~~~~~~~~~~g~G~v~~~Tvt~~-p~~Gn~~PR~~~~~~~~iN~~G~~n~G~~~~~~~l~   82 (296)
T cd04740           7 LRLK--NPVILASGTFG-FGEELSRVADLGKLGAIVTKSITLE-PREGNPPPRVVETPGGMLNAIGLQNPGVEAFLEELL   82 (296)
T ss_pred             EECC--CCCEECCCCCC-CCHHHHHHHHHCCCCEEEECCCCCC-CCCCCCCCCEEECCHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             8579--98787867899-8399999988589638993804703-145899981781541167652378886489998789


Q ss_pred             HHHHHHCCEEEEECCC--HH----HHHHHHHH-CCEEEE----------CHHHCCCHHH----HHHHHH-CCCEEEEECC
Q ss_conf             8866528768852288--99----99876502-157882----------2576289999----999850-5977998367
Q gi|254780669|r  109 DLKKKYGFPILTDVHT--EQ----QCEAIADS-VDILQI----------PALLCRQTDL----LTAAAQ-TGRVINVKKG  166 (301)
Q Consensus       109 e~k~~~glpv~TeV~~--~~----~~e~~~~~-vDilQI----------gA~~~rqtdL----l~a~a~-t~kpV~iKkg  166 (301)
                      +.++++++|++--|.-  ++    -++.+.++ +|.+-|          +....++.++    +.++.+ +.+||.+|=.
T Consensus        83 ~~~~~~~~pvi~si~~~~~~d~~~~~~~~~~~gad~ielNiScPNt~~~g~~~~~~~~~~~~i~~~vk~~~~~Pi~vKls  162 (296)
T cd04740          83 PWLREFGTPVIASIAGSTVEEFVEVAEKLADAGADAIELNISCPNVKGGGMAFGTDPEAVAEIVKAVKKATDVPVIVKLT  162 (296)
T ss_pred             HHHCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             86356897189981689878999999998864898899978899867636775749999999999998604896699718


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             7789999999999997258780899514
Q gi|254780669|r  167 QFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       167 q~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      ...  .+....++.+...|.+-|+++-+
T Consensus       163 P~~--~~i~~ia~~~~~~g~dgiv~~NT  188 (296)
T cd04740         163 PNV--TDIVEIARAAEEAGADGLTLINT  188 (296)
T ss_pred             CCC--CHHHHHHHHHHHCCCCEEEEECC
T ss_conf             980--00999999999769988999746


No 29 
>pfam01207 Dus Dihydrouridine synthase (Dus). Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archae. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. Dus 1 from Saccharomyces cerevisiae acts on pre-tRNA-Phe, while Dus 2 acts on pre-tRNA-Tyr and pre-tRNA-Leu. Dus 1 is active as a single subunit, requiring NADPH or NADH, and is stimulated by the presence of FAD. Some family members may be targeted to the mitochondria and even have a role in mitochondria.
Probab=95.51  E-value=0.22  Score=30.06  Aligned_cols=80  Identities=24%  Similarity=0.291  Sum_probs=31.2

Q ss_pred             CHHHCCCHHHHHHHHH-----CCCEEEEEC--CCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH
Q ss_conf             2576289999999850-----597799836--777899999999999972587808995146544401000000010688
Q gi|254780669|r  141 PALLCRQTDLLTAAAQ-----TGRVINVKK--GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM  213 (301)
Q Consensus       141 gA~~~rqtdLl~a~a~-----t~kpV~iKk--gq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l  213 (301)
                      ||.|+++.+++.++-+     +++||-+|-  |.--+.++....++.+.+.|...+.+--|=-.=.|.. ..|...+..+
T Consensus       100 GsaLl~~p~~~~~iv~a~~~~~~~PVtvK~RlG~d~~~~~~~~~~~~l~~~G~~~itvH~Rt~~q~~~g-~a~w~~i~~~  178 (309)
T pfam01207       100 GAALLRDPDLVAQIVKAVVKAVDIPVTVKIRIGWDESHENAVEIARRVEDAGAQALTVHGRTRAQNYEG-PADWDAIKQV  178 (309)
T ss_pred             CEEHHHCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCHHHCCCC-CCCHHHHHHH
T ss_conf             762541778999999999975588546754337887638899999999846888799967632402678-6541899999


Q ss_pred             HH-HCCCEE
Q ss_conf             85-187168
Q gi|254780669|r  214 TS-MGVPVI  221 (301)
Q Consensus       214 k~-~~~PVi  221 (301)
                      |+ ..+|||
T Consensus       179 k~~~~ipvi  187 (309)
T pfam01207       179 KQAVSIPVI  187 (309)
T ss_pred             HHHCCCCEE
T ss_conf             985898289


No 30 
>KOG2335 consensus
Probab=95.21  E-value=0.26  Score=29.46  Aligned_cols=108  Identities=19%  Similarity=0.219  Sum_probs=59.1

Q ss_pred             ECHHHCCCHHHHHHH-----HHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCC-CCCCHHHCCCCCCCHHH
Q ss_conf             225762899999998-----505977998367778999999999999725878089951465-44401000000010688
Q gi|254780669|r  140 IPALLCRQTDLLTAA-----AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGT-SFGYNTLVTDMRSIPIM  213 (301)
Q Consensus       140 IgA~~~rqtdLl~a~-----a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~-~fgy~~lvvD~~~i~~l  213 (301)
                      .||+||.|.+|+.++     ++++-||-+|=-.|-++++-..-+..+..+|..-+.+--|-- .=|-..-..|..+|-.+
T Consensus       118 yGa~L~~~~eLv~e~V~~v~~~l~~pVs~KIRI~~d~~kTvd~ak~~e~aG~~~ltVHGRtr~~kg~~~~pad~~~i~~v  197 (358)
T KOG2335         118 YGAFLMDNPELVGEMVSAVRANLNVPVSVKIRIFVDLEKTVDYAKMLEDAGVSLLTVHGRTREQKGLKTGPADWEAIKAV  197 (358)
T ss_pred             CCCEECCCHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCHHHCCCCCCCCCHHHHHHH
T ss_conf             26000238899999999998525998699998557678789999999867986899936557762888887677999999


Q ss_pred             HH-HC-CCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             85-18-7168711777421223453212638899999999997189889998
Q gi|254780669|r  214 TS-MG-VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       214 k~-~~-~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      |+ .. +|||..                |+=..+...-+.....|+||+|.-
T Consensus       198 ~~~~~~ipviaN----------------GnI~~~~d~~~~~~~tG~dGVM~a  233 (358)
T KOG2335         198 RENVPDIPVIAN----------------GNILSLEDVERCLKYTGADGVMSA  233 (358)
T ss_pred             HHHCCCCCEEEE----------------CCCCCHHHHHHHHHHHCCCEEEEC
T ss_conf             974767708950----------------885768999999997587468860


No 31 
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional
Probab=95.11  E-value=0.34  Score=28.77  Aligned_cols=148  Identities=15%  Similarity=0.212  Sum_probs=79.4

Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCHHHHHHHHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             48889998866528768852288999987650-21578822576289999999850597799836777899999999999
Q gi|254780669|r  102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQK  180 (301)
Q Consensus       102 ~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~ek  180 (301)
                      +-|.-|.+...++|+-++.|||+..+++.+.+ .++++-|-.||-++++                   .+++....-+.+
T Consensus       147 ~~l~~l~~~a~~lgl~~LvEvh~~~el~~a~~~~~~iiGiNnRnL~tf~-------------------vdl~~t~~l~~~  207 (459)
T PRK09427        147 EQYRQLAAVAHSLNMGVLTEVSNEEELERAIALGAKVIGINNRNLRDLS-------------------IDLNRTRELAPL  207 (459)
T ss_pred             HHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHCCCCEEEEECCCCCCEE-------------------ECHHHHHHHHHH
T ss_conf             9999999999982990799968999999998489998998789886214-------------------877999999976


Q ss_pred             HHHCCCCCEEEEECCCCCCCHHHCCCCC--------CCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             9725878089951465444010000000--------10688851871687117774212234532126388999999999
Q gi|254780669|r  181 LHAHGAKDVLFCERGTSFGYNTLVTDMR--------SIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAA  252 (301)
Q Consensus       181 i~~~Gn~~i~lcERG~~fgy~~lvvD~~--------~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa  252 (301)
                      +   -...+.+.|-|+.. ..+. -.++        +=..||.      =||+.+++.--.+..+..|-+..  .-+++|
T Consensus       208 i---p~~~~~vsESGI~~-~~dv-~~l~~~~~~~LvGe~lmr~------~d~~~~~r~l~~g~~KICGIT~~--eDA~~a  274 (459)
T PRK09427        208 I---PADVTVISESGIYT-HAQV-RELSPFVNGFLIGSSLMAE------DDLDLAVRKLILGENKVCGLTRP--QDAKAA  274 (459)
T ss_pred             C---CCCCEEEECCCCCC-HHHH-HHHHHHCCEEEECHHHHCC------CCHHHHHHHHHCCCCCCCCCCCH--HHHHHH
T ss_conf             8---99974997379999-9999-9998439999978587579------99899999973789846789989--999999


Q ss_pred             HHHCCC--EEEEEECCCHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             971898--89998369833479782018688999999999
Q gi|254780669|r  253 VAIGIA--GIFLETHQDPDNAPSDGPNMINIKDLPKLLSQ  290 (301)
Q Consensus       253 ~a~G~d--GlfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~~  290 (301)
                      ..+|+|  |+..  +|.       +|-.+++++-..+++.
T Consensus       275 ~~~GAD~iGfIF--~~~-------SpR~Vs~e~Ak~I~~~  305 (459)
T PRK09427        275 YDAGAVYGGLIF--VEK-------SPRYVSLEQAQEIIAA  305 (459)
T ss_pred             HHCCCCEEEEEE--ECC-------CCCCCCHHHHHHHHHH
T ss_conf             984999898997--269-------8887999999999986


No 32 
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only]
Probab=94.78  E-value=0.29  Score=29.20  Aligned_cols=82  Identities=17%  Similarity=0.240  Sum_probs=62.1

Q ss_pred             HHHHHHHHHHHCCEEEEECCCHHHHH-HHHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             88999886652876885228899998-7650-215788225762899999998505977998367778999999999999
Q gi|254780669|r  104 REIFRDLKKKYGFPILTDVHTEQQCE-AIAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKL  181 (301)
Q Consensus       104 L~il~e~k~~~glpv~TeV~~~~~~e-~~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki  181 (301)
                      .+-.+++.++|+++     ......+ .+++ -+|++-|.+-+-...++..++-+.||+|++-||..+|++|....++-.
T Consensus        40 ~~~a~~~a~~~~~~-----~~~~~~~~ll~~~~iD~V~Iatp~~~H~~~a~~AL~aGkhVl~EKPla~t~~ea~~l~~~a  114 (342)
T COG0673          40 PERAEAFAEEFGIA-----KAYTDLEELLADPDIDAVYIATPNALHAELALAALEAGKHVLCEKPLALTLEEAEELVELA  114 (342)
T ss_pred             HHHHHHHHHHCCCC-----CCCCCHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             89999999981997-----4529999994599998899969806779999999977996999289989999999999999


Q ss_pred             HHCCCCCEEE
Q ss_conf             7258780899
Q gi|254780669|r  182 HAHGAKDVLF  191 (301)
Q Consensus       182 ~~~Gn~~i~l  191 (301)
                      ... +..++.
T Consensus       115 ~~~-g~~l~v  123 (342)
T COG0673         115 RKA-GVKLMV  123 (342)
T ss_pred             HHC-CCEEEE
T ss_conf             975-994999


No 33 
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
Probab=94.76  E-value=0.32  Score=28.94  Aligned_cols=77  Identities=19%  Similarity=0.267  Sum_probs=61.6

Q ss_pred             HHHHHHHHHHCCEEEEECCCHHHHHHHH-HHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8999886652876885228899998765-021578822576289999999850597799836777899999999999972
Q gi|254780669|r  105 EIFRDLKKKYGFPILTDVHTEQQCEAIA-DSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHA  183 (301)
Q Consensus       105 ~il~e~k~~~glpv~TeV~~~~~~e~~~-~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~  183 (301)
                      +-.++.+++|++++.++   .+  +.+. +-+|++-|-......+++...+.+.|++|++-||...+++|.....+....
T Consensus        37 ~~~~~~~~~~~~~~~~~---~~--~~l~~~~iD~v~I~tp~~~H~~~~~~~l~~g~~v~~EKP~~~~~~e~~~l~~~a~~  111 (120)
T pfam01408        37 ARAEAVAESFGVPAYSD---LE--ELLADPDVDAVSVATPPGLHFELALAALEAGKHVLVEKPLATTVEEAKELVELAEK  111 (120)
T ss_pred             HHHHHHHHHHCCCEECC---HH--HHHHCCCCCEEEECCCHHHHHHHHHHHHHHCCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             99999999839967886---99--99737788989990874618999999998199899968981999999999999998


Q ss_pred             CCC
Q ss_conf             587
Q gi|254780669|r  184 HGA  186 (301)
Q Consensus       184 ~Gn  186 (301)
                      .|.
T Consensus       112 ~~~  114 (120)
T pfam01408       112 KGV  114 (120)
T ss_pred             CCC
T ss_conf             299


No 34 
>PRK11613 folP dihydropteroate synthase; Provisional
Probab=94.72  E-value=0.43  Score=28.11  Aligned_cols=205  Identities=17%  Similarity=0.169  Sum_probs=130.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHH
Q ss_conf             999999999999999655339-9706601557688666322245671248889998866528768852288999987650
Q gi|254780669|r   55 ESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIAD  133 (301)
Q Consensus        55 ES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~  133 (301)
                      -+.+.+++-|+.+.+-|+... +|+-  +|-+.+.+  +....+  ++--+.+++.+++++++++--|-..++-++.+.+
T Consensus        35 ~~~~~a~~~a~~mi~~GAdiIDIGge--STrPga~~--vs~eeE--~~Rl~pvi~~i~~~~~v~iSIDT~~~~Va~~ale  108 (282)
T PRK11613         35 NSLIDAVKHANLMINAGATIIDVGGE--STRPGAAE--VSVEEE--LDRVIPVVEAIAQRFEVWISVDTSKPEVIRESAK  108 (282)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCC--CCCCCCCC--CCHHHH--HHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHH
T ss_conf             89999999999999889969997982--58998986--898999--9999999999997359729997998899999996


Q ss_pred             -HCCEEE-ECHHHCCCHHHHHHHHHCCCEEEEECCCC--C-------------CHHH-HHHHHHHHHHCCCC-CEEEEEC
Q ss_conf             -215788-22576289999999850597799836777--8-------------9999-99999999725878-0899514
Q gi|254780669|r  134 -SVDILQ-IPALLCRQTDLLTAAAQTGRVINVKKGQF--L-------------SPWE-MHNILQKLHAHGAK-DVLFCER  194 (301)
Q Consensus       134 -~vDilQ-IgA~~~rqtdLl~a~a~t~kpV~iKkgq~--~-------------s~~e-~~~a~eki~~~Gn~-~i~lcER  194 (301)
                       .+||+- |.++  +.-+++..+++.+.|+.+=.-+.  -             ...+ +...++++.+.|-+ +=++..=
T Consensus       109 ~Ga~iINDIsg~--~d~~~~~~va~~~~~~vlmH~~g~p~~m~~~~~y~dvi~~v~~~f~~~i~~~~~~Gi~~~~IilDP  186 (282)
T PRK11613        109 AGAHIINDIRSL--SEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKEKLLLDP  186 (282)
T ss_pred             CCCCEEECCCCC--CCHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECC
T ss_conf             397888663212--486599999972998899806899855332676352799999999999999998799947499806


Q ss_pred             CCCCCCHHH--CCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHH
Q ss_conf             654440100--000001068885187168711777421223453212638899999999997189889998369833
Q gi|254780669|r  195 GTSFGYNTL--VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD  269 (301)
Q Consensus       195 G~~fgy~~l--vvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~  269 (301)
                      |+-||.+.-  .-=++++..++++++|+.+-.|+--..-.-.+. ....| ...++|-++.++---.=++-||.-.+
T Consensus       187 GiGFgK~~~~n~~ll~~l~~~~~lg~PiLvG~SRKsfig~~~~~-~~~eR-l~gTla~~~~a~~~Ga~ilRVHDV~e  261 (282)
T PRK11613        187 GFGFGKNLSHNYQLLARLAEFHHFNLPLLVGMSRKSMIGQLLNV-GPSER-LSGSLACAVIAAMQGAQIIRVHDVKE  261 (282)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHCC-CHHHH-HHHHHHHHHHHHHCCCCEEEECCHHH
T ss_conf             87767887889999983899853799879970477899987189-96870-37999999999987999999589899


No 35 
>KOG2741 consensus
Probab=94.70  E-value=0.12  Score=31.63  Aligned_cols=77  Identities=17%  Similarity=0.226  Sum_probs=63.6

Q ss_pred             HHHHHHHHCCEEEEECCCHHHHHHHHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCC
Q ss_conf             998866528768852288999987650-2157882257628999999985059779983677789999999999997258
Q gi|254780669|r  107 FRDLKKKYGFPILTDVHTEQQCEAIAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHG  185 (301)
Q Consensus       107 l~e~k~~~glpv~TeV~~~~~~e~~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~G  185 (301)
                      =++-.+.+++|  +.=+..+.=|.+.+ -||++-|+.-|++.++.+.-+..-+|+|++-|+..++..|....+|...+.|
T Consensus        46 A~~fAq~~~~~--~~k~y~syEeLakd~~vDvVyi~~~~~qH~evv~l~l~~~K~VL~EKPla~n~~e~~~iveaA~~rg  123 (351)
T KOG2741          46 AKEFAQRHNIP--NPKAYGSYEELAKDPEVDVVYISTPNPQHYEVVMLALNKGKHVLCEKPLAMNVAEAEEIVEAAEARG  123 (351)
T ss_pred             HHHHHHHCCCC--CCCCCCCHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHCC
T ss_conf             99999865999--8742557998824987687996799800899999999759957865655388999999999999769


No 36 
>pfam09370 TIM-br_sig_trns TIM-barrel signal transduction protein. This domain is likely to have a TIM barrel fold related to IGPS. Although this family of proteins are functionally uncharacterized this domain is found as an N-terminal domain of sigma 54 -dependent transcriptional activators (enhancer-binding proteins) suggesting a potential role in signal recognition/receiving and signal transduction.
Probab=94.60  E-value=0.29  Score=29.18  Aligned_cols=136  Identities=18%  Similarity=0.255  Sum_probs=84.7

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCC
Q ss_conf             69995486349999999999999996553399706601557688666322245671248889998866528768852288
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHT  124 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~  124 (301)
                      ..+|||-|.-+-+-.+....+.+++.|-.-..++===.-+|=.-|... -..|.|.+.-.++++.+++ .|+..+-=|-+
T Consensus        82 tPViaGv~~tDP~~~~~~~L~~l~~~GfsGV~NfPTvglidG~fR~~L-EetGmgy~~EVEmIr~A~~-~dl~T~~yvf~  159 (268)
T pfam09370        82 TPVLAGVCGTDPFRDMDRFLDELKEMGFAGVQNFPTVGLIDGEFRQNL-EETGMGYDLEVEMIRLAHE-KGLLTTPYVFN  159 (268)
T ss_pred             CCEEEECCCCCCCCCHHHHHHHHHHHCCCCEEECCCEEEECCHHHHHH-HHCCCCHHHHHHHHHHHHH-CCCCCCCEECC
T ss_conf             875876158897452999999999719774443882203351888778-8808867999999999997-79833313268


Q ss_pred             HHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHC-CCEEEEECCCCCCHHHHHHHHHHHHHC---CCCC-EEEEECCC
Q ss_conf             9999876502-15788225762899999998505-977998367778999999999999725---8780-89951465
Q gi|254780669|r  125 EQQCEAIADS-VDILQIPALLCRQTDLLTAAAQT-GRVINVKKGQFLSPWEMHNILQKLHAH---GAKD-VLFCERGT  196 (301)
Q Consensus       125 ~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t-~kpV~iKkgq~~s~~e~~~a~eki~~~---Gn~~-i~lcERG~  196 (301)
                      ++|+..+++. +|||=.--            +-| +--+--++.  .|++|....++.+...   =|++ |+||+-|-
T Consensus       160 ~e~a~~Ma~AGaDiIv~H~------------GlT~gG~iG~~~a--~sl~~a~~~~~~i~~aa~~v~~diIvLchGGp  223 (268)
T pfam09370       160 VEEARAMAEAGADIIVAHM------------GLTTGGTIGADTA--LSLDDCVELINAIARAARSVNPDVIVLCHGGP  223 (268)
T ss_pred             HHHHHHHHHCCCCEEEECC------------CCCCCCCCCCCCC--CCHHHHHHHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             9999999974998999767------------7677767467776--78999999999999999985998699951788


No 37 
>PRK10415 tRNA-dihydrouridine synthase B; Provisional
Probab=94.58  E-value=0.46  Score=27.90  Aligned_cols=112  Identities=15%  Similarity=0.189  Sum_probs=68.9

Q ss_pred             ECHHHCCCHHHHHHHHH-----CCCEEEEECCC--CCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHH
Q ss_conf             22576289999999850-----59779983677--789999999999997258780899514654440100000001068
Q gi|254780669|r  140 IPALLCRQTDLLTAAAQ-----TGRVINVKKGQ--FLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI  212 (301)
Q Consensus       140 IgA~~~rqtdLl~a~a~-----t~kpV~iKkgq--~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~  212 (301)
                      -||.|+++.+++.++-+     ++.||-+|==.  ..+.......+..+.+.|..-|.+--|=-.-.|+- ..|...|..
T Consensus       110 ~GsaLl~~p~~~~~iv~a~~~a~~iPVTvKiRlG~~~~~~~~~~~~~~~e~aG~~~itvHgRT~~q~y~g-~adw~~i~~  188 (321)
T PRK10415        110 AGSALLQYPDLVKSILTEVVNAVDVPVTLKIRTGWAPEHRNCEEIAQLAEDCGIQALTIHGRTRACLFNG-EAEYDSIRA  188 (321)
T ss_pred             CEEEHHCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHCC-CCCHHHHHH
T ss_conf             3650633989999999999734487469998468885224399999999856988999972213443169-987799999


Q ss_pred             HHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE--ECCCH
Q ss_conf             885-187168711777421223453212638899999999997189889998--36983
Q gi|254780669|r  213 MTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE--THQDP  268 (301)
Q Consensus       213 lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE--~Hp~P  268 (301)
                      +|+ ...|||..           |    +-..+- ..-+.---.|+||+||=  .--||
T Consensus       189 vk~~~~iPvi~N-----------G----DI~~~~-da~~~l~~tg~dgvMigRgal~nP  231 (321)
T PRK10415        189 VKQKVSIPVIAN-----------G----DITDPL-KARAVLDYTGADALMIGRAAQGRP  231 (321)
T ss_pred             HHHCCCCCEEEC-----------C----CCCCHH-HHHHHHHHHCCCEEEECHHHHCCC
T ss_conf             985479978965-----------8----919999-999999862999999756653698


No 38 
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism]
Probab=94.43  E-value=0.12  Score=31.83  Aligned_cols=97  Identities=20%  Similarity=0.167  Sum_probs=61.9

Q ss_pred             CCCCCCCHHHHHHHHHHHHHH---CCEEEEECCC--HHH-------HHHHHHHCCEEEEC--------HHHCC-CH----
Q ss_conf             224567124888999886652---8768852288--999-------98765021578822--------57628-99----
Q gi|254780669|r   94 GKRGVGLKKGREIFRDLKKKY---GFPILTDVHT--EQQ-------CEAIADSVDILQIP--------ALLCR-QT----  148 (301)
Q Consensus        94 sfrG~Gle~gL~il~e~k~~~---glpv~TeV~~--~~~-------~e~~~~~vDilQIg--------A~~~r-qt----  148 (301)
                      +|.-+|.+.-++-++..+.+.   ++++..-+..  ++.       ++.+.+ +|.+-+-        -|..+ +.    
T Consensus        72 G~~N~G~~~~~~~l~~~~~~~~~~~~~i~~~~~~~~~~~~~d~~~~~~~~~~-ad~ielNiScPnt~g~~~l~~~~e~l~  150 (310)
T COG0167          72 GFNNPGADAFLEELKLAKYEGKPIGVNIGKNKGGPSEEAWADYARLLEEAGD-ADAIELNISCPNTPGGRALGQDPELLE  150 (310)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCC-CCEEEEECCCCCCCCHHHHCCCHHHHH
T ss_conf             8986528999999886400147767634887578857889999999975077-887999853899977466543999999


Q ss_pred             HHHHHHHH-CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             99999850-5977998367778999999999999725878089951
Q gi|254780669|r  149 DLLTAAAQ-TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCE  193 (301)
Q Consensus       149 dLl~a~a~-t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcE  193 (301)
                      +|+.++.+ +.+||.+|=..  +..++..+++.+...|-+-|+++-
T Consensus       151 ~l~~~vk~~~~~Pv~vKl~P--~~~di~~iA~~~~~~g~Dgl~~~N  194 (310)
T COG0167         151 KLLEAVKAATKVPVFVKLAP--NITDIDEIAKAAEEAGADGLIAIN  194 (310)
T ss_pred             HHHHHHHHCCCCCEEEEECC--CHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             99999986356865999388--889999999999974985899970


No 39 
>PRK08318 dihydropyrimidine dehydrogenase; Validated
Probab=93.97  E-value=0.61  Score=27.07  Aligned_cols=147  Identities=15%  Similarity=0.172  Sum_probs=87.0

Q ss_pred             CEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCC-CCCCCCCC------------CCCC-----
Q ss_conf             27976997069995486349999999999999996553399706601557-68866632------------2245-----
Q gi|254780669|r   36 QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFD-KANRSSLA------------GKRG-----   97 (301)
Q Consensus        36 ~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfd-KanRtS~~------------sfrG-----   97 (301)
                      ++++-  +|+.+=|||-+ .+.+++.+..+    .|.   -+.+.|.-++ ..|..+|.            +|..     
T Consensus        10 Gl~lk--NP~~lASgp~t-~~~~~i~~~~~----aG~---GaVV~KTl~~~~~~~~~pr~~~~~~~~~~~~G~~N~elis   79 (413)
T PRK08318         10 GIKSP--NPFWLASAPPT-NKYYNVARAFE----AGW---GGVVWKTLGPFIVNVSSPRFDALVKEDRRFIGFNNIELIT   79 (413)
T ss_pred             CEECC--CCCEECCCCCC-CCHHHHHHHHH----CCC---EEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCC
T ss_conf             99818--97678986788-99999999987----695---3999050787677889998257357762423623742134


Q ss_pred             -CCCHHHHHHHHHHHHHH-CCEEEEECCC---HHH-H---HHHHHH-CCEEEE-------------CHHHCCCHHHHHHH
Q ss_conf             -67124888999886652-8768852288---999-9---876502-157882-------------25762899999998
Q gi|254780669|r   98 -VGLKKGREIFRDLKKKY-GFPILTDVHT---EQQ-C---EAIADS-VDILQI-------------PALLCRQTDLLTAA  154 (301)
Q Consensus        98 -~Gle~gL~il~e~k~~~-glpv~TeV~~---~~~-~---e~~~~~-vDilQI-------------gA~~~rqtdLl~a~  154 (301)
                       .+++.-|+-++++|+++ +.|++.-|+-   .+. .   ..+.+. +|.|.+             |+-.-|+.+++..+
T Consensus        80 d~~le~~L~~i~~~k~~~P~~~vIaSI~g~~~~e~w~~la~~~e~~GaDalELNiSCPn~~~~~~~G~~~gq~pe~v~~i  159 (413)
T PRK08318         80 DRPLEVNLREIRRVKRDYPDRALIASIMVECNEEEWKEIAPLVEETGADGIELNFGCPHGMSERGMGSAVGQVPELVEMV  159 (413)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHCCCHHHHHHH
T ss_conf             45899999999998860789708999945878899999999866518877999555677666665551105799999999


Q ss_pred             HH-----CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             50-----59779983677789999999999997258780899514
Q gi|254780669|r  155 AQ-----TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       155 a~-----t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      -+     +++||.+|=....+  ++...+....+.|.+-|.++-+
T Consensus       160 ~~~Vk~~~~iPV~vKLsPnvt--di~~iA~aa~~aGADgv~liNT  202 (413)
T PRK08318        160 TRWVKRGSRLPVIAKLTPNIT--DIREPARAAKRGGADAVSLINT  202 (413)
T ss_pred             HHHHHHHCCCCEEEEECCCCC--CHHHHHHHHHHCCCCEEEEEEC
T ss_conf             999885068856998289975--2899999999769988999814


No 40 
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional
Probab=93.89  E-value=0.24  Score=29.76  Aligned_cols=181  Identities=15%  Similarity=0.200  Sum_probs=109.1

Q ss_pred             EECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHH
Q ss_conf             95486349999999999999996553399706601557688666322245671248889998866528768852288999
Q gi|254780669|r   48 IAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQ  127 (301)
Q Consensus        48 IAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~  127 (301)
                      -+|--.-|.+..       +.+-++-+..+-.-++--        +-.+-|.+.+   ..+.+.+=+|+-.+-=|+-.+.
T Consensus        27 ~gg~lt~ea~ka-------~~~~gdgysvcd~C~~~L--------D~i~~Ppi~~---f~~~la~flg~D~~rlvnGar~   88 (386)
T PRK09331         27 RGGRLTPEARKA-------LIEYGDGYSVCDYCKGRL--------DKIEKPPIAD---FHEDLAKFLGMDEARVTPGARE   88 (386)
T ss_pred             HCCCCCHHHHHH-------HHHHCCCCCHHHHHCCHH--------HCCCCCCHHH---HHHHHHHHHCCCEEEECCCCCH
T ss_conf             269689999999-------999748873664541101--------1255998899---9999999849963785288427


Q ss_pred             HHH-----HHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEEC----CCCCCHHHHHHHHHHHHHC-C-CCCEE-EEECC
Q ss_conf             987-----65021578822576289999999850597799836----7778999999999999725-8-78089-95146
Q gi|254780669|r  128 CEA-----IADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK----GQFLSPWEMHNILQKLHAH-G-AKDVL-FCERG  195 (301)
Q Consensus       128 ~e~-----~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKk----gq~~s~~e~~~a~eki~~~-G-n~~i~-lcERG  195 (301)
                      --.     +.+-=|-+=+| |||.-+.++-+.-.-..|+-+-.    .+..+++.....+|.+... | ++.++ +++--
T Consensus        89 g~qAv~~a~c~~GD~VIl~-rnaHyS~~~A~elaG~~~~~v~~~~~~~~~I~~~~~~~~Iee~~~e~gk~~aL~llt~pd  167 (386)
T PRK09331         89 GKFAVMHALCKKGDYVVLD-GLAHYTSYVAAERAGLNVREVPKTGYPDYRITPEAYAEKIEEVEDETGKPPALALLTHVD  167 (386)
T ss_pred             HHHHHHHHHHCCCCEEEEC-CCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             8999999863699979844-840599999999759858993687772345080057999999998618985599996888


Q ss_pred             CCCCCHHHCCCCCCCHHH-HHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             544401000000010688-851871687117774212234532126388999999999971898899983698
Q gi|254780669|r  196 TSFGYNTLVTDMRSIPIM-TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD  267 (301)
Q Consensus       196 ~~fgy~~lvvD~~~i~~l-k~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~  267 (301)
                        +.|+|+ .|.+.|... ++++.||++|.-|+.           |+      |-..|+.+|+|-.-.-+|--
T Consensus       168 --y~yGn~-~d~~~i~~iah~~~ip~lvdeA~~~-----------~~------~P~~a~~~GaD~~v~S~HK~  220 (386)
T PRK09331        168 --GNYGNL-HDAKKIAKVAHQYGIPLLLNGAYTV-----------GR------MPVDGKELGADFIVGSGHKS  220 (386)
T ss_pred             --CCCCCH-HHHHHHHHHHHHCCCCEEEECCCCC-----------CC------CCCCHHHCCCCEEEEECCCC
T ss_conf             --664454-6389999999874981898144335-----------77------89746663998898634544


No 41 
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase. This family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Cys-tRNA(Cys) is produced by O-phosphoseryl-tRNA synthetase which ligates O-phosphoserine (Sep) to tRNA(Cys), and Sep-tRNA:Cys-tRNA synthase (SepCysS) converts Sep-tRNA(Cys) to Cys-tRNA(Cys), in methanogenic archaea. SepCysS forms a dimer, each monomer is composed of a large and small domain; the larger, a typical pyridoxal 5'-phosphate (PLP)-dependent-like enzyme fold.  In the active site of each monomer, PLP is covalently bound to a conserved Lys residue near the dimer interface.
Probab=93.60  E-value=0.5  Score=27.68  Aligned_cols=153  Identities=16%  Similarity=0.215  Sum_probs=86.9

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHH--HHH---CCEEEECHHHCCCHHHHHHHHHC-CCEEEE
Q ss_conf             663222456712488899988665287688522889999876--502---15788225762899999998505-977998
Q gi|254780669|r   90 SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAI--ADS---VDILQIPALLCRQTDLLTAAAQT-GRVINV  163 (301)
Q Consensus        90 tS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~--~~~---vDilQIgA~~~rqtdLl~a~a~t-~kpV~i  163 (301)
                      ...+...-|...+-.   +.+.+-+|.-..-=|.-...-..+  ..+   =|.+=+ .+||..+.. .++-.. ..|+-+
T Consensus        36 ~~ld~~~~P~i~efe---~~aAeflG~d~A~~V~Ggt~Gnqa~i~t~c~~GD~VIv-~~naH~S~~-~a~~laG~~~~~v  110 (361)
T cd06452          36 GRLDEIEKPPIKDFH---HDLAEFLGMDEARVTPGAREGKFAVMHSLCEKGDWVVV-DGLAHYTSY-VAAERAGLNVREV  110 (361)
T ss_pred             CCCCCCCCCCHHHHH---HHHHHHCCCCEEEEECCCCHHHHHHHHHHHCCCCEEEE-CCCCHHHHH-HHHHHCCCEEEEE
T ss_conf             653347699889999---99998719966999468520899999998479988985-575128899-8888638469995


Q ss_pred             ECC----CCCCHHHHHHHHHHHHH-CCCC-CEEEEECCCCCCCHHHCCCCCCCHHH-HHHCCCEEECHHHHHHHCCCCCC
Q ss_conf             367----77899999999999972-5878-08995146544401000000010688-85187168711777421223453
Q gi|254780669|r  164 KKG----QFLSPWEMHNILQKLHA-HGAK-DVLFCERGTSFGYNTLVTDMRSIPIM-TSMGVPVIFDASHSVQQPGIHGN  236 (301)
Q Consensus       164 Kkg----q~~s~~e~~~a~eki~~-~Gn~-~i~lcERG~~fgy~~lvvD~~~i~~l-k~~~~PVi~D~SHs~q~p~~~~~  236 (301)
                      +..    ..++|++...++|.+.. .|.. .+++.+ +...-|.+ +.|+..|... ++++.||++|.-|+.        
T Consensus       111 ~~~~~~~~~i~pe~~~~~Iee~~~e~g~~p~Lilit-~~dy~yG~-~~dl~~I~~iah~y~iPvlvD~A~~~--------  180 (361)
T cd06452         111 PNTGHPEYHITPEGYAEVIEEVKDEFGKPPALALLT-HVDGNYGN-LHDAKKIAKVCHEYGVPLLLNGAYTV--------  180 (361)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEE-CCCCCCCC-CCCHHHHHHHHHHCCCCEEECCCCCC--------
T ss_conf             677685665188999999999998618996499996-67877366-31379999999985996897154224--------


Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             212638899999999997189889998369
Q gi|254780669|r  237 CSGGERQYIVPLAKAAVAIGIAGIFLETHQ  266 (301)
Q Consensus       237 ~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp  266 (301)
                         |.      |-..|...|+|-++.-.|-
T Consensus       181 ---g~------lpv~a~~~gaD~v~~s~hK  201 (361)
T cd06452         181 ---GR------MPVSGKELGADFIVGSGHK  201 (361)
T ss_pred             ---CC------CCCCHHHCCCCEEEEECCC
T ss_conf             ---75------7987545079689986565


No 42 
>pfam05690 ThiG Thiazole biosynthesis protein ThiG. This family consists of several bacterial thiazole biosynthesis protein G sequences. ThiG, together with ThiF and ThiH, is proposed to be involved in the synthesis of 4-methyl-5-(b-hydroxyethyl)thiazole (THZ) which is an intermediate in the thiazole production pathway.
Probab=93.18  E-value=0.18  Score=30.58  Aligned_cols=168  Identities=21%  Similarity=0.275  Sum_probs=91.8

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH-HH-CCEEEEECCC
Q ss_conf             995486349999999999999996553399706601557688666322245671248889998866-52-8768852288
Q gi|254780669|r   47 LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKK-KY-GFPILTDVHT  124 (301)
Q Consensus        47 iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~-~~-glpv~TeV~~  124 (301)
                      +|-|----.|.+.   +.+.+...+.++. -.+-+       |.+...-   +-+   .+|..++. ++ =||-..-.+.
T Consensus        11 L~lGTgky~s~~~---~~~ai~aSg~eiv-TVAlR-------R~~~~~~---~~~---~~l~~i~~~~~~iLPNTAGc~t   73 (246)
T pfam05690        11 LLLGTGKYPSPEV---LKEAIRASGAEIV-TVALR-------RVNAGQP---GGE---NFLDLLDWLGITLLPNTAGCRT   73 (246)
T ss_pred             EEEECCCCCCHHH---HHHHHHHHCCCEE-EEEEE-------EECCCCC---CCC---HHHHHHHHCCCEECCCCCCCCC
T ss_conf             4787389999999---9999999689779-98986-------3058888---842---5888641338667776301188


Q ss_pred             HHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCE----EEEECCCCCCHHHHHHHHHHHHHCC-------CCCEEEEE
Q ss_conf             999987650215788225762899999998505977----9983677789999999999997258-------78089951
Q gi|254780669|r  125 EQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV----INVKKGQFLSPWEMHNILQKLHAHG-------AKDVLFCE  193 (301)
Q Consensus       125 ~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kp----V~iKkgq~~s~~e~~~a~eki~~~G-------n~~i~lcE  193 (301)
                      .+++=.+                -.|.+++..++-.    +-=++-.+..+.+.+.|+|.+...|       +.+.++|.
T Consensus        74 A~EAVr~----------------A~laRE~~~t~wIKLEVi~D~~~LlPD~~etl~Aae~Lv~eGF~VlpY~~~D~v~ak  137 (246)
T pfam05690        74 AEEAVRT----------------ARLAREAFGTNWIKLEVIGDSKTLLPDPIETLKAAEILVKEGFTVLPYTTDDPVLAR  137 (246)
T ss_pred             HHHHHHH----------------HHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHH
T ss_conf             9999999----------------999999709974899982698877988789999999999789989886179989999


Q ss_pred             C------------CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEE
Q ss_conf             4------------654440100000001068885-187168711777421223453212638899999999997189889
Q gi|254780669|r  194 R------------GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI  260 (301)
Q Consensus       194 R------------G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGl  260 (301)
                      |            |.--|.+.=+.+..++.++.+ ...|||+|+--             |.    |+-|-.|+-.|+||+
T Consensus       138 rLed~Gc~avMPlgsPIGSg~Gl~n~~~l~~i~e~~~vPvIVDAGi-------------G~----pS~Aa~aMElG~DaV  200 (246)
T pfam05690       138 RLEEAGCAAVMPLGAPIGSGLGLRNPENLRIIIEEADVPVIVDAGI-------------GT----PSDAAQAMELGADAV  200 (246)
T ss_pred             HHHHCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCC-------------CC----HHHHHHHHHCCCCEE
T ss_conf             9987598498622440136888689999999999679988984898-------------96----788999997456777


Q ss_pred             EEEE
Q ss_conf             9983
Q gi|254780669|r  261 FLET  264 (301)
Q Consensus       261 fiE~  264 (301)
                      ++-|
T Consensus       201 LvNT  204 (246)
T pfam05690       201 LLNT  204 (246)
T ss_pred             EHHH
T ss_conf             7306


No 43 
>PRK10550 tRNA-dihydrouridine synthase C; Provisional
Probab=93.18  E-value=0.69  Score=26.71  Aligned_cols=83  Identities=20%  Similarity=0.246  Sum_probs=49.9

Q ss_pred             ECHHHCCCHHHHHH----HHH---CCCEEEEECCC-CCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCH
Q ss_conf             22576289999999----850---59779983677-78999999999999725878089951465444010000000106
Q gi|254780669|r  140 IPALLCRQTDLLTA----AAQ---TGRVINVKKGQ-FLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIP  211 (301)
Q Consensus       140 IgA~~~rqtdLl~a----~a~---t~kpV~iKkgq-~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~  211 (301)
                      -||.|+++.+++.+    +-+   ++.||-+|==. |-+.+.+.-.++.+.+.|..-|.+--|=-.-+|..--+|...+.
T Consensus       108 ~Gs~Ll~~p~~~~~iv~a~~~~v~~~iPVtvK~RlG~~~~~~~~e~~~~~~~~G~~~ltvH~RT~~q~y~~~~~dw~~i~  187 (312)
T PRK10550        108 GGATLLKDPELIYQGAKAMREAVPAHLPVTVKVRLGWDSGDRKFEIADAVQQAGATELVVHGRTKEQGYRAEHIDWQAIG  187 (312)
T ss_pred             CEEEECCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCEEEEECCCHHHCCCCCCCCHHHHH
T ss_conf             26853289779999999999745878995477535899863199999999973998799905526535899834899999


Q ss_pred             HHHH-HCCCEEE
Q ss_conf             8885-1871687
Q gi|254780669|r  212 IMTS-MGVPVIF  222 (301)
Q Consensus       212 ~lk~-~~~PVi~  222 (301)
                      .+|+ ...|||.
T Consensus       188 ~~~~~~~iPvi~  199 (312)
T PRK10550        188 EIRQRLTIPVIA  199 (312)
T ss_pred             HHHHHCCCCEEE
T ss_conf             999748998997


No 44 
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed
Probab=93.14  E-value=0.84  Score=26.17  Aligned_cols=99  Identities=16%  Similarity=0.231  Sum_probs=66.1

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCEEEEECC--CHHH-H---HHHHH--HCCEEEE----------CHHHCCCHHHH----
Q ss_conf             224567124888999886652876885228--8999-9---87650--2157882----------25762899999----
Q gi|254780669|r   94 GKRGVGLKKGREIFRDLKKKYGFPILTDVH--TEQQ-C---EAIAD--SVDILQI----------PALLCRQTDLL----  151 (301)
Q Consensus        94 sfrG~Gle~gL~il~e~k~~~glpv~TeV~--~~~~-~---e~~~~--~vDilQI----------gA~~~rqtdLl----  151 (301)
                      +|...|.+.-++-+.+.++++++|++--+.  .+++ .   +.+.+  ++|.+-|          |.+.-++.+++    
T Consensus        70 G~~n~G~~~~~~~~~~~~~~~~~pvi~si~~~~~~d~~~~~~~l~~~~~ad~ielNiScPn~~~~g~~~~~~~~~l~~i~  149 (301)
T PRK07259         70 GLQNPGVDAFIEEELPWLEEFDTPIIANIAGSTPEEYVEVAEKLSKAPNVDAIELNISCPNVKHGGMAFGTDPELAYEVV  149 (301)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHCCCCHHHHHHHH
T ss_conf             67883599999999976420699879973767768999999986455688889996547888852666087999999999


Q ss_pred             HHHHH-CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             99850-59779983677789999999999997258780899514
Q gi|254780669|r  152 TAAAQ-TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       152 ~a~a~-t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      +++.+ +++||.+|=....  .+....+..+...|.+-|+++-+
T Consensus       150 ~~v~~~~~~Pv~vKlsP~~--~~i~~ia~~~~~~gadgvv~~Nt  191 (301)
T PRK07259        150 KAVKSVSKVPVIVKLTPNV--TDIVEIAKAAEEAGADGLSLINT  191 (301)
T ss_pred             HHHHHHCCCCEEEEECCCH--HHHHHHHHHHHHCCCCEEEEECC
T ss_conf             9998734897799807871--21999999999759988999567


No 45 
>pfam04481 DUF561 Protein of unknown function (DUF561). Protein of unknown function found in a cyanobacterium, and the chloroplasts of algae.
Probab=92.99  E-value=0.88  Score=26.03  Aligned_cols=200  Identities=21%  Similarity=0.298  Sum_probs=123.6

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCC
Q ss_conf             69995486349999999999999996553399706601557688666322245671248889998866528768852288
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHT  124 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~  124 (301)
                      +-+|+|-.--+ .+++..+++....-|+.                     |=...  .--++.+.+++..++||..--.+
T Consensus        15 lKVIsGL~NFd-~~~V~~i~~AA~~ggAt---------------------~vDIA--~dp~LV~~v~~~~~lPiCVSaVe   70 (243)
T pfam04481        15 IKVISGLNNFN-YEQVLKIARASQIAKAT---------------------YVDIA--ADPQLVKVVKSVSNIPICVSAVE   70 (243)
T ss_pred             HHHHCCCCCCC-HHHHHHHHHHHHCCCCC---------------------EEEEC--CCHHHHHHHHHHCCCCEEEECCC
T ss_conf             77640723269-89999999998715997---------------------68741--79999999997289985860479


Q ss_pred             HHHH-HHHHHHCCEEEECHHHCCC-----H---HHHHHHHHC-----CCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             9999-8765021578822576289-----9---999998505-----977998367778999999999999725878089
Q gi|254780669|r  125 EQQC-EAIADSVDILQIPALLCRQ-----T---DLLTAAAQT-----GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVL  190 (301)
Q Consensus       125 ~~~~-e~~~~~vDilQIgA~~~rq-----t---dLl~a~a~t-----~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~  190 (301)
                      |+.. +.+...+|++-||-|-+--     |   +.|.=.-+|     +.|.-+-=+--+.+++-..-++.+.+.|. ++|
T Consensus        71 p~~f~~aV~AGA~lvEIGNfDsFY~qGr~f~a~eVL~Lt~~Tr~LLP~~~LsVTVPHiL~ld~Qv~LA~~L~~~Ga-DiI  149 (243)
T pfam04481        71 PELLYEAVLAGADLVEIGNFDSFYKQGRVLSVCEIIALVKETRKLLPHTPLCVTIPHILKLKEQINLAKQLESLGI-DLI  149 (243)
T ss_pred             HHHHHHHHHHCCCEEEECCHHHHHHCCCEECHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHCC-CEE
T ss_conf             7888999982787898645364765476644999999999999768998447745763567899999999998188-778


Q ss_pred             EEECCC-CCCCHHHCCCC--CCCHHH-------HHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEE
Q ss_conf             951465-44401000000--010688-------85187168711777421223453212638899999999997189889
Q gi|254780669|r  191 FCERGT-SFGYNTLVTDM--RSIPIM-------TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI  260 (301)
Q Consensus       191 lcERG~-~fgy~~lvvD~--~~i~~l-------k~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGl  260 (301)
                      -||-|+ ++.++.-+.++  .+.|.+       |....||+|-               .|-...-.||   |+++|+.|+
T Consensus       150 QTEGgtss~p~~~g~~glIekaapTLAaay~IS~~v~vPVlcA---------------SGlS~vT~Pm---AiaaGAsGV  211 (243)
T pfam04481       150 QTEGKITSISKNHCVNDLIEKSASTLASTYEISKHVQLPVICA---------------SGLSDVTVPL---AFSYGASGI  211 (243)
T ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEC---------------CCCCHHHHHH---HHHCCCCCC
T ss_conf             7289877788884257779887588999999986178766754---------------6764214788---997487710


Q ss_pred             EEEECCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             998369833479782018688999999999999999885
Q gi|254780669|r  261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK  299 (301)
Q Consensus       261 fiE~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~vk  299 (301)
                      =+-.            .-=.+++...++.-++.+.+.++
T Consensus       212 GVGS------------avn~Lnd~~aMva~vr~l~~al~  238 (243)
T pfam04481       212 GIGS------------AVSKLNDIEKMVNYISEIKKAIS  238 (243)
T ss_pred             CHHH------------HHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             0657------------76500249999999999999973


No 46 
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water. IGPS is active as a separate monomer in most organisms, but is also found fused to other enzymes as part of a bifunctional or multifunctional enzyme involved in tryptophan biosynthesis.
Probab=92.81  E-value=0.62  Score=27.05  Aligned_cols=170  Identities=19%  Similarity=0.207  Sum_probs=98.5

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHHH-CC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--22889999876502-15
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIADS-VD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~~-vD  136 (301)
                      ..++|+...+.|+..     .--      =|-+..|.|.     ++.|.++++...+||+-  =|-++.|+.....+ +|
T Consensus        33 ~~~~A~~Y~~~GA~a-----iSV------LTe~~~F~Gs-----~~~L~~v~~~~~~PiLrKDFIid~~QI~ea~~~GAd   96 (217)
T cd00331          33 PVEIAKAYEKAGAAA-----ISV------LTEPKYFQGS-----LEDLRAVREAVSLPVLRKDFIIDPYQIYEARAAGAD   96 (217)
T ss_pred             HHHHHHHHHHCCCCE-----EEE------ECCCCCCCCC-----HHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHCCCC
T ss_conf             999999999779818-----999------5577777988-----999999998479986742321769999999981998


Q ss_pred             EEEECHH-HCCC--HHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH
Q ss_conf             7882257-6289--999999850597799836777899999999999972587808995146544401000000010688
Q gi|254780669|r  137 ILQIPAL-LCRQ--TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM  213 (301)
Q Consensus       137 ilQIgA~-~~rq--tdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l  213 (301)
                      .+-+=++ |-..  .+|++.+...|--+++-=+   +.+|+..    ....|.+-|.+--|--    .++-+|+.....+
T Consensus        97 aiLLI~~~L~~~~l~~l~~~a~~lgl~~LvEvh---~~~El~~----a~~~~a~iIGINnRdL----~t~~vd~~~~~~L  165 (217)
T cd00331          97 AVLLIVAALDDEQLKELYELARELGMEVLVEVH---DEEELER----ALALGAKIIGINNRDL----KTFEVDLNTTERL  165 (217)
T ss_pred             CHHHHHHHCCHHHHHHHHHHHHHHCCEEEEEEC---CHHHHHH----HHHCCCCEEEECCCCC----HHCEECHHHHHHH
T ss_conf             787988854999999999999994982798858---9999999----9957998784216771----2303478999999


Q ss_pred             HHHCCC--EEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE----CCCHHHCC
Q ss_conf             851871--687117774212234532126388999999999971898899983----69833479
Q gi|254780669|r  214 TSMGVP--VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET----HQDPDNAP  272 (301)
Q Consensus       214 k~~~~P--Vi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~----Hp~P~~Al  272 (301)
                      .+. +|  +++ .+-            +|-+.- ..+ +.....|+||+.|=+    .+||.+++
T Consensus       166 ~~~-ip~~~~~-IsE------------SGI~~~-~di-~~l~~~G~d~~LIG~sLm~~~~p~~~l  214 (217)
T cd00331         166 APL-IPKDVIL-VSE------------SGISTP-EDV-KRLAEAGADAVLIGESLMRAPDPGAAL  214 (217)
T ss_pred             HHH-CCCCCEE-EEC------------CCCCCH-HHH-HHHHHCCCCEEEECHHHHCCCCHHHHH
T ss_conf             964-8989889-982------------799999-999-999987999999897886799989999


No 47 
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain. Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. 1VHN, a putative flavin oxidoreductase, has high sequence similarity to DUS.  The enzymatic mechanism of 1VHN is not known at the present.
Probab=92.53  E-value=1  Score=25.63  Aligned_cols=107  Identities=18%  Similarity=0.229  Sum_probs=67.7

Q ss_pred             ECHHHCCCHHHHHHHHH-----CCCEEEEECCCCC-CHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH
Q ss_conf             22576289999999850-----5977998367778-99999999999972587808995146544401000000010688
Q gi|254780669|r  140 IPALLCRQTDLLTAAAQ-----TGRVINVKKGQFL-SPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM  213 (301)
Q Consensus       140 IgA~~~rqtdLl~a~a~-----t~kpV~iKkgq~~-s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l  213 (301)
                      -||.|+++.+++.++-+     ++.||-+|==... ..++....+..+.+.|...+.+--|=..-.|.. -.|.-.+..+
T Consensus       100 ~Ga~Ll~~p~~v~~iv~~~~~~~~ipVsvKiRlg~~~~~~~~~~~~~l~~~G~~~ltvH~Rt~~q~~~~-~a~~e~i~~~  178 (231)
T cd02801         100 AGAALLKDPELVAEIVRAVREAVPIPVTVKIRLGWDDEEETLELAKALEDAGASALTVHGRTREQRYSG-PADWDYIAEI  178 (231)
T ss_pred             CCHHHHHCHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCHHHCCCC-CCCHHHHHHH
T ss_conf             307876297899999999997569947999970778634799999999976998999835614414677-6226999999


Q ss_pred             HH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             85-187168711777421223453212638899999999997189889998
Q gi|254780669|r  214 TS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       214 k~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      |+ ..+|||..-           +.. ...++..-+.+    .|+||+|+=
T Consensus       179 ~~~~~ipvi~NG-----------dI~-s~~d~~~~~~~----tg~dgvMig  213 (231)
T cd02801         179 KEAVSIPVIANG-----------DIF-SLEDALRCLEQ----TGVDGVMIG  213 (231)
T ss_pred             HHCCCCEEEEEC-----------CCC-CHHHHHHHHHH----HCCCEEEEC
T ss_conf             865997799838-----------909-99999999985----099999987


No 48 
>PRK11815 tRNA-dihydrouridine synthase A; Provisional
Probab=92.40  E-value=0.54  Score=27.41  Aligned_cols=19  Identities=11%  Similarity=0.351  Sum_probs=8.4

Q ss_pred             HHHHHHHHCCCCCEEEEEC
Q ss_conf             9999997258780899514
Q gi|254780669|r  176 NILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       176 ~a~eki~~~Gn~~i~lcER  194 (301)
                      ..++.+.+.|..-+++--|
T Consensus       155 ~f~~~~~~aG~~~i~vH~R  173 (333)
T PRK11815        155 DFVDTVAEAGCDRFIVHAR  173 (333)
T ss_pred             HHHHHHHHCCCCEEEEEEH
T ss_conf             9999999759988999602


No 49 
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional
Probab=92.34  E-value=1.1  Score=25.48  Aligned_cols=169  Identities=19%  Similarity=0.243  Sum_probs=108.5

Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCCE
Q ss_conf             999999999655339970660155768866632224567124888999886652876885--2288999987650-2157
Q gi|254780669|r   61 FMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVDI  137 (301)
Q Consensus        61 ~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vDi  137 (301)
                      .++|+...+.|++...    =--.|.       ++.|.  ..-+++++++.++..+|+..  =|.+.++++.+.+ .+|=
T Consensus        33 ~~~ak~f~~~Gadelh----ivDld~-------a~~g~--~~n~~~I~~I~~~~~ipi~vGGGIrs~e~~~~ll~~Gadk   99 (253)
T PRK01033         33 INAVRIFNEKEADELI----VLDIDA-------SRKGR--EPNYELIENLASECFMPLCYGGGIKTVEQAKRIFSLGVEK   99 (253)
T ss_pred             HHHHHHHHHCCCCEEE----EEECCC-------CCCCC--CCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCE
T ss_conf             9999999987999899----994745-------42488--0169999999987699889868812168889998679866


Q ss_pred             EEECHHHCCCHHHHHHHHHCC---C---EEEEECC------------CCCCHHHHHHHHHHHHHCCCCCEEEEEC---CC
Q ss_conf             882257628999999985059---7---7998367------------7789999999999997258780899514---65
Q gi|254780669|r  138 LQIPALLCRQTDLLTAAAQTG---R---VINVKKG------------QFLSPWEMHNILQKLHAHGAKDVLFCER---GT  196 (301)
Q Consensus       138 lQIgA~~~rqtdLl~a~a~t~---k---pV~iKkg------------q~~s~~e~~~a~eki~~~Gn~~i~lcER---G~  196 (301)
                      +=|++...+|.+++..+++.-   +   -+-+|++            +-.+..++.-.++++.+.|...++++.=   |+
T Consensus       100 Viigs~a~~~p~~i~~~~~~fG~q~IvvsiD~k~~~~~~~~v~~~g~~~~t~~~~~~~~~~~~~~g~geil~TdI~rDGt  179 (253)
T PRK01033        100 VSISTAALEDPKLITEAAEIYGSQSVVVSIDVKKRLFGRYDVYTHNGTKKTGLDPVEFAKQAEELGAGEIVLNSIDRDGV  179 (253)
T ss_pred             EEECCHHHHCCHHHHHHHHHCCCCCEEEEEEEECCCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             99998786374165789987799769999998248778347898679536785589999998746977999987848897


Q ss_pred             CCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             4440100000001068885-187168711777421223453212638899999999997189889998
Q gi|254780669|r  197 SFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       197 ~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      ..|++     +.-+..+.+ ..+|||.               +||-..+ ..+..+=...|+||+.+=
T Consensus       180 ~~G~d-----~~l~~~i~~~~~ipiIa---------------sGGi~s~-~di~~l~~~~~v~gv~~g  226 (253)
T PRK01033        180 MKGYD-----LELIKKISSAVKIPVTA---------------LGGAGSL-DDIADLIQEAGASAAAAG  226 (253)
T ss_pred             CCCCC-----HHHHHHHHHHCCCCEEE---------------ECCCCCH-HHHHHHHHHCCCEEEEEE
T ss_conf             66879-----99999999878999999---------------7898999-999999986797399783


No 50 
>pfam00218 IGPS Indole-3-glycerol phosphate synthase.
Probab=92.34  E-value=0.81  Score=26.26  Aligned_cols=171  Identities=20%  Similarity=0.185  Sum_probs=102.3

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      ..++|+...+.|+...     --      =|-+..|+|     .++.|.++++..++||+-  =|-++.|+.+... .+|
T Consensus        70 p~~iA~~Y~~~GA~ai-----SV------LTd~~~F~G-----s~~~L~~vr~~v~lPiLrKDFIid~yQI~ear~~GAD  133 (254)
T pfam00218        70 PAEIARAYEAAGASAI-----SV------LTEPKYFQG-----SLEYLREVREAVSLPVLRKDFIIDEYQIYEARAYGAD  133 (254)
T ss_pred             HHHHHHHHHHCCCCEE-----EE------ECCCCCCCC-----CHHHHHHHHHHCCCCEECCHHEEEHHHHHHHHHCCCC
T ss_conf             9999999997798379-----98------426786798-----7999999998648851114104659999999980888


Q ss_pred             -EEEECHHHCCC--HHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH
Q ss_conf             -78822576289--999999850597799836777899999999999972587808995146544401000000010688
Q gi|254780669|r  137 -ILQIPALLCRQ--TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM  213 (301)
Q Consensus       137 -ilQIgA~~~rq--tdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l  213 (301)
                       ||=|-+.|-..  .+|+..+..-|--+++-=+   +.+|+..    ....|.+=|-+--|--    .++.+|+.....+
T Consensus       134 aiLLI~~~L~~~~l~~l~~~a~~lgl~~LvEvh---~~~El~~----al~~~a~iIGINNRnL----~tf~vd~~~t~~L  202 (254)
T pfam00218       134 TVLLIVAVLSDELLEELYEYARSLGMEPLVEVH---NEEELER----ALALGAKLIGVNNRNL----KTFEVDLNTTRRL  202 (254)
T ss_pred             EEEHHHHCCCHHHHHHHHHHHHHHCCEEEEEEC---CHHHHHH----HHHCCCCEEEECCCCH----HHHHCCHHHHHHH
T ss_conf             631447119999999999999984886798868---9999999----9848997896327884----6510057999999


Q ss_pred             HHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE----CCCHHHCC
Q ss_conf             851-871687117774212234532126388999999999971898899983----69833479
Q gi|254780669|r  214 TSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET----HQDPDNAP  272 (301)
Q Consensus       214 k~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~----Hp~P~~Al  272 (301)
                      ... .--+++ .+-|       |  . ..++-+.    ....+|+||+.|=.    ++||..++
T Consensus       203 ~~~ip~~~~~-VsES-------G--I-~~~~di~----~l~~~G~~~~LIGe~lm~~~dp~~~l  251 (254)
T pfam00218       203 APMVPEDVLL-VAES-------G--I-STPEDVE----KLAKHGANAFLVGESLMRAPDVRAAI  251 (254)
T ss_pred             HHHCCCCCEE-EECC-------C--C-CCHHHHH----HHHHCCCCEEEECHHHHCCCCHHHHH
T ss_conf             9558989879-9838-------9--9-9999999----99987999999896875799989999


No 51 
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism. ThiG catalyzes the formation of thiazole from 1-deoxy-D-xylulose 5-phosphate (DXP) and dehydroglycine, with the help of the sulfur carrier protein ThiS that carries the sulfur needed for thiazole assembly on its carboxy terminus (ThiS-COSH).
Probab=92.15  E-value=0.24  Score=29.77  Aligned_cols=168  Identities=23%  Similarity=0.310  Sum_probs=91.3

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH-H-CCEEEEECCC
Q ss_conf             9954863499999999999999965533997066015576886663222456712488899988665-2-8768852288
Q gi|254780669|r   47 LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKK-Y-GFPILTDVHT  124 (301)
Q Consensus        47 iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~-~-glpv~TeV~~  124 (301)
                      +|-|----.|.+.   +.+.+...+.++.- .+-+       |.++.. .  +-+   .+|..++.. + =||-..-.++
T Consensus        12 LilGTgky~s~~~---~~~ai~aSgaeivT-VAlR-------R~~~~~-~--~~~---~~l~~i~~~~~~~LPNTAGc~t   74 (248)
T cd04728          12 LLLGTGKYPSPAI---MKEAIEASGAEIVT-VALR-------RVNIGD-P--GGE---SFLDLLDKSGYTLLPNTAGCRT   74 (248)
T ss_pred             EEEECCCCCCHHH---HHHHHHHHCCCEEE-EEEE-------ECCCCC-C--CCH---HHHHHHHHCCCEECCCCCCCCC
T ss_conf             3786489999999---99999996897699-9986-------305788-8--852---6898752338668765401167


Q ss_pred             HHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCE----EEEECCCCCCHHHHHHHHHHHHHCC-------CCCEEEEE
Q ss_conf             999987650215788225762899999998505977----9983677789999999999997258-------78089951
Q gi|254780669|r  125 EQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV----INVKKGQFLSPWEMHNILQKLHAHG-------AKDVLFCE  193 (301)
Q Consensus       125 ~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kp----V~iKkgq~~s~~e~~~a~eki~~~G-------n~~i~lcE  193 (301)
                      .+++=.+                -.|.+++..++-.    +-=+|-....+.|.+.|+|.+...|       +.+.++|.
T Consensus        75 a~EAvr~----------------A~laRE~~~t~~IKLEVi~D~~~LlPD~~eTl~Aae~Lv~~GF~VlpY~~~D~v~ak  138 (248)
T cd04728          75 AEEAVRT----------------ARLAREALGTDWIKLEVIGDDKTLLPDPIETLKAAEILVKEGFTVLPYCTDDPVLAK  138 (248)
T ss_pred             HHHHHHH----------------HHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHH
T ss_conf             9999999----------------999999848986999981797677988689999999999889989786788999999


Q ss_pred             C------------CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEE
Q ss_conf             4------------654440100000001068885-187168711777421223453212638899999999997189889
Q gi|254780669|r  194 R------------GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI  260 (301)
Q Consensus       194 R------------G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGl  260 (301)
                      |            |.--|.+.=+.+..++.++.+ ...|||+|+--             |.    |+-|-.|+-.|+||+
T Consensus       139 rLe~~Gc~avMPlgsPIGSg~Gl~n~~~l~~i~e~~~vPvIVDAGi-------------G~----pS~Aa~aMElG~daV  201 (248)
T cd04728         139 RLEDAGCAAVMPLGSPIGSGQGLLNPYNLRIIIERADVPVIVDAGI-------------GT----PSDAAQAMELGADAV  201 (248)
T ss_pred             HHHHCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCC-------------CC----HHHHHHHHHCCCCEE
T ss_conf             9997495345204564347988799999999998479988984799-------------97----567899987265533


Q ss_pred             EEEE
Q ss_conf             9983
Q gi|254780669|r  261 FLET  264 (301)
Q Consensus       261 fiE~  264 (301)
                      ++-|
T Consensus       202 L~NT  205 (248)
T cd04728         202 LLNT  205 (248)
T ss_pred             EHHH
T ss_conf             4546


No 52 
>PRK05567 inositol-5'-monophosphate dehydrogenase; Reviewed
Probab=92.03  E-value=1.2  Score=25.24  Aligned_cols=145  Identities=19%  Similarity=0.237  Sum_probs=83.4

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCEEEEECC---------------------------------------CHHHHHHHHH-
Q ss_conf             224567124888999886652876885228---------------------------------------8999987650-
Q gi|254780669|r   94 GKRGVGLKKGREIFRDLKKKYGFPILTDVH---------------------------------------TEQQCEAIAD-  133 (301)
Q Consensus        94 sfrG~Gle~gL~il~e~k~~~glpv~TeV~---------------------------------------~~~~~e~~~~-  133 (301)
                      ...|..++++.++|.+-|.+ -+||+.|-.                                       +.+-++.+.+ 
T Consensus       161 ~~~~is~~eA~~~l~~~kie-klPvVd~~g~L~Glit~kDi~k~~~~P~A~~D~~grL~VgAAVg~~~~~~eRa~~Lv~A  239 (486)
T PRK05567        161 VPEGTTLEEALELLHEHRIE-KLLVVDDNGRLKGLITVKDIEKAEEFPNACKDEQGRLRVGAAVGVGADNEERAEALVKA  239 (486)
T ss_pred             ECCCCCHHHHHHHHHHHHHC-CCCEECCCCCEEEEEEHHHHHHHHHCCCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHC
T ss_conf             25889999999999973130-34277468968888776677765208851236668889999962680189999999976


Q ss_pred             HCCEEEECHHH---CCCHHHHHHHHHCC--CEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEE--------ECCC-CCC
Q ss_conf             21578822576---28999999985059--7799836777899999999999972587808995--------1465-444
Q gi|254780669|r  134 SVDILQIPALL---CRQTDLLTAAAQTG--RVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFC--------ERGT-SFG  199 (301)
Q Consensus       134 ~vDilQIgA~~---~rqtdLl~a~a~t~--kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lc--------ERG~-~fg  199 (301)
                      .+|+|=|-.-.   ..+-+.++.+.+..  .||.  -|--.+.+    +++.+...|..-|.+.        -|-. -+|
T Consensus       240 GvDvivIDtAhGhs~~vi~~ik~ik~~~~~v~vi--aGNv~T~~----~a~~L~~aGaD~vkVGiG~GsiCtTr~v~GvG  313 (486)
T PRK05567        240 GVDVLVVDTAHGHSEGVLDRVREIKAKYPDVQII--AGNVATAE----AARALIEAGADAVKVGIGPGSICTTRIVAGVG  313 (486)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHCCCCCCEE--EEEECHHH----HHHHHHHCCCCEEEECCCCCCCCCCCCCCCCC
T ss_conf             9988995044521577899999997407877368--75120199----99999972987699656688665134324778


Q ss_pred             CHHHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             010000000106888518716871177742122345321263889999999999718988999
Q gi|254780669|r  200 YNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       200 y~~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                      +..+-.=+......++++.|||-|---..            ..+.+     .|+|+|+|.+|+
T Consensus       314 vPq~tAv~~~a~~a~~~~v~iIADGGi~~------------sGdi~-----KAla~GAd~VMl  359 (486)
T PRK05567        314 VPQITAIADAAEAAKKTGIPVIADGGIRY------------SGDIA-----KALAAGASAVML  359 (486)
T ss_pred             CCHHHHHHHHHHHHHHCCCEEEECCCCCC------------CCHHH-----HHHHCCCCEEEE
T ss_conf             64699999999999865977996488354------------35799-----998658988986


No 53 
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional
Probab=92.01  E-value=1.2  Score=25.22  Aligned_cols=163  Identities=19%  Similarity=0.186  Sum_probs=105.2

Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEE---------CC-
Q ss_conf             49999999999999996553399706601557688666322245671248889998866528768852---------28-
Q gi|254780669|r   54 IESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTD---------VH-  123 (301)
Q Consensus        54 iES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~Te---------V~-  123 (301)
                      +.+.+.+-.+|+..+.-|+.                    +.|=    .|++-.+.+|+..++||+-=         |- 
T Consensus        19 l~~~~im~~mA~Aa~~gGA~--------------------giR~----~~~~dI~aik~~v~lPIIGi~K~~~~~s~VyI   74 (222)
T PRK01130         19 LHSPEIMAAMALAAEQGGAV--------------------GIRA----NGVEDIKAIREVVDVPIIGIIKRDYPDSEVYI   74 (222)
T ss_pred             CCCHHHHHHHHHHHHHCCCE--------------------EEEC----CCHHHHHHHHHHCCCCEEEEEECCCCCCCEEE
T ss_conf             78879999999999968962--------------------9971----89889999998479987999954689997375


Q ss_pred             --CHHHHHHHHH-HCCEEEECHHHCCC------HHHHHHHHHC-CCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             --8999987650-21578822576289------9999998505-977998367778999999999999725878089951
Q gi|254780669|r  124 --TEQQCEAIAD-SVDILQIPALLCRQ------TDLLTAAAQT-GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCE  193 (301)
Q Consensus       124 --~~~~~e~~~~-~vDilQIgA~~~rq------tdLl~a~a~t-~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcE  193 (301)
                        ...+++.+.+ .+||+-+-|-+-..      .+|++++-+. +..++--=   .+.+|-+.|.    ..|.+=|--|-
T Consensus        75 TPt~~ev~~l~~aGadiIA~DaT~R~RP~g~~~~~~i~~i~~~~~~l~MAD~---st~eea~~A~----~~G~D~V~TTL  147 (222)
T PRK01130         75 TPTLKEVDALAAAGADIIALDATLRPRPDGETLAELVKRIKEKPGQLLMADC---STLEEGLAAA----KLGFDFIGTTL  147 (222)
T ss_pred             CCCHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHCCEEEEEC---CCHHHHHHHH----HCCCCEEECCC
T ss_conf             1769999999986999999846789898996899999999998298789854---8899999999----84999997233


Q ss_pred             CCCCCCCH---HHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             46544401---000000010688851871687117774212234532126388999999999971898899983
Q gi|254780669|r  194 RGTSFGYN---TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       194 RG~~fgy~---~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      +|.+-...   .--.||.-+..+.+.+.|||..                 -|-.-|..++.|+.+|++.+-+-+
T Consensus       148 sGYT~~t~~~~~~~pD~~lv~~l~~~~~pvIaE-----------------Gri~tPe~a~~al~~GA~aVvVGs  204 (222)
T PRK01130        148 SGYTEYTEGETPEEPDFALLKELLKAGCPVIAE-----------------GRINTPEQAKKALELGAHAVVVGS  204 (222)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEE-----------------CCCCCHHHHHHHHHCCCCEEEECC
T ss_conf             456767677878998699999999589989974-----------------798999999999984998999897


No 54 
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain.  DHPD catalyzes the first step in pyrimidine degradation: the NADPH-dependent reduction of uracil and thymine to the corresponding 5,6-dihydropyrimidines. DHPD contains two FAD, two FMN, and eight [4Fe-4S] clusters, arranged in two electron transfer chains that pass the dimer interface twice. Two of the Fe-S clusters show a hitherto unobserved coordination involving a glutamine residue.
Probab=91.99  E-value=1.2  Score=25.21  Aligned_cols=153  Identities=12%  Similarity=0.127  Sum_probs=81.2

Q ss_pred             EEECCCCCEEEEECCCCCCCHHHHHHHHHH------HHHHHHH-----CCCCEEEECCCCCCCCCCCCCC---CCCCCHH
Q ss_conf             797699706999548634999999999999------9996553-----3997066015576886663222---4567124
Q gi|254780669|r   37 VTFSNEQRFVLIAGPCQIESHDHAFMIAEK------LYAICQS-----LNIGLVYKSSFDKANRSSLAGK---RGVGLKK  102 (301)
Q Consensus        37 i~ig~~~~l~iIAGPCsiES~e~~~~~A~~------lk~~~~~-----~~~~~ifK~sfdKanRtS~~sf---rG~Gle~  102 (301)
                      ++|-  +|+.+=|||..-. .+++....+.      ++.++..     .-++-+|.-..+.+|+.++..-   ...|.+.
T Consensus         9 l~~~--nPi~lAAG~~~~~-~~~~~~~~~~G~G~vv~ktit~~~~~~gn~~PR~~r~~~~~~~~~g~~n~~~~~~~~~~~   85 (299)
T cd02940           9 IKFP--NPFGLASAPPTTS-YPMIRRAFEAGWGGAVTKTLGLDKDIVTNVSPRIARLRTSGRGQIGFNNIELISEKPLEY   85 (299)
T ss_pred             EECC--CCCEECCCCCCCC-HHHHHHHHHCCCCEEECCEECCCCCCCCCCCCCEEECCCCHHHHCCCCCCHHHHHHHHHH
T ss_conf             9889--9868787789989-999999998798889915689887888999987898876625521337840121202999


Q ss_pred             HHHHHHHHHHHH-CCEEEEEC---CCHHHH----HHHHHH-CCEEEE-------------CHHHCCCHHHHHHHHH----
Q ss_conf             888999886652-87688522---889999----876502-157882-------------2576289999999850----
Q gi|254780669|r  103 GREIFRDLKKKY-GFPILTDV---HTEQQC----EAIADS-VDILQI-------------PALLCRQTDLLTAAAQ----  156 (301)
Q Consensus       103 gL~il~e~k~~~-glpv~TeV---~~~~~~----e~~~~~-vDilQI-------------gA~~~rqtdLl~a~a~----  156 (301)
                      .++-++++|+++ +.|++--+   +..++.    +.+.+. +|.+-+             +....++.+++.++.+    
T Consensus        86 ~~~~~~~~~~~~~~~~~i~si~~~~~~~~~~~~a~~~~~~gad~lElNiScPN~~~~~~~g~~~~~~~~~l~~i~~~v~~  165 (299)
T cd02940          86 WLKEIRELKKDFPDKILIASIMCEYNKEDWTELAKLVEEAGADALELNFSCPHGMPERGMGAAVGQDPELVEEICRWVRE  165 (299)
T ss_pred             HHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             99999998752799737988517898789999999998718888998267889876123455524499999999999986


Q ss_pred             -CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             -59779983677789999999999997258780899514
Q gi|254780669|r  157 -TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       157 -t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                       +++||.+|=....  .+....++.+...|.+-+.++-+
T Consensus       166 ~~~~Pi~vKLsP~~--~~i~~ia~~~~~~gadgiv~~Nt  202 (299)
T cd02940         166 AVKIPVIAKLTPNI--TDIREIARAAKEGGADGVSAINT  202 (299)
T ss_pred             HCCCCEEEECCCCH--HHHHHHHHHHHHCCCCEEEEECC
T ss_conf             24786489628871--54999999999859989999766


No 55 
>PRK00208 thiG thiazole synthase; Reviewed
Probab=91.98  E-value=0.2  Score=30.23  Aligned_cols=167  Identities=22%  Similarity=0.294  Sum_probs=89.0

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH--HHCCEEEEECCC
Q ss_conf             995486349999999999999996553399706601557688666322245671248889998866--528768852288
Q gi|254780669|r   47 LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKK--KYGFPILTDVHT  124 (301)
Q Consensus        47 iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~--~~glpv~TeV~~  124 (301)
                      +|-|----.|.+.   +.+.+...+.++.- .+-+       |...+.-   +-+   .+|..++.  -.=||=..-.+.
T Consensus        13 LilGTgky~s~~~---~~~ai~aSg~eivT-VAlR-------R~~~~~~---~~~---~~l~~i~~~~~~lLPNTAGc~t   75 (256)
T PRK00208         13 LLLGTGKYPSPEV---MQEAIEASGAEIVT-VALR-------RVNLGDP---GGD---NLLDLLDPLGVTLLPNTAGCRT   75 (256)
T ss_pred             EEEECCCCCCHHH---HHHHHHHHCCCEEE-EEEE-------EECCCCC---CCH---HHHHHHCCCCCEECCCCCCCCC
T ss_conf             4786489999999---99999996897799-9986-------4247789---850---5888743158567666403267


Q ss_pred             HHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEE-----ECCCCCCHHHHHHHHHHHHHCC-------CCCEEEE
Q ss_conf             999987650215788225762899999998505977998-----3677789999999999997258-------7808995
Q gi|254780669|r  125 EQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV-----KKGQFLSPWEMHNILQKLHAHG-------AKDVLFC  192 (301)
Q Consensus       125 ~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~i-----Kkgq~~s~~e~~~a~eki~~~G-------n~~i~lc  192 (301)
                      .+++=.+                -.|.+++..++- |-|     .|-....+.|.+.|+|.+...|       +++.++|
T Consensus        76 a~EAVr~----------------A~laRE~~~tnw-IKLEVi~D~~~LlPD~~etl~Aae~Lv~eGF~VlpY~~~D~v~a  138 (256)
T PRK00208         76 AEEAVRT----------------ARLAREALGTDW-IKLEVIGDDKTLLPDPIETLKAAEILVKEGFVVLPYCTDDPVLA  138 (256)
T ss_pred             HHHHHHH----------------HHHHHHHHCCCE-EEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHH
T ss_conf             9999999----------------999999848986-99998179767798868999999999988998978678898999


Q ss_pred             EC------------CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCE
Q ss_conf             14------------654440100000001068885-18716871177742122345321263889999999999718988
Q gi|254780669|r  193 ER------------GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG  259 (301)
Q Consensus       193 ER------------G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dG  259 (301)
                      .|            |.--|.+.=+....++.++.+ ...|||+|+--             |.    |+-|-.|+-.|+||
T Consensus       139 krLe~~Gc~avMPlgsPIGSg~Gl~n~~~l~~i~e~~~vPvIVDAGi-------------G~----pS~Aa~AMElG~Da  201 (256)
T PRK00208        139 KRLEEAGCAAVMPLGAPIGSGLGLLNPYNLRIIIEQADVPVIVDAGI-------------GT----PSDAAQAMELGADA  201 (256)
T ss_pred             HHHHHCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCC-------------CC----HHHHHHHHHCCCCE
T ss_conf             99997495345204564347988799999999998679988985788-------------97----66789998625543


Q ss_pred             EEEEE
Q ss_conf             99983
Q gi|254780669|r  260 IFLET  264 (301)
Q Consensus       260 lfiE~  264 (301)
                      +++-|
T Consensus       202 VL~NT  206 (256)
T PRK00208        202 VLLNT  206 (256)
T ss_pred             EEHHH
T ss_conf             23556


No 56 
>PRK02621 consensus
Probab=91.97  E-value=1.2  Score=25.19  Aligned_cols=189  Identities=15%  Similarity=0.213  Sum_probs=118.4

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      -.++|+...+.+++...  +.--  |.       ++.|  -..-+++++++.++..+|+..  =|.+.++++.+.+ .+|
T Consensus        32 P~~~ak~~~~~gad~lh--ivDl--d~-------a~~~--~~~~~~~I~~i~~~~~ipi~vGGGIrs~e~~~~ll~~Gad   98 (254)
T PRK02621         32 PVELACRYSQAGADELV--FLDI--TA-------THEG--RATLIDVVYRTAEQVFIPLTVGGGISSLEGIKELLRAGAD   98 (254)
T ss_pred             HHHHHHHHHHCCCCEEE--EEEC--CC-------CCCC--CHHHHHHHHHHHHHCCCCEEEECCEEEHHHHHHHHHCCCC
T ss_conf             99999999985999999--9826--67-------6567--5428999999998679858996335357999999974999


Q ss_pred             EEEECHHHCCCHHHHHHHHHC-CC-----EEEEECCC--------------CCCHHHHHHHHHHHHHCCCCCEEEEEC--
Q ss_conf             788225762899999998505-97-----79983677--------------789999999999997258780899514--
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQT-GR-----VINVKKGQ--------------FLSPWEMHNILQKLHAHGAKDVLFCER--  194 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t-~k-----pV~iKkgq--------------~~s~~e~~~a~eki~~~Gn~~i~lcER--  194 (301)
                      =+=|++...+|.+++.++++. |.     -+-+|++.              -.+..+....++++.+.|...++++.=  
T Consensus        99 kVii~s~a~~np~~~~~~~~~fG~q~Iv~siD~k~~~~~~~gw~~~~~~~~~~~~~~~~~~~~~~~~~g~geil~tdI~~  178 (254)
T PRK02621         99 KVSLNSAAVRDPDLVRQASDRFGSQCIVVAIDARRRKPDNPGWDVYVRGGRENTGLDAVEWAEEVAERGAGEILLTSMDG  178 (254)
T ss_pred             EEEECCHHHHCCCHHHHHHHHCCCCCEEEEEEEECCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCEEEEEEECC
T ss_conf             89998867647354455687569843399999553534788628996688455776799999887762889699988804


Q ss_pred             -CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCC
Q ss_conf             -654440100000001068885-187168711777421223453212638899999999997189889998369833479
Q gi|254780669|r  195 -GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP  272 (301)
Q Consensus       195 -G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~Al  272 (301)
                       |+..||+     +.-+..+.+ ...|||.               +||-+.+- .+..+-...|++|..+=      +|+
T Consensus       179 DGt~~G~d-----~~l~~~i~~~~~iPvi~---------------sGGi~s~e-di~~~l~~~~v~gvivG------~al  231 (254)
T PRK02621        179 DGTQAGYD-----LELTRAIAEAVEIPVIA---------------SGGAGCCD-HIAEALTEGKAEAALLA------SLL  231 (254)
T ss_pred             CCCCCCCC-----HHHHHHHHHHCCCCEEE---------------ECCCCCHH-HHHHHHHHCCCEEEEEH------HHH
T ss_conf             79757688-----69999999717997999---------------77999999-99999985898198775------787


Q ss_pred             CCCCCCCCHHHHHHHHHH
Q ss_conf             782018688999999999
Q gi|254780669|r  273 SDGPNMINIKDLPKLLSQ  290 (301)
Q Consensus       273 sD~~q~l~l~~l~~ll~~  290 (301)
                      -+  ..+++.++++.|.+
T Consensus       232 ~~--~~~~l~e~K~~l~~  247 (254)
T PRK02621        232 HY--GQLTIAEIKADLLA  247 (254)
T ss_pred             HC--CCCCHHHHHHHHHH
T ss_conf             88--99999999999997


No 57 
>PRK03220 consensus
Probab=91.95  E-value=1.2  Score=25.18  Aligned_cols=188  Identities=16%  Similarity=0.201  Sum_probs=121.2

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      -+++|+...+.|.+...=  .-  .|-       ++.  |-..-+++++++.++..+|+..  =|++.++++.+.+ .+|
T Consensus        33 P~~~a~~~~~~G~d~lhi--vD--ld~-------a~~--g~~~n~~~I~~i~~~~~~pi~vGGGIrs~e~~~~ll~~Gad   99 (257)
T PRK03220         33 PVELAAVYDAEGADELTF--LD--VTA-------SSS--GRATMLDVVRRTAEQVFIPLTVGGGVRTVEDVDSLLRAGAD   99 (257)
T ss_pred             HHHHHHHHHHCCCCEEEE--EE--CCC-------CCC--CCHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCC
T ss_conf             999999999869998999--90--888-------756--76307999999985069648984785879999999981975


Q ss_pred             EEEECHHHCCCHHHHHHHHHCC---C---EEEEECC------------------CCCCHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             7882257628999999985059---7---7998367------------------77899999999999972587808995
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQTG---R---VINVKKG------------------QFLSPWEMHNILQKLHAHGAKDVLFC  192 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t~---k---pV~iKkg------------------q~~s~~e~~~a~eki~~~Gn~~i~lc  192 (301)
                      -+=|++....|.+++.++++.-   +   -+-+|++                  +-.+--++.-.++++.+.|...++++
T Consensus       100 kVvigs~a~~~p~~~~~~~~~fG~q~Iv~siD~k~~~~~~~~~~~g~~v~~~g~~~~t~~~~~~~i~~~~~~g~geil~t  179 (257)
T PRK03220        100 KVSVNTAAIARPELLAELARRFGSQCIVLSVDARRVPVGSAPTPSGFEVTTHGGRRGTGIDAVEWAARGAELGVGEILLN  179 (257)
T ss_pred             EEECHHHHHHCCHHHHHHHHHCCCEEEEEEEEEEECCCCCCCCCCCEEEEECCCEEECCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             08720667759477789998709866999999886256774346874999728826028759999999862698889999


Q ss_pred             EC---CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             14---654440100000001068885-18716871177742122345321263889999999999718988999836983
Q gi|254780669|r  193 ER---GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP  268 (301)
Q Consensus       193 ER---G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P  268 (301)
                      .=   |+.-|++     +..+..+++ +..|+|.               +||-+.+- .+. .+...|+||+.+=     
T Consensus       180 dI~rDGt~~G~d-----~~l~~~i~~~~~~piIa---------------sGGv~s~~-di~-~l~~~g~~gv~~g-----  232 (257)
T PRK03220        180 SMDADGTKAGFD-----LEMLRAVRAAVTVPVIA---------------SGGAGAVE-HFA-PAVAAGADAVLAA-----  232 (257)
T ss_pred             EECCCCCCCCCC-----HHHHHHHHHHCCCCEEE---------------ECCCCCHH-HHH-HHHHCCCCEEEEH-----
T ss_conf             886866023789-----69999999748999899---------------87899999-999-9997899799874-----


Q ss_pred             HHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             3479782018688999999999
Q gi|254780669|r  269 DNAPSDGPNMINIKDLPKLLSQ  290 (301)
Q Consensus       269 ~~AlsD~~q~l~l~~l~~ll~~  290 (301)
                       +|+-++  .+++.++++.|++
T Consensus       233 -~a~~~~--~~s~~~~k~~l~~  251 (257)
T PRK03220        233 -SVFHFG--ELTIGQVKAALAA  251 (257)
T ss_pred             -HHHHCC--CCCHHHHHHHHHH
T ss_conf             -687889--9889999999998


No 58 
>cd02911 arch_FMN Archeal FMN-binding domain. This family of archaeal proteins are part of the NAD(P)H-dependent flavin oxidoreductase (oxidored) FMN-binding family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN. The specific function of this group is unknown.
Probab=91.75  E-value=1.2  Score=25.04  Aligned_cols=110  Identities=16%  Similarity=0.199  Sum_probs=62.9

Q ss_pred             HHHHHCCEEEE--------------CHHHCCCHH----HHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             76502157882--------------257628999----999985059779983677789999999999997258780899
Q gi|254780669|r  130 AIADSVDILQI--------------PALLCRQTD----LLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLF  191 (301)
Q Consensus       130 ~~~~~vDilQI--------------gA~~~rqtd----Ll~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~l  191 (301)
                      .+.+..|++-|              ||.|+++.+    +++++.++++||-+|=-..-..++ ...++.+...|..-  +
T Consensus        93 ~~~~~~d~IDiN~GCP~~kV~~~g~GsaLl~dp~~~~~iv~avk~~~~PVtvKiR~G~d~~~-~~~a~~~e~aG~~~--l  169 (233)
T cd02911          93 LVAKNAAILEINAHCRQPEMVEAGAGEALLKDPERLSEFIKALKETGVPVSVKIRAGVDVDD-EELARLIEKAGADI--I  169 (233)
T ss_pred             HHHCCCCEEEEECCCCCHHHCCCCCHHHHCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCH-HHHHHHHHHHCCCE--E
T ss_conf             97436999999799992898379753777389899999999998538984279856999888-99999999839607--9


Q ss_pred             EECCCCCCCHHHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             514654440100000001068885187168711777421223453212638899999999997189889998
Q gi|254780669|r  192 CERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       192 cERG~~fgy~~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      +-|+.  .|+. ..|...+...+ ..+|||-           +|+..  ..+-    ++..+..|+||+||=
T Consensus       170 ~v~~~--~~~~-~ad~~~I~~~~-~~i~Vig-----------NGDI~--s~ed----a~~~~~~G~DgVMIg  220 (233)
T cd02911         170 HVDAM--DPGN-HADLKKIRDIS-TELFIIG-----------NNSVT--TIES----AKEMFSYGADMVSVA  220 (233)
T ss_pred             EEECC--CCCC-HHHHHHHHHHC-CCCEEEE-----------ECCCC--CHHH----HHHHHHHCCCEEEEC
T ss_conf             94320--7785-08999999863-7987998-----------08969--9999----999998599999973


No 59 
>PRK00694 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated
Probab=91.64  E-value=1.3  Score=24.96  Aligned_cols=117  Identities=15%  Similarity=0.247  Sum_probs=74.0

Q ss_pred             ECCCEEEECCCCCCEEECCCCCEEEEECCCCCCCHH--HHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             317706835787727976997069995486349999--999999999996553399706601557688666322245671
Q gi|254780669|r   23 HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHD--HAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL  100 (301)
Q Consensus        23 ~~~~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e--~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gl  100 (301)
                      ...+.|.+    |+|.+||++|..+= --+.-.+.|  ...+-...|.+.|..+-             |-+..     + 
T Consensus        13 r~Tr~V~v----G~v~iGg~~Pi~vQ-SMt~t~T~D~~atv~Qi~~l~~aGceiV-------------Rvtvp-----~-   68 (606)
T PRK00694         13 RKTHSVRI----GNLFVGSEHSIKIQ-SMTTTATTDVDGTVRQICALQEHGCDIV-------------RVTVQ-----G-   68 (606)
T ss_pred             CCCEEEEE----CCCCCCCCCCEEEE-ECCCCCCCCHHHHHHHHHHHHHCCCCEE-------------EECCC-----C-
T ss_conf             57636898----59665799967556-4689986368999999999998599989-------------98779-----9-


Q ss_pred             HHHHHHHHHHHHH-----HCCEEEEECCCHHHHH-HHHHHCCEEEECHHHCCC--------------------------H
Q ss_conf             2488899988665-----2876885228899998-765021578822576289--------------------------9
Q gi|254780669|r  101 KKGREIFRDLKKK-----YGFPILTDVHTEQQCE-AIADSVDILQIPALLCRQ--------------------------T  148 (301)
Q Consensus       101 e~gL~il~e~k~~-----~glpv~TeV~~~~~~e-~~~~~vDilQIgA~~~rq--------------------------t  148 (301)
                      .+.-+-|+++|++     +.+|++.|||-...+. .+++++|-+.|--=|.-+                          .
T Consensus        69 ~~~A~al~~I~~~l~~~~~~iPlvADIHF~~~~a~~a~~~~~kiRINPGN~~~~~~~f~~~~~~deey~~~~~~~~e~~~  148 (606)
T PRK00694         69 IKEAQACEHIKERLIQQGISIPLVADIHFFPQAAMHVADFVDKVRINPGNYVDKRNMFTGKIYTDEQYAHSLLRLEEKFS  148 (606)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             99998699999998636999998866688889999999752838888997666644444333317777777776888999


Q ss_pred             HHHHHHHHCCCEEEE
Q ss_conf             999998505977998
Q gi|254780669|r  149 DLLTAAAQTGRVINV  163 (301)
Q Consensus       149 dLl~a~a~t~kpV~i  163 (301)
                      .+++++.+.+.|+-|
T Consensus       149 ~~v~~~k~~~~~iRI  163 (606)
T PRK00694        149 PLVEKCKRLGKAMRI  163 (606)
T ss_pred             HHHHHHHHCCCCEEE
T ss_conf             999999984998787


No 60 
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional
Probab=90.98  E-value=0.39  Score=28.38  Aligned_cols=99  Identities=23%  Similarity=0.330  Sum_probs=62.5

Q ss_pred             HHHHHHHHCCC----EEEEECCCCCCHHHHHHHHHHHHHCC-------CCCEEEEEC----C--------CCCCCHHHCC
Q ss_conf             99999850597----79983677789999999999997258-------780899514----6--------5444010000
Q gi|254780669|r  149 DLLTAAAQTGR----VINVKKGQFLSPWEMHNILQKLHAHG-------AKDVLFCER----G--------TSFGYNTLVT  205 (301)
Q Consensus       149 dLl~a~a~t~k----pV~iKkgq~~s~~e~~~a~eki~~~G-------n~~i~lcER----G--------~~fgy~~lvv  205 (301)
                      .|.+++..++-    .+-=+|-.+..+.+.+.|+|.+...|       +.+.++|.|    |        .--|.+.=+.
T Consensus       158 ~lARe~~~t~~iKLEVi~D~~tL~Pd~~etl~Aae~Lv~eGF~VlpY~~dDpv~akrLed~Gc~avMPlgsPIGSg~Gi~  237 (327)
T PRK11840        158 RLAREAGGWDLVKLEVLGDQKTLYPDMVETLKAAEVLVKEGFQVMVYCSDDPIAAKRLEDAGAVAVMPLGAPIGSGLGIQ  237 (327)
T ss_pred             HHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCEEEEECCCCCCCCCCCC
T ss_conf             99998559985899980797667998589999999999789889887169868999998759838862245234788868


Q ss_pred             CCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             0001068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  206 DMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       206 D~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      ...++.++.+ ...|||+|+--             |.    |+-|-.|+-.|+||+++-|
T Consensus       238 n~~~i~~i~e~~~vpvivDAGi-------------G~----pS~A~~aMElG~daVL~NT  280 (327)
T PRK11840        238 NPYTIRLIVEGAKVPVLVDAGV-------------GT----ASDAAVAMELGCDGVLMNT  280 (327)
T ss_pred             CHHHHHHHHHHCCCCEEEECCC-------------CC----HHHHHHHHHCCCCEEEHHH
T ss_conf             9999999997369978995798-------------98----7899999863666666336


No 61 
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed
Probab=90.95  E-value=1.3  Score=24.89  Aligned_cols=168  Identities=19%  Similarity=0.191  Sum_probs=98.1

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      ..++|+...+.|+...     --      =|-+..|.|     .++.|.++++.+++||+-  =|-++.|+.+... .+|
T Consensus        72 p~~~A~~Y~~~GA~ai-----SV------LTe~~~F~G-----s~~~L~~vr~~~~lPiLrKDFIid~~QI~ea~~~GAD  135 (261)
T PRK00278         72 PVEIAKAYEEGGAACL-----SV------LTDERFFQG-----SFEYLRAARAAVSLPVLRKDFIIDPYQIYEARAAGAD  135 (261)
T ss_pred             HHHHHHHHHHCCCCEE-----EE------EECCCCCCC-----CHHHHHHHHHHCCCCEEEEHEECCHHHHHHHHHCCCC
T ss_conf             9999999997799689-----99------513032488-----7999999998669987720101769999999981898


Q ss_pred             E-EEECHHHCCC--HHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH
Q ss_conf             7-8822576289--999999850597799836777899999999999972587808995146544401000000010688
Q gi|254780669|r  137 I-LQIPALLCRQ--TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM  213 (301)
Q Consensus       137 i-lQIgA~~~rq--tdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l  213 (301)
                      . |=|-+.|-..  .+|+..+..-|--+++-=+   +.+|+.    +....|.+=|-+--|--    .++-+|+.....+
T Consensus       136 aiLLI~~~L~~~~l~~l~~~a~~lgl~~LvEvh---~~~El~----~a~~~~a~iIGINnRnL----~t~~vd~~~~~~L  204 (261)
T PRK00278        136 AILLIVAALDDEQLKELLDLAHELGLDVLVEVH---DEEELE----RALKLGAPLIGINNRNL----KTFEVDLDTTERL  204 (261)
T ss_pred             CHHHHHHHCCHHHHHHHHHHHHHHCCEEEEEEC---CHHHHH----HHHHCCCCEEEEECCCC----HHCEECHHHHHHH
T ss_conf             578988755899999999999982990797768---999999----99847998898746771----1200378999999


Q ss_pred             HHHCCC--EEECHHHHHHHCCCCCCCCCCC--HHHHHHHHHHHHHHCCCEEEEEE----CCCHHHCC
Q ss_conf             851871--6871177742122345321263--88999999999971898899983----69833479
Q gi|254780669|r  214 TSMGVP--VIFDASHSVQQPGIHGNCSGGE--RQYIVPLAKAAVAIGIAGIFLET----HQDPDNAP  272 (301)
Q Consensus       214 k~~~~P--Vi~D~SHs~q~p~~~~~~~gG~--r~~v~~la~aa~a~G~dGlfiE~----Hp~P~~Al  272 (301)
                      .+. +|  +++ .+-            +|-  ++=+    +....+|+||+.|=.    .+||..++
T Consensus       205 ~~~-ip~~~~~-VsE------------SGI~~~~d~----~~l~~~G~davLIGeslm~~~dp~~~l  253 (261)
T PRK00278        205 APL-IPKDRLL-VSE------------SGIFTPEDL----KRLAKAGADAFLVGESLMRADDPGAAL  253 (261)
T ss_pred             HHH-CCCCCEE-EEC------------CCCCCHHHH----HHHHHCCCCEEEECHHHHCCCCHHHHH
T ss_conf             964-8999889-979------------999999999----999977999999897876799989999


No 62 
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed
Probab=90.81  E-value=1.5  Score=24.44  Aligned_cols=98  Identities=19%  Similarity=0.333  Sum_probs=65.7

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCEEEEECC--CHHH----HHHHHHH-CCEEEECHHHCCC-------------HHHHHHH
Q ss_conf             24567124888999886652876885228--8999----9876502-1578822576289-------------9999998
Q gi|254780669|r   95 KRGVGLKKGREIFRDLKKKYGFPILTDVH--TEQQ----CEAIADS-VDILQIPALLCRQ-------------TDLLTAA  154 (301)
Q Consensus        95 frG~Gle~gL~il~e~k~~~glpv~TeV~--~~~~----~e~~~~~-vDilQIgA~~~rq-------------tdLl~a~  154 (301)
                      +...|.++-|+.+++.|+.+++|++--|.  .+++    +..+.+. +|.|.+--..+-+             .++++++
T Consensus        81 ~~n~g~e~~l~~i~~~k~~~~~pvIaSi~g~s~ee~~~~a~~~e~~gadaiElNis~~~~~~~~~~~~~~~~~~~iv~~V  160 (333)
T PRK07565         81 YFRGGPEEYLELIRRAKEAVDIPVIASLNGSSAGGWVDYARQIEEAGADALELNIYYLPTDPDISGAEVEQRYLDILRAV  160 (333)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             56868999999999877505984598747799899999999997649988999766779886544465078899999999


Q ss_pred             HH-CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             50-59779983677789999999999997258780899514
Q gi|254780669|r  155 AQ-TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       155 a~-t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      .+ +++||.+|=....  .+....+..+.+.|.+-|.++-|
T Consensus       161 ~~~~~~Pv~vKLsPn~--tdi~~iA~aa~~~Gadgv~~iNT  199 (333)
T PRK07565        161 KSAVSIPVAVKLSPYF--SNLANMAKRLDAAGADGLVLFNR  199 (333)
T ss_pred             HHHCCCCEEEECCCCC--CHHHHHHHHHHHCCCCEEEEECC
T ss_conf             8646885687359982--10999999999749988998436


No 63 
>PRK11579 putative oxidoreductase; Provisional
Probab=90.14  E-value=1.2  Score=25.21  Aligned_cols=70  Identities=16%  Similarity=0.182  Sum_probs=56.4

Q ss_pred             HHCCEEEEECCCHHHHHHHHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             528768852288999987650-215788225762899999998505977998367778999999999999725878
Q gi|254780669|r  113 KYGFPILTDVHTEQQCEAIAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       113 ~~glpv~TeV~~~~~~e~~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      ..++++.++.   +  +.+.+ -+|.+-|..-+....++..++.+.||.|++-|+...+..|..-.++.....|..
T Consensus        47 ~~~~~~~~~~---~--~ll~~~~id~V~i~tp~~~H~~~~~~al~aGkhv~~EKP~a~~~~~a~~l~~~a~~~g~~  117 (346)
T PRK11579         47 WPTVTVVSEP---K--HLFNDPNIDLIVIPTPNDTHFPLAKAALEAGKHVVVDKPFTVTLSQARELDALAKSLGRV  117 (346)
T ss_pred             CCCCCEECCH---H--HHHCCCCCCEEEECCCCHHHHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHCCCE
T ss_conf             5899538999---9--994599999999979967899999999987994895387678799999999999872967


No 64 
>COG3200 AroG 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]
Probab=90.13  E-value=1.8  Score=24.06  Aligned_cols=129  Identities=19%  Similarity=0.220  Sum_probs=74.9

Q ss_pred             CEEEECHHHCCCHHH-HHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC-CEEEEECCCCCCCHHHCCC--CCCCH
Q ss_conf             578822576289999-9998505977998367778999999999999725878-0899514654440100000--00106
Q gi|254780669|r  136 DILQIPALLCRQTDL-LTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAK-DVLFCERGTSFGYNTLVTD--MRSIP  211 (301)
Q Consensus       136 DilQIgA~~~rqtdL-l~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~-~i~lcERG~~fgy~~lvvD--~~~i~  211 (301)
                      -++|||-|.-|--.- +.=+....-||-+|=|..+++++.+--++.+.-...+ .+-|+-|   ||+... -|  .+-+.
T Consensus       260 HmlWIGeRTRq~D~AHVe~~rgv~NPig~K~GP~~~~d~ll~l~d~LnP~nepGRLtLi~R---mG~dKV-~d~LP~li~  335 (445)
T COG3200         260 HMLWIGERTRQPDGAHVEFLRGVKNPIGVKIGPSMTPDELLELIDRLNPHNEPGRLTLIAR---MGADKV-GDRLPPLVE  335 (445)
T ss_pred             CEEEECCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCEEEEEHH---CCCHHH-HHHHHHHHH
T ss_conf             2355323235887008999974578601001898998999999985197788860787401---051577-766569999


Q ss_pred             HHHHHCCCEE--ECHHHHHHHCCCCCCCCCCC---HHHHHHHHHHHHHHC--CCEEEEEECCCH
Q ss_conf             8885187168--71177742122345321263---889999999999718--988999836983
Q gi|254780669|r  212 IMTSMGVPVI--FDASHSVQQPGIHGNCSGGE---RQYIVPLAKAAVAIG--IAGIFLETHQDP  268 (301)
Q Consensus       212 ~lk~~~~PVi--~D~SHs~q~p~~~~~~~gG~---r~~v~~la~aa~a~G--~dGlfiE~Hp~P  268 (301)
                      ..++.+.+||  +||-|.--.-.++|-+|---   -+=|...-....+-|  .-|+-+|.-.+-
T Consensus       336 av~~eG~~VvWs~DPMHGNTi~a~~gyKTR~fd~Il~EV~sFfeihraeG~hpgGiHlEmTg~d  399 (445)
T COG3200         336 AVEAEGHQVIWSSDPMHGNTIKASTGYKTRPFDRILDEVQSFFEIHRAEGTHPGGIHLEMTGED  399 (445)
T ss_pred             HHHHCCCCEEEECCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCC
T ss_conf             9997388348734788786234478875761899999999999999851777870378843763


No 65 
>CHL00162 thiG thiamin biosynthesis protein G; Validated
Probab=89.95  E-value=0.47  Score=27.83  Aligned_cols=188  Identities=19%  Similarity=0.293  Sum_probs=92.0

Q ss_pred             CCCEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             17706835787727976997069995486349999999999999996553399706601557688666322245671248
Q gi|254780669|r   24 TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG  103 (301)
Q Consensus        24 ~~~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~g  103 (301)
                      .+....||+    .+|..  +  +|-|----.|.+.   +.+.+...+.++..--+.        |.....-.+     .
T Consensus         4 ~~D~l~I~g----~~f~S--R--LilGTgkY~s~~~---~~~ai~aSgaeiVTVAlR--------R~~~~~~~~-----~   59 (267)
T CHL00162          4 MTDPLKIGN----KSFNS--R--LMLGTGKYRNLEE---AINSIEASGCEIVTVAIR--------RAQNNKLNG-----N   59 (267)
T ss_pred             CCCCEEECC----EEEEC--C--EEEECCCCCCHHH---HHHHHHHHCCCEEEEEEE--------CCCCCCCCC-----H
T ss_conf             898669999----99885--3--2787289999999---999999969987999973--------255778887-----4


Q ss_pred             HHHHHHHHH-HH-CCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCC-CEEE-----EECCCCCCHHHHH
Q ss_conf             889998866-52-87688522889999876502157882257628999999985059-7799-----8367778999999
Q gi|254780669|r  104 REIFRDLKK-KY-GFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTG-RVIN-----VKKGQFLSPWEMH  175 (301)
Q Consensus       104 L~il~e~k~-~~-glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~-kpV~-----iKkgq~~s~~e~~  175 (301)
                      -.+|..++. +| =||-..-.+..+++=..++-          .|  +++.++|..+ ..|-     =++-....+.|.+
T Consensus        60 ~~~l~~i~~~~~~~LPNTAGc~taeEAVr~A~l----------AR--El~~~~g~~~tnwIKLEVi~D~~tLlPD~~etl  127 (267)
T CHL00162         60 SSLLDGLDWNKLWLLPNTAGCQTAEEAIRVAFL----------GR--ELAKQLGQEDNNFVKLEVIPDPKYLLPDPIGTL  127 (267)
T ss_pred             HHHHHHCCCCCEEECCCCCCCCCHHHHHHHHHH----------HH--HHHHHCCCCCCCEEEEEEECCCCCCCCCHHHHH
T ss_conf             678743370241785663022879999999999----------99--985301567897799998279877798878999


Q ss_pred             HHHHHHHHCC-------CCCEEEEEC------------CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCC
Q ss_conf             9999997258-------780899514------------654440100000001068885-18716871177742122345
Q gi|254780669|r  176 NILQKLHAHG-------AKDVLFCER------------GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHG  235 (301)
Q Consensus       176 ~a~eki~~~G-------n~~i~lcER------------G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~  235 (301)
                      .|+|.+...|       +++.++|.|            |.--|.+.=+.+..++.++.+ ...|||+|+--         
T Consensus       128 ~Aae~Lv~eGF~VlpY~~dD~v~akrLe~~Gc~avMPlgsPIGSg~Gl~n~~~l~~i~e~~~vPvIVDAGi---------  198 (267)
T CHL00162        128 KAAEFLVRKGFTVLPYINADPVLAKQLEDIGCATVMPLGSPIGSGQGLQNLLNLQIIIENAKIPVIIDAGI---------  198 (267)
T ss_pred             HHHHHHHHCCCEEEEECCCCHHHHHHHHHCCCEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCEEEECCC---------
T ss_conf             99999997899998954899899999986598688634551236887589999999996489988996898---------


Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             32126388999999999971898899983
Q gi|254780669|r  236 NCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       236 ~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                          |.    |+-|-.|+-.|+||+++-|
T Consensus       199 ----G~----pSdAa~aMElG~DaVL~NT  219 (267)
T CHL00162        199 ----GT----PSEASQAMELGASGVLLNT  219 (267)
T ss_pred             ----CC----HHHHHHHHHCCCCEEEECH
T ss_conf             ----96----7888999974677787016


No 66 
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=89.94  E-value=1.8  Score=23.96  Aligned_cols=141  Identities=15%  Similarity=0.218  Sum_probs=93.6

Q ss_pred             HHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCCEEEECHHHCCCHHHHHHHHHCC--CE---EEEECCC-----
Q ss_conf             24888999886652876885--2288999987650-2157882257628999999985059--77---9983677-----
Q gi|254780669|r  101 KKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVDILQIPALLCRQTDLLTAAAQTG--RV---INVKKGQ-----  167 (301)
Q Consensus       101 e~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vDilQIgA~~~rqtdLl~a~a~t~--kp---V~iKkgq-----  167 (301)
                      ..-+++++++.+..++|+-.  =|.+.++++.+.+ .+|-+=||+....|.+++.++++..  +.   +-.|++.     
T Consensus        62 ~~n~~~I~~i~~~~~~~iqvGGGIRs~e~i~~~l~~G~~rViigT~a~~~~~~l~~~~~~f~~~Ivv~iD~~~~~v~~~G  141 (234)
T PRK13587         62 AREFDYIKSLRRLTTKDIEVGGGIRTKSQIMDYFAAGINYCIVGTKGIQDTDWLKEMAHTFPGRIYLSVDAYGEDIKVNG  141 (234)
T ss_pred             CCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHCCCCEEEEEECCCCEEEECC
T ss_conf             43799999998437986798465475999999997689999988813028699999998666776871202385454457


Q ss_pred             --CCCHHHHHHHHHHHHHCCCCCEEEEEC---CCCCCCHHHCCCCCCCHHHH-HHCCCEEECHHHHHHHCCCCCCCCCCC
Q ss_conf             --789999999999997258780899514---65444010000000106888-518716871177742122345321263
Q gi|254780669|r  168 --FLSPWEMHNILQKLHAHGAKDVLFCER---GTSFGYNTLVTDMRSIPIMT-SMGVPVIFDASHSVQQPGIHGNCSGGE  241 (301)
Q Consensus       168 --~~s~~e~~~a~eki~~~Gn~~i~lcER---G~~fgy~~lvvD~~~i~~lk-~~~~PVi~D~SHs~q~p~~~~~~~gG~  241 (301)
                        -.|-.+..-.++++...|...+++|.=   |+.-|+|     +..+..+. ....|||.               +||-
T Consensus       142 W~~~s~~~~~d~~~~~~~~g~~~il~TdI~rDGtl~G~n-----~el~~~i~~~~~~pvIa---------------SGGv  201 (234)
T PRK13587        142 WEEDTELNLFSFVRQLSDIPLGGIIYTDIAKDGKMSGPN-----FELTGQLVKATTIPVIA---------------SGGI  201 (234)
T ss_pred             CCEECCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCCC-----HHHHHHHHHHCCCCEEE---------------ECCC
T ss_conf             514258679999999974398789984026657455799-----99999999767999999---------------8998


Q ss_pred             HHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             8899999999997189889998
Q gi|254780669|r  242 RQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       242 r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      +.+= .+.+ ....|++|..+=
T Consensus       202 ~sl~-Di~~-L~~~gv~GvIvG  221 (234)
T PRK13587        202 RHQQ-DIQR-LASLNVHAAIIG  221 (234)
T ss_pred             CCHH-HHHH-HHHCCCCEEEEE
T ss_conf             9999-9999-998899899999


No 67 
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=89.77  E-value=1.9  Score=23.87  Aligned_cols=187  Identities=18%  Similarity=0.247  Sum_probs=116.9

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHHH-CC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--22889999876502-15
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIADS-VD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~~-vD  136 (301)
                      -.+.|+...+.|++..    +=.-.|.       +..|-+  .-+++++++.+++++|+.-  =|.+.++++.+.+. +|
T Consensus        33 P~~~a~~~~~~Ga~~l----hivDLd~-------a~~g~~--~n~~~I~~i~~~~~~pi~vGGGIrs~~~i~~~l~~Ga~   99 (240)
T PRK13585         33 PVEVAKRWVDAGAKTL----HLVDLDG-------AFEGSR--KNADIIEKIVEATDVSIQLGGGIRSVEDAASLLDLGVD   99 (240)
T ss_pred             HHHHHHHHHHCCCCEE----EEEECCC-------CCCCCC--CHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCC
T ss_conf             9999999998799979----9998977-------211894--44999999997379778997885879999999976998


Q ss_pred             EEEECHHHCCCHHHHHHHHHC---CC---EEEEECCCCCC-------HHHHHHHHHHHHHCCCCCEEEEEC---CCCCCC
Q ss_conf             788225762899999998505---97---79983677789-------999999999997258780899514---654440
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQT---GR---VINVKKGQFLS-------PWEMHNILQKLHAHGAKDVLFCER---GTSFGY  200 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t---~k---pV~iKkgq~~s-------~~e~~~a~eki~~~Gn~~i~lcER---G~~fgy  200 (301)
                      -+=|++-...+.+++.++++.   .+   -+-+|+|+...       ..+..-.++++...|...++++.=   |+.-|+
T Consensus       100 kvvigs~~~~~~~~~~~i~~~~G~~~ivvsiD~k~~~v~~~gw~~~~~~~~~e~~~~~~~~g~~eii~tdI~~dGt~~G~  179 (240)
T PRK13585        100 RVILGTAAIENPELVRELSDEFGSERVMVSLDAKDGEVVIEGWTESTGKDPVEWAQRFEELGAGSILFTNVDVEGLLQGV  179 (240)
T ss_pred             EEEECCCCHHCCHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEECCHHHHCCC
T ss_conf             99939811318428899998739721799999306502324765678863557778888638735898642332232578


Q ss_pred             HHHCCCCCCCHHHH-HHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCC
Q ss_conf             10000000106888-51871687117774212234532126388999999999971898899983698334797820186
Q gi|254780669|r  201 NTLVTDMRSIPIMT-SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI  279 (301)
Q Consensus       201 ~~lvvD~~~i~~lk-~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l  279 (301)
                      +     +..+..+. ....|||.               +||-+.+=. +. .....|++|..+=.      |+-+  ..+
T Consensus       180 d-----~~~~~~i~~~~~~pvia---------------sGGv~s~~d-i~-~l~~~g~~gvivG~------Al~~--g~i  229 (240)
T PRK13585        180 N-----PEPVRELVDSVDIPVIA---------------SGGVTSLDD-VK-ALKEAGAAGVVVGS------ALYK--GKF  229 (240)
T ss_pred             C-----HHHHHHHHHHCCCCEEE---------------ECCCCCHHH-HH-HHHHCCCCEEEEEH------HHHC--CCC
T ss_conf             9-----89999999868999999---------------889999999-99-99978997899876------8767--997


Q ss_pred             CHHHHHHHHH
Q ss_conf             8899999999
Q gi|254780669|r  280 NIKDLPKLLS  289 (301)
Q Consensus       280 ~l~~l~~ll~  289 (301)
                      ++++..+.++
T Consensus       230 ~l~e~~~~~~  239 (240)
T PRK13585        230 TLEEALEAAE  239 (240)
T ss_pred             CHHHHHHHHH
T ss_conf             8999999964


No 68 
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed
Probab=89.77  E-value=1.9  Score=23.87  Aligned_cols=174  Identities=14%  Similarity=0.239  Sum_probs=100.3

Q ss_pred             CCCEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHH---HHHCCCCEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             17706835787727976997069995486349999999999999996---553399706601557688666322245671
Q gi|254780669|r   24 TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAI---CQSLNIGLVYKSSFDKANRSSLAGKRGVGL  100 (301)
Q Consensus        24 ~~~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~---~~~~~~~~ifK~sfdKanRtS~~sfrG~Gl  100 (301)
                      ..+.+.+    +++.+||+.|..+ ---+.-.+.|. ..+.++++++   |..+-             |-+..+      
T Consensus        11 ~Tr~V~V----G~v~IGG~~PI~V-QSMt~t~T~Dv-~at~~Qi~~L~~aGceiV-------------Rvavp~------   65 (367)
T PRK00366         11 KTRQVKV----GNVPIGGDAPIVV-QSMTNTDTADV-EATVAQIKRLARAGCEIV-------------RVAVPD------   65 (367)
T ss_pred             CCEEEEE----CCEEECCCCCEEE-EECCCCCCHHH-HHHHHHHHHHHHCCCCEE-------------EECCCC------
T ss_conf             5606898----5860479995025-75689974438-999999999998499989-------------984599------


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCHHHHH-HHHH-HCCEEEECHHHCCC----HHHHHHHHHCCCEEEE-----------
Q ss_conf             24888999886652876885228899998-7650-21578822576289----9999998505977998-----------
Q gi|254780669|r  101 KKGREIFRDLKKKYGFPILTDVHTEQQCE-AIAD-SVDILQIPALLCRQ----TDLLTAAAQTGRVINV-----------  163 (301)
Q Consensus       101 e~gL~il~e~k~~~glpv~TeV~~~~~~e-~~~~-~vDilQIgA~~~rq----tdLl~a~a~t~kpV~i-----------  163 (301)
                      .+..+-|.+++++..+|++.|+|-..+.. .+.+ .+|-+.|--=|...    ..+++++.+.++||-|           
T Consensus        66 ~~~a~al~~I~~~~~iPlvADIHF~~~lAl~a~~~g~~kiRINPGNig~~e~~~~vv~~ak~~~ipIRIGvN~GSL~~~l  145 (367)
T PRK00366         66 MEAAAALPEIKKQLPVPLVADIHFDYRLALKAAEAGADALRINPGNIGRDERFKEVVEAAKDYGIPIRIGVNAGSLEKDL  145 (367)
T ss_pred             HHHHHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHHHHHEEECCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCCCHHH
T ss_conf             99999699999847897031254148999999986411131378756864889999999998499766446778767999


Q ss_pred             -ECCCCCCHHHHH-HHH---HHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH-HHHCCCEEECHHHH
Q ss_conf             -367778999999-999---99972587808995146544401000000010688-85187168711777
Q gi|254780669|r  164 -KKGQFLSPWEMH-NIL---QKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM-TSMGVPVIFDASHS  227 (301)
Q Consensus       164 -Kkgq~~s~~e~~-~a~---eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l-k~~~~PVi~D~SHs  227 (301)
                       .|--..+++-|. +|.   +.+.+.|-.|+.+--.-     ++..+-..+--.+ ++..+|.=+-.|.+
T Consensus       146 l~kyg~~~~~amveSAl~~~~~~e~~~f~~iviS~Ka-----S~v~~~v~ayr~la~~~dyPLHLGvTEA  210 (367)
T PRK00366        146 LEKYGEPTPEALVESALRHAKILEELGFDDIKISVKA-----SDVQDLIAAYRLLAKRCDYPLHLGVTEA  210 (367)
T ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEC-----CCHHHHHHHHHHHHHHCCCCCEEEECCC
T ss_conf             9870898679999999999999997898559999872-----8699999999999985798834514267


No 69 
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=89.68  E-value=1.9  Score=23.90  Aligned_cols=47  Identities=17%  Similarity=0.219  Sum_probs=29.7

Q ss_pred             HHHHHHHH---CCCEEEEECC------CCCCHHHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             99999850---5977998367------778999999999999725878089951465
Q gi|254780669|r  149 DLLTAAAQ---TGRVINVKKG------QFLSPWEMHNILQKLHAHGAKDVLFCERGT  196 (301)
Q Consensus       149 dLl~a~a~---t~kpV~iKkg------q~~s~~e~~~a~eki~~~Gn~~i~lcERG~  196 (301)
                      ++++++.+   .+-+|-+|=.      -..+++|+...++.+.+.|-.=|-+ -.|.
T Consensus       196 eii~air~~vg~df~vgvRls~~d~~~~g~~~~e~~~~~~~l~~~gvd~i~v-s~g~  251 (327)
T cd02803         196 EIVAAVREAVGPDFPVGVRLSADDFVPGGLTLEEAIEIAKALEEAGVDALHV-SGGS  251 (327)
T ss_pred             HHHHHHHHHCCCCCCEEEEECHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEE-CCCC
T ss_conf             9999999973988761799770212689999899999999998559998997-7784


No 70 
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins.  DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively.  This subgroup has the conserved FMN binding site, but lacks some catalytic residues and may therefore be inactive.
Probab=89.09  E-value=2.1  Score=23.55  Aligned_cols=99  Identities=20%  Similarity=0.375  Sum_probs=65.7

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCEEEEECCC--HHH----HHHHHHH-CCEEEECHH--------HCCC-----HHHHHH
Q ss_conf             2245671248889998866528768852288--999----9876502-157882257--------6289-----999999
Q gi|254780669|r   94 GKRGVGLKKGREIFRDLKKKYGFPILTDVHT--EQQ----CEAIADS-VDILQIPAL--------LCRQ-----TDLLTA  153 (301)
Q Consensus        94 sfrG~Gle~gL~il~e~k~~~glpv~TeV~~--~~~----~e~~~~~-vDilQIgA~--------~~rq-----tdLl~a  153 (301)
                      ++..+|.+.-|+.++++++++++|++--+.-  +++    ++.+.+. +|.+.+--.        .+.+     .+++++
T Consensus        78 g~~n~g~e~~l~~i~~~~~~~~~pvI~Si~g~s~ee~~~~a~~~~~~gad~lElNls~~~~~~~~~~~~~~~~~~~iv~~  157 (325)
T cd04739          78 GRYNLGPEEYLELIRRAKRAVSIPVIASLNGVSAGGWVDYARQIEEAGADALELNIYALPTDPDISGAEVEQRYLDILRA  157 (325)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             45575899999999998753598759871689989999999999764998799965667888554421068899999999


Q ss_pred             HHH-CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             850-59779983677789999999999997258780899514
Q gi|254780669|r  154 AAQ-TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       154 ~a~-t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      +.+ +++||.+|=....  .+....++.+.+.|.+-+.++-+
T Consensus       158 Vk~~~~~Pv~vKLsP~~--~di~~ia~aa~~~GAdgi~liNT  197 (325)
T cd04739         158 VKSAVTIPVAVKLSPFF--SALAHMAKQLDAAGADGLVLFNR  197 (325)
T ss_pred             HHHCCCCCEEEECCCCC--CHHHHHHHHHHHCCCCEEEEECC
T ss_conf             98607886699539983--00999999999759988997357


No 71 
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ. This clade of sequences is highly similar to the HisF protein, but generally represents the second HisF homolog in the genome where the other is an authentic HisF observed in the context of a complete histidine biosynthesis operon. The similarity between these WbuZ sequences and true HisFs is such that often the closest match by BLAST of a WbuZ is a HisF. Only by making a multiple sequence alignment is the homology relationship among the WbuZ sequences made apparent. WbuZ genes are invariably observed in the presence of a homolog of the HisH protein (designated WbuY) and a proposed N-acetyl sugar amidotransferase designated in WbuX in E. coli, IfnA in P. aeriginosa and PseA in C. jejuni. Similarly, this trio of genes is invariably found in the context of saccharide biosynthesis loci. It has been shown that the WbuYZ homologs are not essential components of the activity expressed by WbuX, leading to the proposal that these to pr
Probab=89.03  E-value=2.1  Score=23.52  Aligned_cols=167  Identities=23%  Similarity=0.316  Sum_probs=109.5

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      -.++|+...+.+.+..    .=--.|.       ++.|.  ..-+++++++.++..+|+.-  =|.+.++++.+.+ .+|
T Consensus        32 P~~~ak~~~~~g~d~l----hivDld~-------a~~~~--~~n~~~I~~i~~~~~ipi~vGGGIrs~e~~~~ll~~Gad   98 (232)
T TIGR03572        32 PVNAARIYNAKGADEL----IVLDIDA-------SKRGR--EPLFELISNLAEECFMPLTVGGGIRSLEDAKKLLSLGAD   98 (232)
T ss_pred             HHHHHHHHHHCCCCEE----EEEECCC-------CCCCC--CCHHHHHHHHHHHCCCCEEEEECEEEHHHHHHHHHCCCC
T ss_conf             9999999998699999----9996876-------43488--217999999999729858997133038999999976996


Q ss_pred             EEEECHHHCCCHHHHHHHHHC-C--CE---EEEECC-------------C---CCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             788225762899999998505-9--77---998367-------------7---789999999999997258780899514
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQT-G--RV---INVKKG-------------Q---FLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t-~--kp---V~iKkg-------------q---~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      -+=|++....|.+++.++++. |  +.   +-+|++             +   ..++.||   ++++.+.|...++++.=
T Consensus        99 kViigs~a~~~p~~~~~~~~~~G~q~ivvsiD~k~~~~~~~~~v~~~g~~~~~~~~~~~~---i~~~~~~g~geii~tdI  175 (232)
T TIGR03572        99 KVSINTAALENPDLIEEAARRFGSQCVVVSIDVKKELDGSDYKVYSDNGRRATGRDPVEW---AREAEQLGAGEILLNSI  175 (232)
T ss_pred             EEEECHHHHHCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCEEEEECCCCCCCCCCHHHH---HHHHHHCCCCEEEEEEE
T ss_conf             899345452193577899998699458999998416778727999667763579879999---99987359989999888


Q ss_pred             ---CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             ---654440100000001068885-187168711777421223453212638899999999997189889998
Q gi|254780669|r  195 ---GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       195 ---G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                         |+..|++     +.-+..+++ +..|+|.               +||-+.+ ..+.+.+...+++|+.+-
T Consensus       176 ~~DG~~~G~d-----~~l~~~i~~~~~~piia---------------sGGi~~~-~di~~l~~~~~~~gv~~g  227 (232)
T TIGR03572       176 DRDGTMKGYD-----LELIKTVSDAVSIPVIA---------------LGGAGSL-DDLVEVALEAGASAVAAA  227 (232)
T ss_pred             CCCCCCCCCC-----HHHHHHHHHHCCCCEEE---------------ECCCCCH-HHHHHHHHHCCCEEEEEE
T ss_conf             5768567689-----99999999868999999---------------8898999-999999985898199972


No 72 
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain. This family is involved in biosynthesis of guanosine nucleotide. Members of this family contain a TIM barrel structure. In the inosine monophosphate dehydrogenases 2 CBS domains pfam00571 are inserted in the TIM barrel. This family is a member of the common phosphate binding site TIM barrel family.
Probab=88.76  E-value=2.2  Score=23.40  Aligned_cols=140  Identities=24%  Similarity=0.357  Sum_probs=79.0

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCEEEEECC---------------------------------------CHHHHHHH-HHHC
Q ss_conf             4567124888999886652876885228---------------------------------------89999876-5021
Q gi|254780669|r   96 RGVGLKKGREIFRDLKKKYGFPILTDVH---------------------------------------TEQQCEAI-ADSV  135 (301)
Q Consensus        96 rG~Gle~gL~il~e~k~~~glpv~TeV~---------------------------------------~~~~~e~~-~~~v  135 (301)
                      .|..++++.++|.+-|.+ .+||+.|-.                                       +.+-++.+ ...+
T Consensus       158 ~~~~~~ea~~~l~~~kie-klpvvd~~g~L~glit~kDi~k~~~~P~a~~D~~grL~VgAAVG~~~~~~eRa~~Lv~aGv  236 (467)
T pfam00478       158 EGITLEEANEILHEHKIE-KLPIVDDDGELVGLITRKDIEKARDYPNASKDAQGRLLVGAAVGTRDDDLERAEALVEAGV  236 (467)
T ss_pred             CCCCHHHHHHHHHHHHHH-HCCEECCCCCEEEEEEHHHHHHHHCCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHCCC
T ss_conf             889989999999975564-1544467883788887434677420785222656777999980678659999999987699


Q ss_pred             CEEEECHHHCCCHHHHHHHHHC-----CCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE--------EECCC-CCCCH
Q ss_conf             5788225762899999998505-----9779983677789999999999997258780899--------51465-44401
Q gi|254780669|r  136 DILQIPALLCRQTDLLTAAAQT-----GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLF--------CERGT-SFGYN  201 (301)
Q Consensus       136 DilQIgA~~~rqtdLl~a~a~t-----~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~l--------cERG~-~fgy~  201 (301)
                      |+|=|-.-+-.+...++.+.+.     +.+|.  -|--.+.+    +++.+...|.+-|-.        +-|-. -+|+.
T Consensus       237 DvivIDtAhGhs~~vi~~ik~ik~~~p~~~iI--aGNVaT~e----~a~~Li~aGAD~vKVGiGpGSiCTTR~v~GvG~P  310 (467)
T pfam00478       237 DVIVIDSAHGHSEYVLEMIKWIKKKYPDLDVI--AGNVVTAE----AARELIDAGADAVKVGIGPGSICTTREVAGVGRP  310 (467)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCCCCEE--EEEECCHH----HHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             88997344544188999999987407877378--51005899----9999997077757755668865656420366775


Q ss_pred             HHCCCCCCCH----HHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             0000000106----8885187168711777421223453212638899999999997189889998
Q gi|254780669|r  202 TLVTDMRSIP----IMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       202 ~lvvD~~~i~----~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      .    +.++.    ..++++.|||-|--=                .+.-.++| |+|+|+|.+|+=
T Consensus       311 Q----~tAv~~~a~~a~~~~vpiIADGGi----------------~~sGDi~K-AlaaGAd~VMlG  355 (467)
T pfam00478       311 Q----LTAVYEVADAARKLGVPVIADGGI----------------RYSGDIAK-ALAAGASAVMLG  355 (467)
T ss_pred             H----HHHHHHHHHHHHHCCCEEEECCCC----------------CCHHHHHH-HHHCCCCEEEEC
T ss_conf             0----879999999986569879944762----------------33048999-987289889877


No 73 
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated
Probab=88.52  E-value=2.3  Score=23.30  Aligned_cols=168  Identities=17%  Similarity=0.250  Sum_probs=107.7

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      -.++|+...+.|.+..    .=--.|-       ++.|-+  .-+++++++.+++.+|+.-  =|.+.++++.+.+ .+|
T Consensus        31 P~~~A~~~~~~Ga~~l----hvvDLd~-------A~~g~~--~n~~~I~~i~~~~~~pi~vGGGIrs~e~~~~~l~~Gad   97 (241)
T PRK00748         31 PLAQAQAWQDQGAEWL----HLVDLDG-------AFAGRP--VNLELIEAIVAAVDIPVQLGGGIRDLETVEAYLDAGVA   97 (241)
T ss_pred             HHHHHHHHHHCCCCEE----EEEECCC-------CCCCCC--CHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCC
T ss_conf             9999999998799989----9997854-------202882--07999999998679999982770749999999976977


Q ss_pred             EEEECHHHCCCHHHHHHHHHC--CCEE---EEECCC----------CCCHHHHHHHHHHHHHCCCCCEEEEEC---CCCC
Q ss_conf             788225762899999998505--9779---983677----------789999999999997258780899514---6544
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQT--GRVI---NVKKGQ----------FLSPWEMHNILQKLHAHGAKDVLFCER---GTSF  198 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t--~kpV---~iKkgq----------~~s~~e~~~a~eki~~~Gn~~i~lcER---G~~f  198 (301)
                      -+=|++....|.+++.++.+.  .+.|   -+|+++          ..+++|   .++++.+.|...++++.=   |+.-
T Consensus        98 kVvigS~a~~n~~~i~~~~~~~g~~ivvsiD~k~~~v~~~gw~~~t~~~~~~---~i~~~~~~G~~eii~tdI~~DGt~~  174 (241)
T PRK00748         98 RVIIGTAAVKNPELVKEACKKFPGRIVVGLDARDGKVATRGWQEVSGVDLED---LAKRFEDAGVAAIIYTDISRDGTLS  174 (241)
T ss_pred             EEEECCHHHHCHHHHHHHHHHCCCCEEEEEEECCCEEECCCCCCCCCCCHHH---HHHHHHHCCCCEEEEEEEECCCCCC
T ss_conf             5886471033968999998623555799998216654015755467974899---9999985587569998870568547


Q ss_pred             CCHHHCCCCCCCHHHH-HHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHH-HHHHCCCEEEEE
Q ss_conf             4010000000106888-5187168711777421223453212638899999999-997189889998
Q gi|254780669|r  199 GYNTLVTDMRSIPIMT-SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKA-AVAIGIAGIFLE  263 (301)
Q Consensus       199 gy~~lvvD~~~i~~lk-~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~a-a~a~G~dGlfiE  263 (301)
                      |++     +.-+..+. ....|||.               +||-+.+-.--... .-..|++|..+=
T Consensus       175 G~d-----~~l~~~i~~~~~ipvia---------------sGGv~s~~Di~~L~~~~~~gv~gviiG  221 (241)
T PRK00748        175 GPN-----VELTRELAAATPIPVIA---------------SGGVSSLDDIRALKALGPEGVEGVIVG  221 (241)
T ss_pred             CCC-----HHHHHHHHHHCCCCEEE---------------ECCCCCHHHHHHHHHCCCCCCCEEEEE
T ss_conf             689-----99999999868998999---------------889999999999986031792489987


No 74 
>pfam04551 GcpE GcpE protein. In a variety of organisms, including plants and several eubacteria, isoprenoids are synthesized by the mevalonate-independent 2-C-methyl-D-erythritol 4-phosphate (MEP) pathway. Although different enzymes of this pathway have been described, the terminal biosynthetic steps of the MEP pathway have not been fully elucidated. GcpE gene of Escherichia coli is involved in this pathway.
Probab=88.48  E-value=2.3  Score=23.28  Aligned_cols=173  Identities=14%  Similarity=0.259  Sum_probs=99.2

Q ss_pred             CEEEECCCCCCEEECCCCCEEEEECCCCCCCHHH--HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             7068357877279769970699954863499999--99999999996553399706601557688666322245671248
Q gi|254780669|r   26 AAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDH--AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG  103 (301)
Q Consensus        26 ~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~--~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~g  103 (301)
                      +.+.+    |++.+||+.|..+ ---+.-.+.|.  ..+-...|.+.|.++-             |-+..     . .+.
T Consensus         2 r~V~V----G~v~IGG~~PI~V-QSMt~t~T~Dv~atv~Qi~~L~~aGceiV-------------Rvavp-----~-~~~   57 (345)
T pfam04551         2 RPVKV----GNVPIGGDAPISV-QSMTNTDTRDVEATVAQIKRLEEAGCDIV-------------RVAVP-----D-MEA   57 (345)
T ss_pred             CEEEE----CCEEECCCCCEEE-EECCCCCCCCHHHHHHHHHHHHHCCCCEE-------------EECCC-----C-HHH
T ss_conf             47998----4862679895766-75689986208999999999998599989-------------98879-----9-999


Q ss_pred             HHHHHHHHHHHCCEEEEECCCHHHHHH-HHH-HCCEEEECHHHCCCH----HHHHHHHHCCCEEEEE------------C
Q ss_conf             889998866528768852288999987-650-215788225762899----9999985059779983------------6
Q gi|254780669|r  104 REIFRDLKKKYGFPILTDVHTEQQCEA-IAD-SVDILQIPALLCRQT----DLLTAAAQTGRVINVK------------K  165 (301)
Q Consensus       104 L~il~e~k~~~glpv~TeV~~~~~~e~-~~~-~vDilQIgA~~~rqt----dLl~a~a~t~kpV~iK------------k  165 (301)
                      .+-|.++++...+|++.|+|-..+.-. +.+ .+|-+.|--=|....    .+++++.+.++||-|=            |
T Consensus        58 a~al~~I~~~~~iPlVADIHF~~~lAl~a~~~g~~kiRINPGNig~~~~~~~vv~~ak~~~~pIRIGvN~GSL~~~~l~k  137 (345)
T pfam04551        58 AEALKEIKKQSPIPLVADIHFDYRLALEAIEAGVDKIRINPGNIGRREKVKEVVEAAKERGIPIRIGVNSGSLEKRILEK  137 (345)
T ss_pred             HHHHHHHHHHCCCCCEEECCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHH
T ss_conf             98499999858997140042489999999986220156799774867878999999998399789832677768899987


Q ss_pred             CCCCCHHHHH-HH---HHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH-HHHCCCEEECHHHH
Q ss_conf             7778999999-99---999972587808995146544401000000010688-85187168711777
Q gi|254780669|r  166 GQFLSPWEMH-NI---LQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM-TSMGVPVIFDASHS  227 (301)
Q Consensus       166 gq~~s~~e~~-~a---~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l-k~~~~PVi~D~SHs  227 (301)
                      -...+++-|. +|   ++.+.+.|-.++.+--.-+     +..+-+.+--.+ ++..+|.=+-.|.+
T Consensus       138 y~~~~~~amveSAl~~~~~~e~~~f~~iviS~KsS-----~v~~~i~ayr~la~~~dyPLHLGvTEA  199 (345)
T pfam04551       138 YGGPTPEAMVESALEHVRILEELGFDDIVISLKAS-----DVLVMIEAYRLLAEKTDYPLHLGVTEA  199 (345)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECC-----CHHHHHHHHHHHHHHCCCCCEECCCCC
T ss_conf             08987899999999999999878998689999718-----688999999999975798834477477


No 75 
>PRK02747 consensus
Probab=88.41  E-value=2.3  Score=23.25  Aligned_cols=188  Identities=15%  Similarity=0.167  Sum_probs=115.3

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      -.+.|+...+.|++...  +.--  +.       ++.|  ...-+++++++.++..+|+..  =|.+.++++.+.+ .+|
T Consensus        32 P~~~ak~~~~~Gadelh--~vDl--~~-------a~~~--~~~~~~lI~~i~~~~~ipi~vGGGIrs~e~~~~ll~~Gad   98 (257)
T PRK02747         32 PVEAARAYDAAGADELC--FLDI--TA-------SHEN--RGTMLDVVARTAEQCFMPLTVGGGVRTVDDIRKLLLAGAD   98 (257)
T ss_pred             HHHHHHHHHHCCCCEEE--EEEC--CC-------CCCC--CHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCC
T ss_conf             99999999986999899--9947--67-------7567--5528999999998669988984882073887899876996


Q ss_pred             EEEECHHHCCCHHHHHHHHHCC-C-----EEEEEC----------------CCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             7882257628999999985059-7-----799836----------------77789999999999997258780899514
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQTG-R-----VINVKK----------------GQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t~-k-----pV~iKk----------------gq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      =+=|++-...|.+|+.++++.- .     -+-.|+                ++-.+-.+....++++...|...++++.=
T Consensus        99 kViigs~a~~np~l~~~~~~~fG~q~Iv~siD~k~~~~~~~~~~~~i~~~~~~~~t~~~~~~~~~~~~~~G~geil~tdI  178 (257)
T PRK02747         99 KVSINSAAVARPEFVAEAADKFGSQCIVVAIDAKRVSPAGENDRWEIFTHGGRKPTGIDAVEFAQKVVSLGAGEILLTSM  178 (257)
T ss_pred             EEEECHHHHHCCHHHHHHHHHCCCEEEEEEEEEEECCCCCCCCCEEEEECCCCEECCCHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             89834446548347777887559657999998775157677873899988984634303999999999709988999988


Q ss_pred             ---CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             ---654440100000001068885-1871687117774212234532126388999999999971898899983698334
Q gi|254780669|r  195 ---GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDN  270 (301)
Q Consensus       195 ---G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~  270 (301)
                         |+..||+     +..+..+.+ +..|||.               +||-..+- .+..+....+++|+.+-.      
T Consensus       179 ~rDG~~~G~d-----l~l~~~i~~~~~~pvIa---------------sGGv~~~~-di~~~~~~~~~~av~~g~------  231 (257)
T PRK02747        179 DRDGTKAGFD-----LPLTRAIADAVRVPVIA---------------SGGVGTLD-HLVEGVRDGHATAVLAAS------  231 (257)
T ss_pred             CCCCCCCCCC-----HHHHHHHHHCCCCCEEE---------------ECCCCCHH-HHHHHHHHCCCCEEEEHH------
T ss_conf             3557326788-----69999998607998999---------------77999999-999999838984998832------


Q ss_pred             CCCCCCCCCCHHHHHHHHH
Q ss_conf             7978201868899999999
Q gi|254780669|r  271 APSDGPNMINIKDLPKLLS  289 (301)
Q Consensus       271 AlsD~~q~l~l~~l~~ll~  289 (301)
                      ++-  .+.+++.+.++.|.
T Consensus       232 ~~~--~~~~~l~~ak~~L~  248 (257)
T PRK02747        232 IFH--FGTYTIGEAKAHMA  248 (257)
T ss_pred             HHH--CCCCCHHHHHHHHH
T ss_conf             677--69989999999999


No 76 
>PRK00830 consensus
Probab=88.30  E-value=2.4  Score=23.21  Aligned_cols=188  Identities=14%  Similarity=0.207  Sum_probs=113.7

Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCCE
Q ss_conf             999999999655339970660155768866632224567124888999886652876885--2288999987650-2157
Q gi|254780669|r   61 FMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVDI  137 (301)
Q Consensus        61 ~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vDi  137 (301)
                      .++|+...+.+++...=.=.-+           ++.|  ...-+++++++.++..+|+.-  =|.+.++++.+.+ .+|=
T Consensus        37 ~~~ak~~~~~gadelhivDld~-----------a~~g--~~~~~~~I~~i~~~~~~pi~vGGGIrs~e~~~~ll~~Gadk  103 (273)
T PRK00830         37 VELAKRYYEDGADELVFLDITA-----------SHEG--RATMIDVIERTAEEVFIPLTVGGGIRSIEDIRQILRAGADK  103 (273)
T ss_pred             HHHHHHHHHCCCCEEEEEEEEC-----------CCCC--CCCHHHHHHHHHHHCCCCEEEECCEEECCCHHHHHHCCCCE
T ss_conf             9999999987999899995324-----------6468--84279999999986699589608843773289999769863


Q ss_pred             EEECHHHCCCHHHHHHHHHCC---CE---EEEECCCC-----------------------------CCHHHHHHHHHHHH
Q ss_conf             882257628999999985059---77---99836777-----------------------------89999999999997
Q gi|254780669|r  138 LQIPALLCRQTDLLTAAAQTG---RV---INVKKGQF-----------------------------LSPWEMHNILQKLH  182 (301)
Q Consensus       138 lQIgA~~~rqtdLl~a~a~t~---kp---V~iKkgq~-----------------------------~s~~e~~~a~eki~  182 (301)
                      +=|++....|.+++.++++.-   ..   +-+||...                             .+-.+...-+.++.
T Consensus       104 VvIgS~a~~np~~v~~~~~~fGsq~IvvsiD~k~~~~~~~~~~~~~~~~~~g~~~w~~v~~~g~~~~t~~~~~~~~~~~~  183 (273)
T PRK00830        104 VSVNTAAVKNPEFIREASDIFGSQCIVVAIDCKRNYNPKDNPDKTIVELEDGTCAWYEVVIYGGREFTGIDAVQWAKKVE  183 (273)
T ss_pred             EECHHHHHHCCHHHHHHHHHCCCCEEEEEEEEECCCCCCCCCCCEEEECCCCCCCEEEEEEECCCCCCCCCHHHHHHHHH
T ss_conf             98379898590778999987699059999984337665456762145404787422899970780337867999999998


Q ss_pred             HCCCCCEEEEEC---CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             258780899514---654440100000001068885-1871687117774212234532126388999999999971898
Q gi|254780669|r  183 AHGAKDVLFCER---GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIA  258 (301)
Q Consensus       183 ~~Gn~~i~lcER---G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~d  258 (301)
                      ..|...++++.=   |+.-||+     +..+..+.+ ...|||.               +||-..+- .+..+-...+++
T Consensus       184 ~~G~geil~tdI~rDGt~~G~d-----~~l~~~i~~~~~iPvIa---------------sGGv~~~~-di~~~~~~~~~~  242 (273)
T PRK00830        184 ELGAGEILLTSMDRDGTKDGYD-----IPITKKISEEVDIPVIA---------------SGGVGNPE-HIYEGFSDGKAD  242 (273)
T ss_pred             HCCCCEEEEEEECCCCCCCCCC-----HHHHHHHHHCCCCCEEE---------------ECCCCCHH-HHHHHHHHCCCC
T ss_conf             6498868887875779656889-----69999998637998899---------------88999999-999999838986


Q ss_pred             EEEEEECCCHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             89998369833479782018688999999999
Q gi|254780669|r  259 GIFLETHQDPDNAPSDGPNMINIKDLPKLLSQ  290 (301)
Q Consensus       259 GlfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~~  290 (301)
                      |+.+-.      ++.  -+.+++.++++.|.+
T Consensus       243 ~v~~gs------~f~--~~~~si~e~k~~L~~  266 (273)
T PRK00830        243 AALAAS------IFH--FNEYSIREVKEYLRE  266 (273)
T ss_pred             EEEEEH------HHH--CCCCCHHHHHHHHHH
T ss_conf             887700------566--699799999999998


No 77 
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase. One member of this subgroup, the Sinorhizobium meliloti stachydrine utilization protein stcD, has been idenified as a putative N-methylproline demethylase.
Probab=88.29  E-value=2.4  Score=23.20  Aligned_cols=64  Identities=25%  Similarity=0.305  Sum_probs=42.2

Q ss_pred             HCCEEEECHH---HCCCH------------------------HHHHHHHH---CCCEEEEECCC------CCCHHHHHHH
Q ss_conf             2157882257---62899------------------------99999850---59779983677------7899999999
Q gi|254780669|r  134 SVDILQIPAL---LCRQT------------------------DLLTAAAQ---TGRVINVKKGQ------FLSPWEMHNI  177 (301)
Q Consensus       134 ~vDilQIgA~---~~rqt------------------------dLl~a~a~---t~kpV~iKkgq------~~s~~e~~~a  177 (301)
                      ..|.+||-+-   |..||                        ++++++-+   .+-||.+|=..      ..+++|.+..
T Consensus       154 GfDgVEIH~ahGYLl~qFlSp~~N~RtDeYGGs~eNR~Rf~~EIi~~Ir~~vg~~f~i~~Ris~~~~~~~g~~~~e~~~~  233 (343)
T cd04734         154 GLDGVELQAAHGHLIDQFLSPLTNRRTDEYGGSLENRMRFLLEVLAAVRAAVGPDFIVGIRISGDEDTEGGLSPDEALEI  233 (343)
T ss_pred             CCCEEEECCCCCCHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHH
T ss_conf             99889844577746998469855899676798889998999999999999819877615886762356898998999999


Q ss_pred             HHHHHHCCCCCEEEEECCCC
Q ss_conf             99997258780899514654
Q gi|254780669|r  178 LQKLHAHGAKDVLFCERGTS  197 (301)
Q Consensus       178 ~eki~~~Gn~~i~lcERG~~  197 (301)
                      ++.+...|.-+.+-+-.|+.
T Consensus       234 ~~~l~~~G~vD~l~vs~g~~  253 (343)
T cd04734         234 AARLAAEGLIDYVNVSAGSY  253 (343)
T ss_pred             HHHHHHCCCCCEEEECCCCC
T ss_conf             99999669976899656754


No 78 
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism]
Probab=88.28  E-value=2.4  Score=23.20  Aligned_cols=172  Identities=15%  Similarity=0.244  Sum_probs=101.2

Q ss_pred             CCEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHH---HHHCCCCEEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             7706835787727976997069995486349999999999999996---5533997066015576886663222456712
Q gi|254780669|r   25 NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAI---CQSLNIGLVYKSSFDKANRSSLAGKRGVGLK  101 (301)
Q Consensus        25 ~~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~---~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle  101 (301)
                      .+.+.+    |++.+|++.|..+=+ -+.-.+.| +..+..+++++   |.++-             |-+..     . .
T Consensus         6 tr~v~V----G~V~vGgdaPI~VQS-MTnT~T~D-v~aTv~QI~~L~~aG~dIV-------------Rvtv~-----~-~   60 (361)
T COG0821           6 TRQVKV----GNVPVGGDAPIVVQS-MTNTDTAD-VEATVAQIKALERAGCDIV-------------RVTVP-----D-M   60 (361)
T ss_pred             CEEEEE----CCEEECCCCCEEEEE-CCCCCCCC-HHHHHHHHHHHHHCCCCEE-------------EEECC-----C-H
T ss_conf             115888----777666999568886-15777301-7999999999998189789-------------99369-----9-7


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCHHHHH-HHHHH-CCEEEECHHHCCCH----HHHHHHHHCCCEEEEE-----------
Q ss_conf             4888999886652876885228899998-76502-15788225762899----9999985059779983-----------
Q gi|254780669|r  102 KGREIFRDLKKKYGFPILTDVHTEQQCE-AIADS-VDILQIPALLCRQT----DLLTAAAQTGRVINVK-----------  164 (301)
Q Consensus       102 ~gL~il~e~k~~~glpv~TeV~~~~~~e-~~~~~-vDilQIgA~~~rqt----dLl~a~a~t~kpV~iK-----------  164 (301)
                      +.-+-+.++|++..+|++.|+|--.++- .+.++ +|-+.|--=|.-..    ++++++.+.|+||-|-           
T Consensus        61 e~A~A~~~Ik~~~~vPLVaDiHf~~rla~~~~~~g~~k~RINPGNig~~~~v~~vVe~Ak~~g~piRIGVN~GSLek~~~  140 (361)
T COG0821          61 EAAEALKEIKQRLNVPLVADIHFDYRLALEAAECGVDKVRINPGNIGFKDRVREVVEAAKDKGIPIRIGVNAGSLEKRLL  140 (361)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH
T ss_conf             89999999998479987987305689999756427426987786567367799999999975998799526686169999


Q ss_pred             -CCCCCCHHHHH----HHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCH-HH-HHHCCCEEECHHHH
Q ss_conf             -67778999999----999999725878089951465444010000000106-88-85187168711777
Q gi|254780669|r  165 -KGQFLSPWEMH----NILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIP-IM-TSMGVPVIFDASHS  227 (301)
Q Consensus       165 -kgq~~s~~e~~----~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~-~l-k~~~~PVi~D~SHs  227 (301)
                       |=...+++-|.    .-++++...|-.++++--..+     + +.++-... .| ++..+|.=.-.|-+
T Consensus       141 ~ky~~pt~ealveSAl~~a~~~e~l~f~~i~iS~K~S-----d-v~~~v~aYr~lA~~~dyPLHLGvTEA  204 (361)
T COG0821         141 EKYGGPTPEALVESALEHAELLEELGFDDIKVSVKAS-----D-VQLMVAAYRLLAKRCDYPLHLGVTEA  204 (361)
T ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECC-----C-HHHHHHHHHHHHHHCCCCCCCCEECC
T ss_conf             9854798789999999999999977998679998738-----7-89999999999986687720141035


No 79 
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional
Probab=88.23  E-value=2.4  Score=23.18  Aligned_cols=189  Identities=17%  Similarity=0.262  Sum_probs=117.0

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      -.++|+...+.+++...=.=.-+           |..|-  ..-+++++++.+++.+|+.-  =|.+.++++.+.+ .+|
T Consensus        32 P~~~a~~~~~~gadel~ivDld~-----------s~~~~--~~~~~~I~~i~~~~~~pi~vGGGIrs~e~~~~ll~~Gad   98 (253)
T PRK02083         32 PVELAKRYDEEGADELVFLDITA-----------SSEGR--DTMKDVVERVAEQVFIPLTVGGGIRSVEDARRLLRAGAD   98 (253)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCC-----------CCCCC--HHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCC
T ss_conf             99999999987999899995626-----------64577--417999999998639877851762138987689877987


Q ss_pred             EEEECHHHCCCHHHHHHHHHC-CC-----EEEEECC-------------CCCCHHHHHHHHHHHHHCCCCCEEEEE---C
Q ss_conf             788225762899999998505-97-----7998367-------------778999999999999725878089951---4
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQT-GR-----VINVKKG-------------QFLSPWEMHNILQKLHAHGAKDVLFCE---R  194 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t-~k-----pV~iKkg-------------q~~s~~e~~~a~eki~~~Gn~~i~lcE---R  194 (301)
                      -+=|++....|.+++.++++. |.     -+.+|++             +-.+..+....++++...|...++++.   -
T Consensus        99 kVvigs~a~~~p~~i~~~~~~~G~q~Iv~siD~~~~~~~~~~~v~~~~~~~~~~~~~~~~i~~~~~~g~geil~tdI~rD  178 (253)
T PRK02083         99 KVSINSAAVADPELITELADRFGSQCIVVAIDAKRDGEPGRWEVFTHGGRKPTGIDAVEWAKEVQELGAGEILLTSMDQD  178 (253)
T ss_pred             EEEECCHHHHCCCHHHHHHHHCCCEEEEEEEEEEECCCCCEEEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             89999846538535578897469835999999887376871899980784125523999999987569878999988555


Q ss_pred             CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCC
Q ss_conf             654440100000001068885-1871687117774212234532126388999999999971898899983698334797
Q gi|254780669|r  195 GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS  273 (301)
Q Consensus       195 G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~Als  273 (301)
                      |+..||+     +.-+..+++ ...|||.               +||-..+- .+.++--..|++|..+=.      |+-
T Consensus       179 G~~~G~d-----~~l~~~i~~~~~iPiI~---------------sGGv~s~~-di~~~l~~~~i~gv~~G~------~~~  231 (253)
T PRK02083        179 GTKNGYD-----LELTRAVRDAVSVPVIA---------------SGGAGNLE-HFAEAFTEGGADAALAAS------VFH  231 (253)
T ss_pred             CCCCCCC-----HHHHHHHHHHCCCCEEE---------------ECCCCCHH-HHHHHHHHCCCEEEEEHH------HHH
T ss_conf             8667889-----99999999757999999---------------88999999-999999867980998712------777


Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             82018688999999999
Q gi|254780669|r  274 DGPNMINIKDLPKLLSQ  290 (301)
Q Consensus       274 D~~q~l~l~~l~~ll~~  290 (301)
                        -..+++.++++.|.+
T Consensus       232 --~~~~sl~~~k~~L~~  246 (253)
T PRK02083        232 --FGEITIGELKAYLAE  246 (253)
T ss_pred             --CCCCCHHHHHHHHHH
T ss_conf             --699999999999998


No 80 
>PRK13597 imidazole glycerol phosphate synthase subunit HisF; Provisional
Probab=88.05  E-value=2.5  Score=23.11  Aligned_cols=188  Identities=18%  Similarity=0.227  Sum_probs=117.2

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      -.++|+...+.+++...=.=    .|-       ++.  |-..-+++++++.++..+|+..  =|.+.++++...+ .+|
T Consensus        33 P~~~a~~~~~~Gad~lhlvD----ld~-------a~~--~~~~n~~~I~~i~~~~~vpiqvGGGIrs~e~~~~ll~~Gad   99 (252)
T PRK13597         33 PVEAARAYDEAGADELVFLD----ISA-------THE--ERAILLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGAD   99 (252)
T ss_pred             HHHHHHHHHHCCCCEEEEEE----CCC-------CCC--CCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCC
T ss_conf             99999999986999999995----646-------666--86637999999986269828984771308999999856987


Q ss_pred             EEEECHHHCCCHHHHHHHHHC---CCE--------------EEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC---CC
Q ss_conf             788225762899999998505---977--------------9983677789999999999997258780899514---65
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQT---GRV--------------INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER---GT  196 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t---~kp--------------V~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER---G~  196 (301)
                      =+=|++....|.+++.++++.   .+.              |.++.++-.+-.+..-.+.++...|...++++.=   |+
T Consensus       100 kViigS~a~~np~~i~~~~~~fG~q~Iv~~iD~~~~~~~~~v~~~~~~~~~~~~~~d~~~~~~~~G~geil~tdI~rDGt  179 (252)
T PRK13597        100 KVSVNSAAVRRPELIRELADHFGAQAVVLAIDARWRGDFPEVHVAGGRVPTGLHAVEWAVKGVELGAGEILLTSMDRDGT  179 (252)
T ss_pred             EEEECHHHHHCCHHHHHHHHHCCCCCEEEEEEEEECCCCCEEEECCCEEECCCCHHHHHHHHHHHCCCEEEEEEECCCCC
T ss_conf             79832666749378999998749965299998886189741675387275697699999999964899999975737684


Q ss_pred             CCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCC
Q ss_conf             4440100000001068885-187168711777421223453212638899999999997189889998369833479782
Q gi|254780669|r  197 SFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG  275 (301)
Q Consensus       197 ~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~  275 (301)
                      +-||+     +..+..+.+ ..+|||.               +||-..+ ..+. .+...|++|..+=      +|+-. 
T Consensus       180 ~~G~d-----~~l~~~i~~~~~~pvIa---------------sGGv~s~-~dl~-~l~~~g~~gvi~G------~al~~-  230 (252)
T PRK13597        180 KEGYD-----LRLTRMVAEAVGVPVIA---------------SGGAGRM-EHFL-EAFQAGAEAALAA------SVFHF-  230 (252)
T ss_pred             CCCCC-----HHHHHHHHHCCCCCEEE---------------ECCCCCH-HHHH-HHHHCCCCEEEEH------HHHHC-
T ss_conf             44769-----59999998507998999---------------7898999-9999-9987899699871------27677-


Q ss_pred             CCCCCHHHHHHHHHH
Q ss_conf             018688999999999
Q gi|254780669|r  276 PNMINIKDLPKLLSQ  290 (301)
Q Consensus       276 ~q~l~l~~l~~ll~~  290 (301)
                       ..+++.++++.|.+
T Consensus       231 -~~~s~~e~k~~L~~  244 (252)
T PRK13597        231 -GEIPIPELKRYLAE  244 (252)
T ss_pred             -CCCCHHHHHHHHHH
T ss_conf             -99999999999998


No 81 
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional
Probab=87.84  E-value=1.1  Score=25.37  Aligned_cols=46  Identities=17%  Similarity=0.275  Sum_probs=23.2

Q ss_pred             HHHHHHHHHHHHCCEEEEECCCHHHHHHHHH-HCCEEEECHHHCCCH
Q ss_conf             8889998866528768852288999987650-215788225762899
Q gi|254780669|r  103 GREIFRDLKKKYGFPILTDVHTEQQCEAIAD-SVDILQIPALLCRQT  148 (301)
Q Consensus       103 gL~il~e~k~~~glpv~TeV~~~~~~e~~~~-~vDilQIgA~~~rqt  148 (301)
                      -|+-|.+...++|+-++.|||+..+++.+.+ .++++-|-+||-+++
T Consensus       148 ~L~~l~~~a~~LGm~~LVEVH~~~El~rAl~~ga~iIGINnRnL~Tf  194 (695)
T PRK13802        148 QLKHLLDLAHELNMTVLVETHTREEIERARKAGAKVIGINARNLKNL  194 (695)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             99999999998699179997899999999847999899878988642


No 82 
>cd04732 HisA HisA.  Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase catalyzes the fourth step in histidine biosynthesis, an isomerisation of the aminoaldose moiety of ProFAR to the aminoketose of PRFAR (N-(5'-phospho-D-1'-ribulosylformimino)-5-amino-1-(5''-phospho-ribosyl)-4-imidazolecarboxamide). In bacteria and archaea, ProFAR isomerase is encoded by the HisA gene.
Probab=87.35  E-value=2.7  Score=22.84  Aligned_cols=170  Identities=21%  Similarity=0.359  Sum_probs=109.1

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      -.++|+.+.+.+.+.    ++=.=.|-       +..|-+  .-+++++++.+++.+|+..  =|.+.++++.+.+ .+|
T Consensus        31 P~~~a~~~~~~g~d~----l~i~DLda-------a~~~~~--~n~~~I~~I~~~~~~pi~vGGGIrs~~~~~~l~~~Ga~   97 (234)
T cd04732          31 PVEVAKKWEEAGAKW----LHVVDLDG-------AKGGEP--VNLELIEEIVKAVGIPVQVGGGIRSLEDIERLLDLGVS   97 (234)
T ss_pred             HHHHHHHHHHCCCCE----EEEEECCC-------HHHCCC--CHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHCCCC
T ss_conf             999999999869998----99996753-------030891--15999999997679568973771759999999864887


Q ss_pred             EEEECHHHCCCHHHHHHHHHC---CC---EEEEECCCCC-------CHHHHHHHHHHHHHCCCCCEEEEEC---CCCCCC
Q ss_conf             788225762899999998505---97---7998367778-------9999999999997258780899514---654440
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQT---GR---VINVKKGQFL-------SPWEMHNILQKLHAHGAKDVLFCER---GTSFGY  200 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t---~k---pV~iKkgq~~-------s~~e~~~a~eki~~~Gn~~i~lcER---G~~fgy  200 (301)
                      =+=|++...+|.+++.++++.   .+   -+-+|+++..       +..+....++++...|...++++.=   |+.-|+
T Consensus        98 kvvi~s~~~~~~~~~~~~~~~~G~q~iv~slD~k~~~~~~~~~~~~~~~~~~~~i~~~~~~g~geiilt~i~~dGt~~G~  177 (234)
T cd04732          98 RVIIGTAAVKNPELVKELLKEYGGERIVVGLDAKDGKVATKGWLETSEVSLEELAKRFEELGVKAIIYTDISRDGTLSGP  177 (234)
T ss_pred             EEEECCCHHHCHHHHHHHHHHCCCCCEEEEEEEECCCHHCCCCCEEECCCHHHHHHHHHHCCCCEEEEEEECCCCCCCCC
T ss_conf             18971401108278999999829764699999751200016864001351699999997458646998764256653568


Q ss_pred             HHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             100000001068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  201 NTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       201 ~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      +     +.-+..+.+ ...|+++               +||-+.+-. + +.....|++|..+=+
T Consensus       178 d-----~~ll~~i~~~~~~p~i~---------------~GGv~s~~d-i-~~l~~~g~~gvivgs  220 (234)
T cd04732         178 N-----FELYKELAAATGIPVIA---------------SGGVSSLDD-I-KALKELGVAGVIVGK  220 (234)
T ss_pred             C-----HHHHHHHHHHCCCCEEE---------------EECCCCHHH-H-HHHHHCCCCEEEEEH
T ss_conf             9-----99999998657998999---------------818999999-9-999977998999988


No 83 
>PRK10206 putative dehydrogenase; Provisional
Probab=87.16  E-value=2.8  Score=22.77  Aligned_cols=70  Identities=14%  Similarity=0.204  Sum_probs=52.2

Q ss_pred             HHHH-CCEEEEECCCHHHHHHHHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCC
Q ss_conf             6652-8768852288999987650-2157882257628999999985059779983677789999999999997258
Q gi|254780669|r  111 KKKY-GFPILTDVHTEQQCEAIAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHG  185 (301)
Q Consensus       111 k~~~-glpv~TeV~~~~~~e~~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~G  185 (301)
                      ..+| ++++.+++   +  |.+++ -+|++-|..=+.-.+++.+++.+.||.|++-|++.++..|..-.++-..+.|
T Consensus        45 a~~~~~~~~~~~~---~--~ll~~~~id~V~i~tP~~~H~~~a~~al~aGkhV~~EKP~~~~~~ea~~l~~~a~~~g  116 (345)
T PRK10206         45 APIYSHIHFTSDL---D--EVLNDPDVKLVVVCTHADSHFEYAKRALEAGKNVLVEKPFTPTLAQAKELFALAKSKG  116 (345)
T ss_pred             HHHCCCCCEECCH---H--HHHCCCCCCEEEECCCCHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHCC
T ss_conf             8776998122899---9--9954999999998799578999999999789928980366498999999999999709


No 84 
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate. This reaction is part of the pathway that allows the usage of sialic acid as a carbohydrate source. Sialic acids are a family of related sugars that are found as a component of glycoproteins, gangliosides, and other sialoglycoconjugates.
Probab=87.00  E-value=2.8  Score=22.71  Aligned_cols=163  Identities=18%  Similarity=0.204  Sum_probs=103.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEC---------C-
Q ss_conf             499999999999999965533997066015576886663222456712488899988665287688522---------8-
Q gi|254780669|r   54 IESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDV---------H-  123 (301)
Q Consensus        54 iES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV---------~-  123 (301)
                      +.+.+.+-.+|...+.-|+.                    +.|=    .|.+-++.+|+..++||+-=+         - 
T Consensus        23 l~~~~im~~mA~Aa~~gGA~--------------------giR~----~~~~dI~aIk~~v~lPIIGi~K~~~~~s~VyI   78 (219)
T cd04729          23 LHSPEIMAAMALAAVQGGAV--------------------GIRA----NGVEDIRAIRARVDLPIIGLIKRDYPDSEVYI   78 (219)
T ss_pred             CCCHHHHHHHHHHHHHCCCE--------------------EEEE----CCHHHHHHHHHCCCCCEEEEEECCCCCCCEEE
T ss_conf             68778999999999978963--------------------9980----89889999983289988999956889998456


Q ss_pred             --CHHHHHHHHH-HCCEEEECHHHCCC------HHHHHHHHHC-CCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             --8999987650-21578822576289------9999998505-977998367778999999999999725878089951
Q gi|254780669|r  124 --TEQQCEAIAD-SVDILQIPALLCRQ------TDLLTAAAQT-GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCE  193 (301)
Q Consensus       124 --~~~~~e~~~~-~vDilQIgA~~~rq------tdLl~a~a~t-~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcE  193 (301)
                        ..++++.+.+ .+||+-+-|-+-..      .+|+.++.+. +.+++--   -.+.+|.+.|.    ..|.+=|--|-
T Consensus        79 TPt~~ev~~l~~aGadiIA~DaT~R~RP~g~~l~~~i~~i~~~~~~l~MAD---~st~ee~~~A~----~~G~D~vgTTL  151 (219)
T cd04729          79 TPTIEEVDALAAAGADIIALDATDRPRPDGETLAELIKRIHEEYNCLLMAD---ISTLEEALNAA----KLGFDIIGTTL  151 (219)
T ss_pred             CCCHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHCCEEEEE---CCCHHHHHHHH----HCCCCEEECCC
T ss_conf             688999999998599999994678879899789999999999869778875---48899999999----84998997021


Q ss_pred             CCCCCCCHH-HCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             465444010-0000001068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  194 RGTSFGYNT-LVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       194 RG~~fgy~~-lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      .|.+-...+ --.||.-+..+.+ .+.|||..-                 |-.-|..++.|+.+|++.+-+-+
T Consensus       152 ~GYT~~t~~~~~PD~~lv~~l~~~~~~pvIaEG-----------------ri~tPe~a~~a~~~GA~aVVVGs  207 (219)
T cd04729         152 SGYTEETAKTEDPDFELLKELRKALGIPVIAEG-----------------RINSPEQAAKALELGADAVVVGS  207 (219)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEC-----------------CCCCHHHHHHHHHCCCCEEEECC
T ss_conf             456778788999878999999997599399706-----------------98999999999983998999895


No 85 
>PRK08195 4-hydroxy-2-ketovalerate aldolase; Validated
Probab=87.00  E-value=2.8  Score=22.71  Aligned_cols=183  Identities=18%  Similarity=0.200  Sum_probs=107.6

Q ss_pred             CCCHHHHHHHHHHHHHHHHHCC-CC---EEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH---CC--EEEEECCC
Q ss_conf             4999999999999999655339-97---0660155768866632224567124888999886652---87--68852288
Q gi|254780669|r   54 IESHDHAFMIAEKLYAICQSLN-IG---LVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY---GF--PILTDVHT  124 (301)
Q Consensus        54 iES~e~~~~~A~~lk~~~~~~~-~~---~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~---gl--pv~TeV~~  124 (301)
                      -=|.++..++++.|.+.|.... ++   +...+||+       ++|.-.   .-.++++.+++..   .+  -++..+..
T Consensus        21 ~fs~e~k~~ia~~Ld~aGVd~IEVghg~gl~~ss~~-------~g~~~~---~d~e~i~~~~~~~~~aki~~l~~pg~~~   90 (337)
T PRK08195         21 QYTLEQVRAIARALDAAGVPVIEVTHGDGLGGSSFN-------YGFGAH---TDEEYIEAAADVVKQAKLATLLLPGIGT   90 (337)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCC-------CCCCCC---CHHHHHHHHHHHHHCCEEEEEECCCCCC
T ss_conf             889999999999999809899994478887775334-------678779---8399999999974328378996356555


Q ss_pred             HHHHHHHHHH-CCEEEECHHHCCCHHH----HHHHHHCCCEE--EEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             9999876502-1578822576289999----99985059779--983677789999999999997258780899514654
Q gi|254780669|r  125 EQQCEAIADS-VDILQIPALLCRQTDL----LTAAAQTGRVI--NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTS  197 (301)
Q Consensus       125 ~~~~e~~~~~-vDilQIgA~~~rqtdL----l~a~a~t~kpV--~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~  197 (301)
                      .++++.+.+. +|++.|.. .|.+.|+    ++.+.+.|.-|  ++-.....+++++...++.+.+.|.+-|.+|.-   
T Consensus        91 ~~dl~~A~~~gv~~vria~-~~tead~~~~~i~~ar~~G~~v~~~lm~s~~~~~e~l~~~a~~~~~~Gad~I~l~DT---  166 (337)
T PRK08195         91 IEDLKMAYDAGVRVVRVAT-HCTEADVSEQHIGLARELGMDTVGFLMMSHMASPEKLAEQAKLMESYGAQCVYVVDS---  166 (337)
T ss_pred             HHHHHHHHHCCCCEEEEEE-ECCHHHHHHHHHHHHHHCCCEEEEEEHHCCCCCHHHHHHHHHHHHHCCCCEEEECCC---
T ss_conf             8889999957989799986-314887799999999977993999751102489999999999998659999997898---


Q ss_pred             CCCHHHCCCCC-CCHHHHH-H--CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             44010000000-1068885-1--871687117774212234532126388999999999971898899983698
Q gi|254780669|r  198 FGYNTLVTDMR-SIPIMTS-M--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD  267 (301)
Q Consensus       198 fgy~~lvvD~~-~i~~lk~-~--~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~  267 (301)
                      +|+-+ -.+.. -+..+|+ .  ..|+-|- .|             -+..+...-+.+|+.+|++-  +++--+
T Consensus       167 ~G~~~-P~~v~~~v~~l~~~l~~~i~igfH-~H-------------NnlGlAvANslaAveaGA~~--ID~Ti~  223 (337)
T PRK08195        167 AGALL-PDDVRARVRALRAALKPDTQVGFH-GH-------------HNLGLGVANSLAAVEAGADR--IDASLA  223 (337)
T ss_pred             CCCCC-HHHHHHHHHHHHHHCCCCCEEEEE-EC-------------CCCCHHHHHHHHHHHCCCCE--EEEECC
T ss_conf             76679-999999999999864998549998-53-------------88675999999999809999--985053


No 86 
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences, their cellular location and their natural electron acceptor used to reoxidize the flavin group. Members of class 1 are cytosolic enzymes and multimers, while class 2 enzymes are membrane associated, monomeric and use respiratory quinones as their physiological electron acceptors.
Probab=86.98  E-value=2.8  Score=22.71  Aligned_cols=99  Identities=16%  Similarity=0.146  Sum_probs=66.4

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCEEEEECCC-------------HHHHHHHHHHCCEEEE--------CHHHCCCHHHHH
Q ss_conf             2245671248889998866528768852288-------------9999876502157882--------257628999999
Q gi|254780669|r   94 GKRGVGLKKGREIFRDLKKKYGFPILTDVHT-------------EQQCEAIADSVDILQI--------PALLCRQTDLLT  152 (301)
Q Consensus        94 sfrG~Gle~gL~il~e~k~~~glpv~TeV~~-------------~~~~e~~~~~vDilQI--------gA~~~rqtdLl~  152 (301)
                      +|.-.|.+.-++-|+..+ ..+.|+.--|.-             ..-++.+++++|.+-|        |-|..|+.+.|.
T Consensus       108 GfnN~G~~~~~~~L~~~~-~~~~~lgvnIg~nk~t~~e~~~~Dy~~~~~~l~~~aDy~~iNiSsPNt~glr~lq~~~~l~  186 (327)
T cd04738         108 GFNNDGADAVAKRLKKRR-PRGGPLGVNIGKNKDTPLEDAVEDYVIGVRKLGPYADYLVVNVSSPNTPGLRDLQGKEALR  186 (327)
T ss_pred             CCCCHHHHHHHHHHHHCC-CCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHH
T ss_conf             587176999999998404-5687179998504788267689999999998535577899954688984510026889999


Q ss_pred             ----HHHH------CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             ----9850------5977998367778999999999999725878089951
Q gi|254780669|r  153 ----AAAQ------TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCE  193 (301)
Q Consensus       153 ----a~a~------t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcE  193 (301)
                          ++.+      ..+||.+|=..-++-+++..+++-+.+.|-+.|+++-
T Consensus       187 ~ll~~v~~~~~~~~~~~Pi~vKlsPD~~~~~i~~i~~~~~~~g~dGvi~tN  237 (327)
T cd04738         187 ELLTAVKEERNKLGKKVPLLVKIAPDLSDEELEDIADVALEHGVDGIIATN  237 (327)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             999999999985377886699817997667899999999973997899958


No 87 
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]
Probab=86.98  E-value=2.8  Score=22.71  Aligned_cols=81  Identities=22%  Similarity=0.223  Sum_probs=35.8

Q ss_pred             CHHHCCCHHHHHHH----HH-C-CCEEEEECCCCCCHHH--HHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHH
Q ss_conf             25762899999998----50-5-9779983677789999--999999997258780899514654440100000001068
Q gi|254780669|r  141 PALLCRQTDLLTAA----AQ-T-GRVINVKKGQFLSPWE--MHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI  212 (301)
Q Consensus       141 gA~~~rqtdLl~a~----a~-t-~kpV~iKkgq~~s~~e--~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~  212 (301)
                      ||.|+++.+|+.++    .+ . +.||-+|==.+-+..+  +.-.+..+...|...+.+-=|=-.-+|.-- .|...|..
T Consensus       113 Ga~Ll~~p~lv~~iv~a~~~av~~iPVTVKiRlG~d~~~~~~~~ia~~~~~~G~~~ltVHgRtr~~~y~~~-a~~~~I~~  191 (323)
T COG0042         113 GAALLKNPELLAEIVKAMVEAVGDIPVTVKIRLGWDDDDILALEIARILEDAGADALTVHGRTRAQGYLGP-ADWDYIKE  191 (323)
T ss_pred             CHHHCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHCCHHHHHHHHHHCCCCEEEEECCCHHHCCCCC-CCHHHHHH
T ss_conf             47771798999999999998538887499985787800200999999999679878999556676468986-48799999


Q ss_pred             HHH-HC-CCEEE
Q ss_conf             885-18-71687
Q gi|254780669|r  213 MTS-MG-VPVIF  222 (301)
Q Consensus       213 lk~-~~-~PVi~  222 (301)
                      +|+ .. +|||.
T Consensus       192 vk~~~~~ipvi~  203 (323)
T COG0042         192 LKEAVPSIPVIA  203 (323)
T ss_pred             HHHHCCCCEEEE
T ss_conf             998679975985


No 88 
>COG1456 CdhE CO dehydrogenase/acetyl-CoA synthase gamma subunit (corrinoid Fe-S protein) [Energy production and conversion]
Probab=86.84  E-value=2.9  Score=22.66  Aligned_cols=186  Identities=16%  Similarity=0.189  Sum_probs=114.9

Q ss_pred             CCCEEEECCCCCCEEECCCCCE------------EEEECCCCCCCHHH---HHHHHHHHHH-HHHHCCCCEEEECCCCCC
Q ss_conf             1770683578772797699706------------99954863499999---9999999999-655339970660155768
Q gi|254780669|r   24 TNAAIHLGSGKNQVTFSNEQRF------------VLIAGPCQIESHDH---AFMIAEKLYA-ICQSLNIGLVYKSSFDKA   87 (301)
Q Consensus        24 ~~~~~~ig~~~~~i~ig~~~~l------------~iIAGPCsiES~e~---~~~~A~~lk~-~~~~~~~~~ifK~sfdKa   87 (301)
                      .-+++-||.+.+.+.+||+.-+            ++.-=+--.++++.   +-+|++.-++ .|.++...++-=-     
T Consensus        65 ~vkevtiG~ge~~v~iGGdeVlyRheLtffNpt~~fvdv~D~m~e~el~~r~~~I~~f~~ervGe~L~LDgvair-----  139 (467)
T COG1456          65 EVKEVTIGVGEKAVVIGGDEVLYRHELTFFNPTPMFVDVADDMDEEELVERANEIANFRKERVGEKLKLDGVAIR-----  139 (467)
T ss_pred             CEEEEEECCCCCEEEECCCCEEEEEEEEEECCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCEEEEEEEEEE-----
T ss_conf             404788627752256556211576345430798448877665888999999999988878642444665269998-----


Q ss_pred             CCC-CCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCE---EEECHHHCCCHHHHHHHHHCCCEEEE
Q ss_conf             866-63222456712488899988665287688522889999876502157---88225762899999998505977998
Q gi|254780669|r   88 NRS-SLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDI---LQIPALLCRQTDLLTAAAQTGRVINV  163 (301)
Q Consensus        88 nRt-S~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDi---lQIgA~~~rqtdLl~a~a~t~kpV~i  163 (301)
                      ||| +|.-|+     ++.   +.+ .+.|+|++-=-.+++-++...++++=   |--+|.-----|+++-+.+.+.|+.+
T Consensus       140 ~~Sgdpekfa-----~av---e~v-~~~~~pv~l~s~dpevmkaaLev~~dqkPllYaAte~n~~e~~klav~y~vplvl  210 (467)
T COG1456         140 NRSGDPEKFA-----EAV---EKV-AEAGLPVILCSFDPEVMKAALEVVKDQKPLLYAATEDNWKEFAKLAVEYKVPLVL  210 (467)
T ss_pred             ECCCCHHHHH-----HHH---HHH-HHCCCCEEEEECCHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHCCCCEEE
T ss_conf             1689979999-----999---999-8658967999579999999998761268525433201399999988444875798


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHH------CCCCCCCHHHH---HHCCCEEECHHH
Q ss_conf             3677789999999999997258780899514654440100------00000106888---518716871177
Q gi|254780669|r  164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL------VTDMRSIPIMT---SMGVPVIFDASH  226 (301)
Q Consensus       164 Kkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~l------vvD~~~i~~lk---~~~~PVi~D~SH  226 (301)
                      --  |-..+++.+-+-+..+.|.+++.| +-||-+|-.++      ++-+|-..++.   .+++|+..=|-.
T Consensus       211 ~a--~~dl~~lk~la~~~~~~Gi~divL-dPgT~p~~egl~~T~d~~v~iRr~aIe~~d~~~~yPim~~p~~  279 (467)
T COG1456         211 SA--FNDLDDLKNLAVTYAQAGIKDIVL-DPGTYPGGEGLKDTFDNFVMIRRAAIEGFDKDFAYPIMALPFT  279 (467)
T ss_pred             EC--CCCHHHHHHHHHHHHHCCCCEEEE-CCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCHH
T ss_conf             55--677899999999999739752776-6886568653668888899999987615675335504405324


No 89 
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional
Probab=86.84  E-value=1.3  Score=25.01  Aligned_cols=170  Identities=16%  Similarity=0.132  Sum_probs=96.8

Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCCE
Q ss_conf             999999999655339970660155768866632224567124888999886652876885--2288999987650-2157
Q gi|254780669|r   61 FMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVDI  137 (301)
Q Consensus        61 ~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vDi  137 (301)
                      .++|+...+.|+...     --      =|-+..|+|     .++.|+.+++.+++||+-  =|-++.|+..... .+|.
T Consensus        64 ~~iA~~Y~~~GA~ai-----SV------LTe~~~F~G-----s~~~L~~v~~~v~lPiLrKDFIid~~QI~ea~~~GADa  127 (247)
T PRK13957         64 VQIAKTYETLGASAI-----SV------LTDQSYFGG-----SLEDLKSVSSELKIPVLRKDFILDEIQIREARAFGASA  127 (247)
T ss_pred             HHHHHHHHHCCCCEE-----EE------CCCCCCCCC-----CHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHCCCCE
T ss_conf             999999997799289-----98------278566799-----89999999985799847411206499999999739985


Q ss_pred             -EEECHHHCCC--HHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHH
Q ss_conf             -8822576289--9999998505977998367778999999999999725878089951465444010000000106888
Q gi|254780669|r  138 -LQIPALLCRQ--TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT  214 (301)
Q Consensus       138 -lQIgA~~~rq--tdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk  214 (301)
                       |=|-|.|...  .+|+..+..-|--+++.=+   +.+|+..|    ...|.+=|-+--|--    .++-+|+.....+.
T Consensus       128 ILLIaa~L~~~~l~~l~~~A~~lGle~LvEvH---~~~El~~a----l~~~~~iIGINNRnL----~tf~vd~~~~~~l~  196 (247)
T PRK13957        128 ILLIVRILTPSQIKSFLKHASSLGMDVLVEVH---TEDEAKLA----LDCGAEIIGINTRDL----DTFQIHQNLVEEVA  196 (247)
T ss_pred             EHHHHHCCCHHHHHHHHHHHHHHCCEEEEEEC---CHHHHHHH----HHCCCCEEEEECCCC----CCCCCCHHHHHHHH
T ss_conf             12688508999999999999983881562558---99999999----848998898745773----21463988999998


Q ss_pred             HHCCC-EEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE----CCCHHHCCC
Q ss_conf             51871-687117774212234532126388999999999971898899983----698334797
Q gi|254780669|r  215 SMGVP-VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET----HQDPDNAPS  273 (301)
Q Consensus       215 ~~~~P-Vi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~----Hp~P~~Als  273 (301)
                      .. +| -++=.|-|        | .. .++=+..+     ..++||+.|-+    .+||.+|+-
T Consensus       197 ~~-ip~~~~~VsES--------G-I~-~~~di~~l-----~~~~da~LIGeslMk~~d~~~a~~  244 (247)
T PRK13957        197 AF-LPPNIVKVGES--------G-IE-SRSDLDKF-----RKLVDAALIGTYFMEKKDIRKAWL  244 (247)
T ss_pred             HH-CCCCCEEEECC--------C-CC-CHHHHHHH-----HHHCCEEEECHHHHCCCCHHHHHH
T ss_conf             43-89998799678--------9-99-99999999-----973999998867756999999999


No 90 
>pfam00977 His_biosynth Histidine biosynthesis protein. Proteins involved in steps 4 and 6 of the histidine biosynthesis pathway are contained in this family. Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes. The enzymes in this Pfam entry are called His6 and His7 in eukaryotes and HisA and HisF in prokaryotes. The structure of HisA is known to be a TIM barrel fold. In some archaeal HisA proteins the TIM barrel is composed of two tandem repeats of a half barrel. This family belong to the common phosphate binding site TIM barrel family.
Probab=86.72  E-value=2.9  Score=22.62  Aligned_cols=168  Identities=18%  Similarity=0.272  Sum_probs=104.0

Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCCE
Q ss_conf             999999999655339970660155768866632224567124888999886652876885--2288999987650-2157
Q gi|254780669|r   61 FMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVDI  137 (301)
Q Consensus        61 ~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vDi  137 (301)
                      .++|+.+.+.+.+.    ++=.-.|.       +..|-+  .-+++++++.+++.+|+.-  =|...++++.+.+ .+|=
T Consensus        32 ~~~a~~~~~~g~d~----i~ivDLda-------~~~~~~--~n~~~i~~i~~~~~~pi~vgGGIrs~e~~~~~l~~Ga~k   98 (229)
T pfam00977        32 VELAKRYEEEGADE----LHFVDLDA-------AKEGRP--VNLDLIEEIAEEVFIPVQVGGGIRSLEDAERLLSAGADK   98 (229)
T ss_pred             HHHHHHHHHCCCCE----EEEEECCC-------CCCCCH--HHHHHHHHHHHHCCCCEEEECCEEEHHHHHHHHHCCCCE
T ss_conf             99999999879998----99996866-------302681--069999999986698789964561189999999769989


Q ss_pred             EEECHHHCCCHHHHHHHHHC---CCE---EEEEC--------CCCCCHHHHHHHHHHHHHCCCCCEEEEEC---CCCCCC
Q ss_conf             88225762899999998505---977---99836--------77789999999999997258780899514---654440
Q gi|254780669|r  138 LQIPALLCRQTDLLTAAAQT---GRV---INVKK--------GQFLSPWEMHNILQKLHAHGAKDVLFCER---GTSFGY  200 (301)
Q Consensus       138 lQIgA~~~rqtdLl~a~a~t---~kp---V~iKk--------gq~~s~~e~~~a~eki~~~Gn~~i~lcER---G~~fgy  200 (301)
                      +=|++....|.++++++.+.   .+.   +-+|+        ++-.+..+....++++.+.|...++++.=   |+.-|+
T Consensus        99 vvigs~~~~~~~~~~~~~~~~g~q~iv~siD~k~~~~v~~~~~~~~~~~~~~~~i~~~~~~g~~eii~tdi~~dGt~~G~  178 (229)
T pfam00977        99 VIIGTAAVKNPELIKEAAEKFGSQCIVVAIDAKRDGKVAINGWREETGIDAVEWAKKLEELGAGEILLTDIDRDGTLSGP  178 (229)
T ss_pred             EEECCCHHHCHHHHHHHHHHCCCCCEEEEEEECCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEEEEECCCCCCCCC
T ss_conf             99586043093789999998098647999987145179980643356744334456776516750688775042756668


Q ss_pred             HHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             100000001068885-187168711777421223453212638899999999997189889998
Q gi|254780669|r  201 NTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       201 ~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      +     +.-+..+.+ ...|+|.               +||-+.+-. +.+ ....|++|+.+=
T Consensus       179 d-----~~l~~~i~~~~~~pii~---------------~GGv~~~~d-i~~-l~~~g~~gvivg  220 (229)
T pfam00977       179 D-----LELTRELAEAVNIPVIA---------------SGGVGSLED-LKE-LFSEGVDGVIAG  220 (229)
T ss_pred             C-----HHHHHHHHHHCCCCEEE---------------ECCCCCHHH-HHH-HHHCCCCEEEEH
T ss_conf             9-----99999999768998999---------------858999999-999-998799899985


No 91 
>PRK01659 consensus
Probab=86.55  E-value=3  Score=22.56  Aligned_cols=145  Identities=18%  Similarity=0.270  Sum_probs=97.3

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      -.++|+...+.|++...=  .-  .|.       ++.|  -..-+++++++.+++.+|+..  =|.+.++++.+.+ .+|
T Consensus        32 P~~~ak~~~~~Gad~ihi--vD--ld~-------a~~g--~~~n~~~I~~i~~~~~ipi~vGGGIrs~e~~~~~l~~Gad   98 (252)
T PRK01659         32 PVEIAAAYNEAGADELVF--LD--ITA-------THEG--RKTMVDVVEKVAAKVFIPLTVGGGISSVKDMKRLLRAGAD   98 (252)
T ss_pred             HHHHHHHHHHCCCCEEEE--EE--CCC-------CCCC--CHHHHHHHHHHHHHCCCCEEEECCEECHHHHHHHHHCCCC
T ss_conf             999999999879999999--94--676-------6568--8648999999997569747996332006888898744885


Q ss_pred             EEEECHHHCCCHHHHHHHHHC-CC--E---EEEE-------------CCCCCCHHHHHHHHHHHHHCCCCCEEEEEC---
Q ss_conf             788225762899999998505-97--7---9983-------------677789999999999997258780899514---
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQT-GR--V---INVK-------------KGQFLSPWEMHNILQKLHAHGAKDVLFCER---  194 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t-~k--p---V~iK-------------kgq~~s~~e~~~a~eki~~~Gn~~i~lcER---  194 (301)
                      -+=|++....|.+++..+++. |.  .   +-+|             .++-.+..+....++.+...|...++++.=   
T Consensus        99 kViigs~a~~n~~~i~~~~~~~G~q~IvvsiD~k~~~~~~~~~i~~~g~~~~~~~~~~~~i~~~~~~g~geil~tdI~rD  178 (252)
T PRK01659         99 KVSINSAAVLRPELITEGADHFGSQCIVVAIDAKYDAEAGKWNVYTHGGRVDTGLDAIAWAKEAVRLGAGEILLTSMDAD  178 (252)
T ss_pred             EEEECHHHHHCHHHHHHHHHHCCCEEEEEEEEEEEECCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             59831777529153214676468632699999897056886899968995767777999999999769977999988145


Q ss_pred             CCCCCCHHHCCCCCCCHHHHH-HCCCEEE
Q ss_conf             654440100000001068885-1871687
Q gi|254780669|r  195 GTSFGYNTLVTDMRSIPIMTS-MGVPVIF  222 (301)
Q Consensus       195 G~~fgy~~lvvD~~~i~~lk~-~~~PVi~  222 (301)
                      |+..|++     +.-+..+.+ +..|||.
T Consensus       179 G~~~G~d-----l~l~~~i~~~~~~PiIa  202 (252)
T PRK01659        179 GTKNGFD-----LRLTKAISEAVSVPVIA  202 (252)
T ss_pred             CCCCCCC-----HHHHHHHHHHCCCCEEE
T ss_conf             8547689-----89999999868999999


No 92 
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage. Known members are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate hydrolase (PPH), carboxyPEP mutase (CPEP mutase), oxaloacetate hydrolase (OAH), isocitrate lyase (ICL), and 2-methylisocitrate lyase (MICL). Isocitrate lyase (ICL) catalyzes the conversion of isocitrate to succinate and glyoxylate, the first committed step in the glyoxylate pathway. This carbon-conserving pathway is present in most prokaryotes, lower eukaryotes and plants, but has not been observed in vertebrates. PEP mutase (PEPM) turns phosphoenolpyruvate (PEP) into phosphonopyruvate (P-pyr), an important intermediate in the formation of organophosphonates, which function as antibiotics or play a role in pathogenesis or signaling. P-pyr can be hydrolyzed by phosphonopyruvate hydrolase (PPH) to from pyruvate and phosphate. Oxaloacetate acetylhydrolase (OAH) catalyzes the hydrolytic cleavage of oxaloacetate to 
Probab=86.30  E-value=3.1  Score=22.47  Aligned_cols=28  Identities=36%  Similarity=0.546  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             8999999999971898899983698334
Q gi|254780669|r  243 QYIVPLAKAAVAIGIAGIFLETHQDPDN  270 (301)
Q Consensus       243 ~~v~~la~aa~a~G~dGlfiE~Hp~P~~  270 (301)
                      +-...=+++-..+|+|++|+|.-.+|++
T Consensus       160 ~eai~R~~aY~~AGAD~ifi~~~~~~~e  187 (243)
T cd00377         160 DEAIERAKAYAEAGADGIFVEGLKDPEE  187 (243)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCHHH
T ss_conf             9999999999982998999458999999


No 93 
>PRK13118 consensus
Probab=85.88  E-value=3.2  Score=22.34  Aligned_cols=218  Identities=19%  Similarity=0.248  Sum_probs=111.3

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCC-----CCCCCCC-CCCCCHHHHHHHHHHHHH-HCCE
Q ss_conf             999548634999999999999999655339-9706601557688-----6663222-456712488899988665-2876
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKAN-----RSSLAGK-RGVGLKKGREIFRDLKKK-YGFP  117 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKan-----RtS~~sf-rG~Gle~gL~il~e~k~~-~glp  117 (301)
                      .+.||   --+.|...++++.+.+.|+++. +|.-|--  +.|-     +++..+. .|..+++.+++++++|++ .++|
T Consensus        22 yitaG---~P~~e~t~~~~~~l~~~GaDiiElGiPfSD--P~ADGPvIq~A~~rAL~~G~~~~~~~~~v~~~r~~~~~~P   96 (269)
T PRK13118         22 FVTAG---DPSPEASVPLLHGLVAAGADVIELGMPFSD--PMADGPAIQLASERALAAGQGLADVLQMVREFRQGDQTTP   96 (269)
T ss_pred             EECCC---CCCHHHHHHHHHHHHHCCCCEEEECCCCCC--CCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             87171---899899999999999769999997898888--6665799999999999679868899999999864389999


Q ss_pred             EEE-----ECC---CHHHHHHHHHH-CCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             885-----228---89999876502-1578822576289-999999850597-799836777899999999999972587
Q gi|254780669|r  118 ILT-----DVH---TEQQCEAIADS-VDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       118 v~T-----eV~---~~~~~e~~~~~-vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn  186 (301)
                      ++-     .|.   ..+-++.+++. +|-+=||-.-... .++..++.+.|. +|     ++.+|.--..-.+++.+...
T Consensus        97 ivlM~Y~N~i~~~G~e~F~~~~~~~GvdGvIipDLP~ee~~~~~~~~~~~gl~~I-----~lvaPtt~~~Ri~~i~~~a~  171 (269)
T PRK13118         97 VVLMGYLNPIEIYGYERFVAQAKEAGVDGLILVDLPPEEADELRAPAQAHGLDFI-----RLTSPTTSDERLPRVLEHAS  171 (269)
T ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCHH-----EEECCCCCHHHHHHHHHCCC
T ss_conf             8997400078786399999999985997464589997899999999997598464-----03698987899999984378


Q ss_pred             CCE-EEEECCCCCCCHHHCC-CC-CCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             808-9951465444010000-00-01068885-18716871177742122345321263889999999999718988999
Q gi|254780669|r  187 KDV-LFCERGTSFGYNTLVT-DM-RSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       187 ~~i-~lcERG~~fgy~~lvv-D~-~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                      .=| .+.-.|+| |-.+... ++ ..+..+|+ +..||++---=|             .++-+     +.+...+||+.+
T Consensus       172 gFiY~vs~~GvT-G~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~~-----~~v~~~aDGvIV  232 (269)
T PRK13118        172 GYLYYVSLAGVT-GAAALDTEHVEEAVARLRRHTDLPVVVGFGIR-------------DAESA-----AAIARLADGVVV  232 (269)
T ss_pred             CCEEEEECCCCC-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-------------CHHHH-----HHHHCCCCEEEE
T ss_conf             838998545667-87766719899999999962589817871679-------------99999-----999800999998


Q ss_pred             EECCCHHHCCC-CCCCCCCHHHHHHHHHHHHHH
Q ss_conf             83698334797-820186889999999999999
Q gi|254780669|r  263 ETHQDPDNAPS-DGPNMINIKDLPKLLSQLLAI  294 (301)
Q Consensus       263 E~Hp~P~~Als-D~~q~l~l~~l~~ll~~l~~i  294 (301)
                      =+.---.-.-+ |..+  .++++.+++++++.-
T Consensus       233 GSa~Vk~i~~~~~~~~--~~~~~~~~~k~lk~a  263 (269)
T PRK13118        233 GSALVDAIAEAKDVDQ--AVERVLALLAELRQA  263 (269)
T ss_pred             CHHHHHHHHHCCCHHH--HHHHHHHHHHHHHHH
T ss_conf             5899999985678267--999999999999999


No 94 
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain.  TMADH is an iron-sulfur flavoprotein that catalyzes the oxidative demethylation of trimethylamine to form dimethylamine and formaldehyde. The protein forms a symetrical dimer with each subunit containing one 4Fe-4S cluster and one FMN cofactor.  It contains a unique flavin, in the form of a 6-S-cysteinyl FMN  which is bent by ~25 degrees along the N5-N10 axis of the flavin isoalloxazine ring. This modification of the conformation of the flavin is thought to facilitate catalysis.The closely related histamine dehydrogenase catalyzes oxidative deamination of histamine.
Probab=85.71  E-value=3.3  Score=22.28  Aligned_cols=45  Identities=13%  Similarity=0.094  Sum_probs=22.3

Q ss_pred             HHHHHHHH---CCCEEEEECC--------CCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             99999850---5977998367--------77899999999999972587808995146
Q gi|254780669|r  149 DLLTAAAQ---TGRVINVKKG--------QFLSPWEMHNILQKLHAHGAKDVLFCERG  195 (301)
Q Consensus       149 dLl~a~a~---t~kpV~iKkg--------q~~s~~e~~~a~eki~~~Gn~~i~lcERG  195 (301)
                      +.++++.+   .+-||.+|=.        ...+.+|....++.+...  .+++-.--|
T Consensus       205 Eii~aVr~~vg~df~i~~R~s~~~~~~~~g~~~~~~~~~~~~~~~~~--~d~~~vs~g  260 (370)
T cd02929         205 ETLEDTKDAVGDDCAVATRFSVDELIGPGGIESEGEGVEFVEMLDEL--PDLWDVNVG  260 (370)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCC--CCEEEEEEC
T ss_conf             99999999719987599998941256889998889999999997365--797998855


No 95 
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family; InterPro: IPR004652   This family represents one branch of COG0042 from COG (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family) and includes NifR3 itself, from Rhodobacter capsulatus. Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes , and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. ; GO: 0016491 oxidoreductase activity, 0050660 FAD binding, 0008033 tRNA processing.
Probab=85.55  E-value=3.1  Score=22.40  Aligned_cols=138  Identities=20%  Similarity=0.338  Sum_probs=88.4

Q ss_pred             EEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEC--CCCCCC-----------------
Q ss_conf             6835787727976997069995486349999999999999996553399706601--557688-----------------
Q gi|254780669|r   28 IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS--SFDKAN-----------------   88 (301)
Q Consensus        28 ~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~--sfdKan-----------------   88 (301)
                      +|.|.+.+.|+-.       -||=--+-.++.+.+|-+.+.+.-.--.++---|=  .||.++                 
T Consensus       103 iN~GCP~~Kitk~-------~aGsaLl~~p~~~~~iv~~vV~AV~~~~iPVTVK~R~GWD~~h~n~~~~a~~a~~~Ga~A  175 (336)
T TIGR00737       103 INMGCPVPKITKK-------GAGSALLRDPDLIGKIVKAVVDAVDAQDIPVTVKIRIGWDDAHINAVEAARIAEDAGAQA  175 (336)
T ss_pred             ECCCCCCCCCCCC-------CCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCE
T ss_conf             3676548842167-------635432358689999999999875187665166551563624488899999998724000


Q ss_pred             -----CCCCCCCCCCCCHHHHHHHHHHHHHHC----CEEEE--ECCCHHHHHHHHHH--CCEEEECHHHCCCHHHHHHHH
Q ss_conf             -----666322245671248889998866528----76885--22889999876502--157882257628999999985
Q gi|254780669|r   89 -----RSSLAGKRGVGLKKGREIFRDLKKKYG----FPILT--DVHTEQQCEAIADS--VDILQIPALLCRQTDLLTAAA  155 (301)
Q Consensus        89 -----RtS~~sfrG~Gle~gL~il~e~k~~~g----lpv~T--eV~~~~~~e~~~~~--vDilQIgA~~~rqtdLl~a~a  155 (301)
                           ||.-..|.|.   --.++.+++|+...    +||+-  ||++++.+..+.+.  +|                   
T Consensus       176 v~lHGRTRaQ~Y~G~---A~wd~I~~vKq~v~~~GeiPVigNGDi~~~~~A~~~L~~TG~D-------------------  233 (336)
T TIGR00737       176 VTLHGRTRAQGYEGE---ANWDIIARVKQAVRKEGEIPVIGNGDIFSPEDAKAMLETTGAD-------------------  233 (336)
T ss_pred             EEHHHHHHCCCCCCC---CCHHHHHHHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHCCCC-------------------
T ss_conf             211100000157887---6068999999997168753322277424678999998637886-------------------


Q ss_pred             HCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC-CEEEEECCCCC
Q ss_conf             05977998367778999999999999725878-08995146544
Q gi|254780669|r  156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAK-DVLFCERGTSF  198 (301)
Q Consensus       156 ~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~-~i~lcERG~~f  198 (301)
                          -|++=||-.-.||-...+..|+...-.+ .+-+-||=..+
T Consensus       234 ----Gvm~gRG~lG~PWl~~~i~~yL~tG~~~~~p~~~ek~~~~  273 (336)
T TIGR00737       234 ----GVMIGRGALGNPWLFKQIEQYLTTGKYKPPPTLAEKLDAI  273 (336)
T ss_pred             ----EEEEECHHCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHH
T ss_conf             ----8985002227875899999997268778898889999999


No 96 
>PRK08782 consensus
Probab=85.21  E-value=3.5  Score=22.13  Aligned_cols=110  Identities=19%  Similarity=0.172  Sum_probs=82.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEEEE-ECCCHHHHHH
Q ss_conf             34999999999999999655339970660155768866632224567124888999886652-876885-2288999987
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPILT-DVHTEQQCEA  130 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv~T-eV~~~~~~e~  130 (301)
                      .+++.+++..+++.+.+-|.+.         +.       -.+|.+   .+++.+++++++| ++.+-. -|.+.+|++.
T Consensus        24 r~~~~~~a~~~~eal~~gGi~~---------iE-------iTlrt~---~a~~~i~~l~~~~p~~~vGaGTV~~~e~~~~   84 (219)
T PRK08782         24 TVDTLDQARRVADALLEGGLPA---------IE-------LTLRTP---VAIEALAMLKRELPNIVIGAGTVLSERQLRQ   84 (219)
T ss_pred             ECCCHHHHHHHHHHHHHCCCCE---------EE-------EECCCC---HHHHHHHHHHHHCCCCEEEEEEECCHHHHHH
T ss_conf             7599999999999999879987---------99-------967993---3999999999868994799997058999999


Q ss_pred             HHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             650-2157882257628999999985059779983677789999999999997258780899
Q gi|254780669|r  131 IAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLF  191 (301)
Q Consensus       131 ~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~l  191 (301)
                      +.+ .++.+=-|.   -+.+++..+.+.+.|+.   +=-+||.|+..|.+    .|.+-+-+
T Consensus        85 a~~aGA~FiVSP~---~~~~v~~~a~~~~i~~i---PGv~TpSEi~~A~~----~G~~~vKl  136 (219)
T PRK08782         85 SVDAGADFLVTPG---TPAPLARLLADAPIPAV---PGAATPTELLTLMG----LGFRVCKL  136 (219)
T ss_pred             HHHCCCCEEECCC---CCHHHHHHHHHCCCCEE---CCCCCHHHHHHHHH----CCCCEEEE
T ss_conf             9984998998789---97999999998199764---78599999999998----79998997


No 97 
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF). The ProFAR isomerase catalyzes the fourth step in histidine biosynthesis, an isomerisation of the aminoaldose moiety of ProFAR to the aminoketose of PRFAR (N-(5'-phospho-D-1'-ribulosylformimino)-5-amino-1-(5''-phospho-ribosyl)-4-imidazolecarboxamide). In bacteria and archaea, ProFAR isomerase is encoded by the HisA gene. The Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)-formimino-5-aminoimidazole-4-carboxamide ribonucleotide (PRFAR) to imidazole glycerol phosphate (ImGP) and 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR). This conversion involves two tightly coupled reactions in distinct active sites of IGPS. The two catalytic domains can be fused, like in fungi and pl
Probab=85.11  E-value=3.5  Score=22.10  Aligned_cols=173  Identities=17%  Similarity=0.294  Sum_probs=108.2

Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHH
Q ss_conf             548634999999999999999655339970660155768866632224567124888999886652876885--228899
Q gi|254780669|r   49 AGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQ  126 (301)
Q Consensus        49 AGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~  126 (301)
                      .+-|...++   .+.|+...+.+.+..    +=.=.|        +.+|.+  .-+++++++.+++.+|+.-  -|...+
T Consensus        29 ~~~~~~~dP---~~~a~~~~~~ga~~l----hivDLd--------a~~g~~--~n~~~I~~i~~~~~~pi~vGGGIrs~~   91 (233)
T cd04723          29 SNLCSTSDP---LDVARAYKELGFRGL----YIADLD--------AIMGRG--DNDEAIRELAAAWPLGLWVDGGIRSLE   91 (233)
T ss_pred             CCCCCCCCH---HHHHHHHHHCCCCEE----EEEECC--------CCCCCC--CHHHHHHHHHHHCCCCEEEECCCCCHH
T ss_conf             373058799---999999998798989----999786--------546997--539999999987899889970227699


Q ss_pred             HHHHHHH-HCCEEEECHHHCCCHHHHHHHHHCCC-----EEEEECCCC------CCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             9987650-21578822576289999999850597-----799836777------89999999999997258780899514
Q gi|254780669|r  127 QCEAIAD-SVDILQIPALLCRQTDLLTAAAQTGR-----VINVKKGQF------LSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       127 ~~e~~~~-~vDilQIgA~~~rqtdLl~a~a~t~k-----pV~iKkgq~------~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      +++.+.+ .+|-+=|++...++..+++.+.+-+.     -+-+|+++.      .++.+|+..++..    ...++++.=
T Consensus        92 ~~~~~l~~Gadkvvigs~~~~~~~~~~~~~~~g~~~ivvslD~k~~~~~~~~~~~~~~~~~~~~~~~----~~eii~t~I  167 (233)
T cd04723          92 NAQEWLKRGASRVIVGTETLPSDDDEDRLAALGEQRLVLSLDFRGGQLLKPTDFIGPEELLRRLAKW----PEELIVLDI  167 (233)
T ss_pred             HHHHHHHCCCCEEECCCHHCCCHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHH----CCEEEEEEE
T ss_conf             9999986072015245100499899999999789998999999899787246434899999999965----895999864


Q ss_pred             ---CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             ---654440100000001068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  195 ---GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       195 ---G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                         |+.-|++     +.-+..+.+ ...|+|.               +||-+.+-. + ++....|++|+.+=.
T Consensus       168 d~dGt~~G~d-----~~l~~~i~~~~~~pvi~---------------sGGv~s~~d-i-~~l~~~g~~gvivg~  219 (233)
T cd04723         168 DRVGSGQGPD-----LELLERLAARADIPVIA---------------AGGVRSVED-L-ELLKKLGASGALVAS  219 (233)
T ss_pred             CCCCCCCCCC-----HHHHHHHHHHCCCCEEE---------------ECCCCCHHH-H-HHHHHCCCCEEEEEH
T ss_conf             3446567779-----99999999868998999---------------889999999-9-999978998999863


No 98 
>PRK07709 fructose-bisphosphate aldolase; Provisional
Probab=84.86  E-value=3.6  Score=22.03  Aligned_cols=77  Identities=25%  Similarity=0.399  Sum_probs=38.2

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC-CHHH-CCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHH
Q ss_conf             78999999999999725878089951465444-0100-000001068885-18716871177742122345321263889
Q gi|254780669|r  168 FLSPWEMHNILQKLHAHGAKDVLFCERGTSFG-YNTL-VTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQY  244 (301)
Q Consensus       168 ~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg-y~~l-vvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~  244 (301)
                      +.+|++   |.+.+..+|. +.+..-=|+..| |..- -.||--+..+++ .+.|.++   |     |+    | |   .
T Consensus       155 ~T~pe~---a~~Fv~~Tgv-D~LAvaiGn~HG~yk~~p~l~~~~l~~i~~~~~vPLVL---H-----Gg----S-G---~  214 (285)
T PRK07709        155 YADPAE---CKHLVEATGI-DCLAPALGSVHGPYKGEPNLGFAEMEQVRDFTGVPLVL---H-----GG----T-G---I  214 (285)
T ss_pred             CCCHHH---HHHHHHHHCC-CEEEHHHCCCCCCCCCCCCCCHHHHHHHHHCCCCCEEE---E-----CC----C-C---C
T ss_conf             579999---9999973187-88842205555776898876699999998405998796---4-----99----9-9---9


Q ss_pred             HHHHHHHHHHHCCCEEEEEE
Q ss_conf             99999999971898899983
Q gi|254780669|r  245 IVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       245 v~~la~aa~a~G~dGlfiE~  264 (301)
                      -...-+.|+..|+.=+=+-|
T Consensus       215 ~~e~i~~ai~~Gv~KiNi~T  234 (285)
T PRK07709        215 PTADIEKAISLGTSKINVNT  234 (285)
T ss_pred             CHHHHHHHHHCCCEEEEECH
T ss_conf             99999999985985999882


No 99 
>PRK13122 consensus
Probab=84.69  E-value=3.6  Score=21.98  Aligned_cols=206  Identities=16%  Similarity=0.166  Sum_probs=103.5

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-9706601------557688666322245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv  118 (301)
                      ++.++|..       .++++.|.+.|+++. +|.=|.-      ..-+|+.-+.  -.|..+++.++++++++++++.|+
T Consensus         8 yi~g~pd~-------~~~~~~l~~~GaDiiElGiPfSDP~ADGpvIQ~A~~rAL--~~G~~~~~~~~~l~~~r~~~~~pi   78 (242)
T PRK13122          8 YIMGNKDL-------IENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAI--KQGITIDYIFNQLEKHGDQIKCNY   78 (242)
T ss_pred             EECCCCCH-------HHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHCCCCCCCE
T ss_conf             62689999-------999999997599999978988886665899999999999--769989999999997313679877


Q ss_pred             EEECCCH----------HHHHHHHHH-CCEEEECHHHCCCH-HHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCC
Q ss_conf             8522889----------999876502-15788225762899-99999850597-79983677789999999999997258
Q gi|254780669|r  119 LTDVHTE----------QQCEAIADS-VDILQIPALLCRQT-DLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHG  185 (301)
Q Consensus       119 ~TeV~~~----------~~~e~~~~~-vDilQIgA~~~rqt-dLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~G  185 (301)
                      +  +|..          .-++.+++. +|-+=||-.-.... ++..++.+.+. +|.+=-+ ..+.+.+..    +.+..
T Consensus        79 v--lM~Y~N~i~~~G~~~F~~~~~~~GvdGvIipDLP~ee~~~~~~~~~~~gi~~I~lvaP-tt~~~Ri~~----i~~~s  151 (242)
T PRK13122         79 V--LMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPYELSQRLKQQFSHYGVKIISLVAM-TTDDKRIKD----IVSHA  151 (242)
T ss_pred             E--EEEECHHHHHHCHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEEECC-CCCHHHHHH----HHHHC
T ss_conf             9--9985169887279999999987699867778998788999999998679868987189-998999999----99829


Q ss_pred             CCCEE-EEECCCCCCCHH-HCCCC-CCCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEE
Q ss_conf             78089-951465444010-00000-010688851-871687117774212234532126388999999999971898899
Q gi|254780669|r  186 AKDVL-FCERGTSFGYNT-LVTDM-RSIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF  261 (301)
Q Consensus       186 n~~i~-lcERG~~fgy~~-lvvD~-~~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlf  261 (301)
                      ..=|. +.-.|+| |-.. +..+. ..+..+|+. ..||++---=|             .++-+..     +.-.+||+.
T Consensus       152 ~GFiY~vs~~GvT-G~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGI~-------------~~e~v~~-----i~~~ADGvI  212 (242)
T PRK13122        152 EGFIYTVTMNATT-GQNGAFHPELKRKIESIKAIANVPVVAGFGIR-------------TPQHVAD-----IKEVADGIV  212 (242)
T ss_pred             CCCEEEEECCCCC-CCCCCCCHHHHHHHHHHHHHCCCCEEEECCCC-------------CHHHHHH-----HHHHCCEEE
T ss_conf             9966987335435-76555658899999999972599858715879-------------9999999-----981199999


Q ss_pred             EEECCCHHHCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             9836983347978201868899999999999
Q gi|254780669|r  262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLL  292 (301)
Q Consensus       262 iE~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~  292 (301)
                      +=++      +..--..=..+++.+++++++
T Consensus       213 VGSa------ivk~i~~~~~e~~~~~i~~l~  237 (242)
T PRK13122        213 IGSE------IVKRFKSNTREEIIKYLQSIQ  237 (242)
T ss_pred             ECHH------HHHHHHHCCHHHHHHHHHHHH
T ss_conf             8489------999999679899999999999


No 100
>PRK04281 consensus
Probab=84.53  E-value=3.7  Score=21.93  Aligned_cols=142  Identities=17%  Similarity=0.197  Sum_probs=95.8

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      -.++|+...+.|++...  +.--  |   .    ++.  |...-+++++++.++..+|+.-  =|.+.++++.+.+ .+|
T Consensus        32 P~~~ak~~~~~Gadelh--ivDl--d---~----a~~--~~~~~~~~I~~i~~~~~vpi~vGGGIrs~e~~~~ll~~Gad   98 (254)
T PRK04281         32 PVEAAKRYNGEGADELT--FLDI--T---A----SSD--NRDTILHIIEEVAGQVFIPLTVGGGVRTVADIRRLLNAGAD   98 (254)
T ss_pred             HHHHHHHHHHCCCCEEE--EEEC--C---C----CCC--CCHHHHHHHHHHHHHCCCCEEEECCEEECHHHHHHHHCCCC
T ss_conf             99999999986999999--9968--8---9----877--75308999999985079628997775451889999976998


Q ss_pred             EEEECHHHCCCHHHHHHHHHCC---C---EEEEECC-----------------CCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             7882257628999999985059---7---7998367-----------------778999999999999725878089951
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQTG---R---VINVKKG-----------------QFLSPWEMHNILQKLHAHGAKDVLFCE  193 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t~---k---pV~iKkg-----------------q~~s~~e~~~a~eki~~~Gn~~i~lcE  193 (301)
                      =+=|++....|.+++.++++.-   +   -+-+|+.                 ...++.||   ++++...|...+++|.
T Consensus        99 kViigs~a~~np~~l~~~~~~fG~q~Iv~siD~k~~~~~~~~~~i~~~g~~~~t~~~~~~~---~~~~~~~g~geil~td  175 (254)
T PRK04281         99 KVSINTAAVTRPDLIDEAAGFFGSQAIVAAVDAKAVNPENTRWEIFTHGGRNPTGLDAVEW---AVEMQKRGAGEILLTG  175 (254)
T ss_pred             EEEECHHHHHCCHHHHHHHHHCCCEEEEEEEEEEEECCCCCCEEEEECCCCCCCCCCHHHH---HHHHHHCCCCEEEEEE
T ss_conf             8997776764926767678755982179999888502468845999758864775449999---9998752998999988


Q ss_pred             C---CCCCCCHHHCCCCCCCHHHHH-HCCCEEE
Q ss_conf             4---654440100000001068885-1871687
Q gi|254780669|r  194 R---GTSFGYNTLVTDMRSIPIMTS-MGVPVIF  222 (301)
Q Consensus       194 R---G~~fgy~~lvvD~~~i~~lk~-~~~PVi~  222 (301)
                      =   |+.-||+     +.-+..+.+ ...|||.
T Consensus       176 I~rDGt~~G~d-----~~l~~~i~~~~~iPvIa  203 (254)
T PRK04281        176 MDRDGTKQGFN-----LPLTRAVAEAVDIPVIA  203 (254)
T ss_pred             ECCCCCCCCCC-----HHHHHHHHHHCCCCEEE
T ss_conf             85788768768-----69999998616998999


No 101
>cd05805 MPG1_transferase GTP-mannose-1-phosphate guanyltransferase (MPG1 transferase), also known as GDP-mannose pyrophosphorylase, is a bifunctional enzyme with both phosphomannose isomerase (PMI) activity and GDP-mannose phosphorylase (GMP) activity.  The protein contains an N-terminal NTP transferase domain, an L-beta-H domain, and a C-terminal PGM-like domain that belongs to the alpha-D-phosphohexomutase superfamily.  This subfamily is limited to bacteria and archaea. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Members of this group appear to lack conserved residues necessary for metal binding and catalytic activity. Other members of this superfamily include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional 
Probab=84.31  E-value=3.2  Score=22.33  Aligned_cols=11  Identities=0%  Similarity=0.030  Sum_probs=4.2

Q ss_pred             CCHHHHHHHHH
Q ss_conf             63889999999
Q gi|254780669|r  240 GERQYIVPLAK  250 (301)
Q Consensus       240 G~r~~v~~la~  250 (301)
                      |.+.....|.+
T Consensus       301 G~~~i~~~m~~  311 (441)
T cd05805         301 SPQALMEAALE  311 (441)
T ss_pred             CHHHHHHHHHH
T ss_conf             38999999974


No 102
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism]
Probab=84.16  E-value=1.1  Score=25.30  Aligned_cols=170  Identities=22%  Similarity=0.268  Sum_probs=80.1

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHH
Q ss_conf             99548634999999999999999655339970660155768866632224567124888999886652876885228899
Q gi|254780669|r   47 LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQ  126 (301)
Q Consensus        47 iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~  126 (301)
                      +|-|---.-|.+.   +++.+...+.++.-- +.+       |.+.  .+..| +.-|+.+... .-.=+|=..--+..+
T Consensus        19 LllGTgky~s~~~---~~~av~asg~~ivTv-AlR-------R~~~--~~~~~-~~~l~~l~~~-~~~~LPNTaGc~tae   83 (262)
T COG2022          19 LLLGTGKYPSPAV---LAEAVRASGSEIVTV-ALR-------RVNA--TRPGG-DGILDLLIPL-GVTLLPNTAGCRTAE   83 (262)
T ss_pred             EEEECCCCCCHHH---HHHHHHHCCCCEEEE-EEE-------EECC--CCCCC-CHHHHHHHHC-CCEECCCCCCCCCHH
T ss_conf             8872478999899---999999727866999-988-------6215--78885-3088774113-867678764558899


Q ss_pred             HHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCC--EEEE--ECCCCCCHHHHHHHHHHHHHCC-------CCCEEEEEC-
Q ss_conf             998765021578822576289999999850597--7998--3677789999999999997258-------780899514-
Q gi|254780669|r  127 QCEAIADSVDILQIPALLCRQTDLLTAAAQTGR--VINV--KKGQFLSPWEMHNILQKLHAHG-------AKDVLFCER-  194 (301)
Q Consensus       127 ~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~k--pV~i--Kkgq~~s~~e~~~a~eki~~~G-------n~~i~lcER-  194 (301)
                      ++-..+                -|.+++..++-  .=.|  .|-.+..+.+.+.|+|.+...|       +.+.++|+| 
T Consensus        84 EAv~tA----------------rlARE~~~t~wiKlEVi~d~~tLlPD~~etl~Aae~Lv~eGF~VlPY~~dD~v~arrL  147 (262)
T COG2022          84 EAVRTA----------------RLAREALGTNWIKLEVIGDEKTLLPDPIETLKAAEQLVKEGFVVLPYTTDDPVLARRL  147 (262)
T ss_pred             HHHHHH----------------HHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHH
T ss_conf             999999----------------9999970698489999368765488757899999999867988850368878999999


Q ss_pred             ---C--------CCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             ---6--------54440100000001068885-18716871177742122345321263889999999999718988999
Q gi|254780669|r  195 ---G--------TSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       195 ---G--------~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                         |        .--|.+.=+...-++.++.+ ...|||+|+--             |.    |+-|-.|+-+|+|++++
T Consensus       148 ee~GcaavMPl~aPIGSg~G~~n~~~l~iiie~a~VPviVDAGi-------------G~----pSdAa~aMElG~DaVL~  210 (262)
T COG2022         148 EEAGCAAVMPLGAPIGSGLGLQNPYNLEIIIEEADVPVIVDAGI-------------GT----PSDAAQAMELGADAVLL  210 (262)
T ss_pred             HHCCCEEECCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCC-------------CC----HHHHHHHHHHCCCEEEH
T ss_conf             86496686335665667867578899999997389988986798-------------97----66889998605543232


Q ss_pred             EE
Q ss_conf             83
Q gi|254780669|r  263 ET  264 (301)
Q Consensus       263 E~  264 (301)
                      -|
T Consensus       211 NT  212 (262)
T COG2022         211 NT  212 (262)
T ss_pred             HH
T ss_conf             56


No 103
>PRK13115 consensus
Probab=84.01  E-value=3.9  Score=21.79  Aligned_cols=211  Identities=18%  Similarity=0.151  Sum_probs=104.6

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEE------CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-970660------1557688666322245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYK------SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK------~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv  118 (301)
                      .+.||=   -+.|...++++.+.+.|.++. +|.-|-      |..-+|+.-+..  .|..+++.++++++++ +.+.|+
T Consensus        29 yitaG~---P~~e~t~~~i~~l~~~GaDiiElGiPFSDP~ADGPvIQ~A~~rAL~--~G~~~~~~f~~v~~~~-~~~~Pi  102 (269)
T PRK13115         29 YLPAGF---PDVDTSIAAMTALVESGCDIVEVGLPYSDPVMDGPVIQAATEAALR--GGVRVRDVFRAVEAIS-AAGGRA  102 (269)
T ss_pred             EECCCC---CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHH--CCCCHHHHHHHHHHHC-CCCCCE
T ss_conf             852738---9989999999999966999999799988856668999999999997--7995999999999841-579988


Q ss_pred             EEECCCH----------HHHHHHHH-HCCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCC
Q ss_conf             8522889----------99987650-21578822576289-999999850597-79983677789999999999997258
Q gi|254780669|r  119 LTDVHTE----------QQCEAIAD-SVDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHG  185 (301)
Q Consensus       119 ~TeV~~~----------~~~e~~~~-~vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~G  185 (301)
                      +-  |..          .-++.+++ .+|-+=||---... .++..++.+.+. +|.+=-+  .|+++.+   +++....
T Consensus       103 vl--M~Y~N~i~~yG~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~gi~~I~LvaP--tt~~eRi---~~i~~~a  175 (269)
T PRK13115        103 LV--MTYWNPVLRYGVDRFARDLAAAGGAGLITPDLIPDEAGEWLAASERHGLDRIFLVAP--SSTPERL---AETVEAS  175 (269)
T ss_pred             EE--HHHHHHHHHHCHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCEEEEEEECC--CCCHHHH---HHHHHCC
T ss_conf             85--475489987369999999997399807647899789999999998658128998589--9988999---9998448


Q ss_pred             CCCEE-EEECCCCCCCHHHCCCCCC-CHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             78089-9514654440100000001-068885-18716871177742122345321263889999999999718988999
Q gi|254780669|r  186 AKDVL-FCERGTSFGYNTLVTDMRS-IPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       186 n~~i~-lcERG~~fgy~~lvvD~~~-i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                      .-=|. +.-.|+|=..+.+-.+... +..+|+ +..||++---=|             .++-+..     +.-.+||+.+
T Consensus       176 ~GFIY~Vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~~~~-----~~~~aDGvIV  237 (269)
T PRK13115        176 RGFVYAASTMGVTGARDAVSSAAPELVARVRAASDIPVCVGLGVS-------------SAAQAAE-----IAGYADGVIV  237 (269)
T ss_pred             CCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEECCCC-------------CHHHHHH-----HHHHCCEEEE
T ss_conf             880899754545677644417799999999971799817972789-------------9999999-----9802999998


Q ss_pred             EECCCHHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             8369833479782018688999999999999
Q gi|254780669|r  263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLA  293 (301)
Q Consensus       263 E~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~  293 (301)
                      =++--  +.+.|+    .++...+++++|++
T Consensus       238 GSa~V--~~i~~~----g~~~v~~~~~el~~  262 (269)
T PRK13115        238 GSALV--SALLDG----GLPAVRALTEELAA  262 (269)
T ss_pred             CHHHH--HHHHHC----CHHHHHHHHHHHHH
T ss_conf             68999--999975----97999999999999


No 104
>PRK07807 inositol-5-monophosphate dehydrogenase; Validated
Probab=83.71  E-value=4  Score=21.71  Aligned_cols=147  Identities=18%  Similarity=0.251  Sum_probs=72.0

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCEEEEEC------------------------------------CC--HHHHHHH-HHHC
Q ss_conf             2456712488899988665287688522------------------------------------88--9999876-5021
Q gi|254780669|r   95 KRGVGLKKGREIFRDLKKKYGFPILTDV------------------------------------HT--EQQCEAI-ADSV  135 (301)
Q Consensus        95 frG~Gle~gL~il~e~k~~~glpv~TeV------------------------------------~~--~~~~e~~-~~~v  135 (301)
                      -.|.-++++.++|++-|.+. +||+.+-                                    .+  .+.++.+ ...|
T Consensus       162 ~~g~sl~eA~~lL~~~kiek-LpvVd~~~~L~gLiT~kDi~k~~~~~~a~D~~grL~VgAAVGv~~d~~eR~~aLv~AGv  240 (479)
T PRK07807        162 PAGTDPRKAFDLLEAAPVKV-APVVDADGRLAGVLTRTGALRATIYTPAVDAAGRLRVAAAVGINGDVAAKARALLEAGV  240 (479)
T ss_pred             CCCCCHHHHHHHHHHCCCCC-CEEECCCCEEEEEEEEEHHHHCCCCCCCCCHHHCEEEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             36678799999997535231-13775699299999961164544688777822345678872578458999999997699


Q ss_pred             CEEEECHHHCCCH---HHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCE-------EEEE-CCC-CCCCHHH
Q ss_conf             5788225762899---99999850597799836777899999999999972587808-------9951-465-4440100
Q gi|254780669|r  136 DILQIPALLCRQT---DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCE-RGT-SFGYNTL  203 (301)
Q Consensus       136 DilQIgA~~~rqt---dLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i-------~lcE-RG~-~fgy~~l  203 (301)
                      |+|=|-.-.-.+.   +.++.+.+...-+-|=-|--++.    .+++.+...|.+-|       -+|- |-. -+|...+
T Consensus       241 DvlvIDtAHGhS~~vi~~vk~iK~~~p~~~viaGNvaT~----~~a~~Li~aGad~ikvGiG~GSiCtTr~v~gvG~pq~  316 (479)
T PRK07807        241 DVLVIDTAHGHQEKMLEAIRAVRALDPGVPLVAGNVVTA----EGTRDLVEAGADIVKVGVGPGAMCTTRMMTGVGRPQF  316 (479)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEHHHH----HHHHHHHHCCCCEEECCCCCCCCEECCCCCCCCCCHH
T ss_conf             899975457664899999999984089885787432029----9999999739997631555783243463237788609


Q ss_pred             CCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             000001068885187168711777421223453212638899999999997189889998
Q gi|254780669|r  204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       204 vvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      --=+......++++.|||-|-.=.          ..|      .++| |+|+|+|.+|+-
T Consensus       317 tAi~~~a~~a~~~gvpiIADGGIr----------~sG------di~K-Ala~GA~~VMlG  359 (479)
T PRK07807        317 SAVLECAAAARELGAHVWADGGVR----------HPR------DVAL-ALAAGASNVMIG  359 (479)
T ss_pred             HHHHHHHHHHHHCCCCEEECCCCC----------CCC------HHHH-HHHCCCCEEEEC
T ss_conf             999999999875699789458725----------346------7999-987289878888


No 105
>pfam06258 DUF1022 Protein of unknown function (DUF1022). This family consists of several hypothetical eukaryotic and prokaryotic proteins. The function of this family is unknown.
Probab=82.98  E-value=4.3  Score=21.52  Aligned_cols=126  Identities=18%  Similarity=0.160  Sum_probs=63.5

Q ss_pred             EEEEECCCCCC--CHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEC
Q ss_conf             69995486349--9999999999999965533997066015576886663222456712488899988665287688522
Q gi|254780669|r   45 FVLIAGPCQIE--SHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDV  122 (301)
Q Consensus        45 l~iIAGPCsiE--S~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV  122 (301)
                      .++|.||.--=  +.+.+.++++.+.++..+....++.=+           |-|.+  ++..+.|++......--++-|=
T Consensus       147 ~vLIGG~sk~~~~~~~~~~~l~~~i~~l~~~~~~~l~it~-----------SRRTP--~~~~~~l~~~~~~~~~~~~~~~  213 (308)
T pfam06258       147 AVLVGGPSKHFRWDADAARRLLEQLQALLEAYGGSLLITT-----------SRRTP--EAAEAALRKLLGPRPGLYVWDG  213 (308)
T ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEE-----------CCCCC--HHHHHHHHHHHCCCCEEEECCC
T ss_conf             9996557878888999999999999999987797299994-----------68896--9999999986089972898279


Q ss_pred             CCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             88999987650215788225762899999998505977998367778999999999999725878
Q gi|254780669|r  123 HTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       123 ~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      -.+.-.......+|.+++-+   --..++-|++-|||||.|=.-.+-+ .-+....+.+.+.|.-
T Consensus       214 ~~~Npy~~~L~~Ad~iiVT~---DSvSMisEA~~tGkPV~i~~l~~~~-~r~~~f~~~L~~~g~~  274 (308)
T pfam06258       214 TGPNPYFGFLAWADAVVVTA---DSVSMVSEAAATGAPVGVLPLEGKR-GKFARFHDSLEERGRV  274 (308)
T ss_pred             CCCCHHHHHHHHCCEEEEEC---CHHHHHHHHHHCCCCEEEEECCCCC-HHHHHHHHHHHHCCCE
T ss_conf             88645899998588689906---7188999998649977999677666-5999999999987990


No 106
>PRK02145 consensus
Probab=82.63  E-value=4.4  Score=21.43  Aligned_cols=186  Identities=17%  Similarity=0.207  Sum_probs=113.4

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      -.++|+...+.|++...=  .-  .|   +    ++.  |.+.-+++++++.++..+|+..  =|.+.++++.+.+ .+|
T Consensus        33 P~~~a~~~~~~Gadelhi--vD--ld---~----a~~--~~~~~~~~I~~i~~~~~iPi~vGGGIrs~e~~~~ll~~Gad   99 (257)
T PRK02145         33 PVEIARRYDEQGADELTF--LD--IT---A----TSD--GRDLILPIIEAVASQVFIPLTVGGGVRAVEDVRRLLNAGAD   99 (257)
T ss_pred             HHHHHHHHHHCCCCEEEE--EE--CC---C----CCC--CCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCC
T ss_conf             999999999879998999--97--88---8----766--75408999999996568748962773046889999981998


Q ss_pred             EEEECHHHCCCHHHHHHHHHC-CC-----EEEEECC----------------C---CCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             788225762899999998505-97-----7998367----------------7---789999999999997258780899
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQT-GR-----VINVKKG----------------Q---FLSPWEMHNILQKLHAHGAKDVLF  191 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t-~k-----pV~iKkg----------------q---~~s~~e~~~a~eki~~~Gn~~i~l  191 (301)
                      =+=|++....|.+++..+++. |.     -+-+|++                +   ..++.+|   ++++.+.|...+++
T Consensus       100 kVii~s~a~~np~~v~~~~~~fG~q~Iv~siD~k~~~~~~~~~~~~v~~~~~~~~t~~~~~~~---~~~~~~~G~geil~  176 (257)
T PRK02145        100 KVSMNSSAVANPQLVRDAADKYGSQCIVVAIDAKRVSADGEPPRWEVFTHGGRKATGLDAVEW---ARKMAELGAGEILL  176 (257)
T ss_pred             EEEEHHHHHHCCCHHHHHHHHCCCCCEEEEEEEEECCCCCCCCEEEEEECCCEECCCCCHHHH---HHHHHHCCCCEEEE
T ss_conf             898415566593022457876698344999998733677777508999778714367745576---56887618786899


Q ss_pred             EEC---CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             514---654440100000001068885-1871687117774212234532126388999999999971898899983698
Q gi|254780669|r  192 CER---GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD  267 (301)
Q Consensus       192 cER---G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~  267 (301)
                      +.=   |+..|++     +.-+..+.+ +.+|||.               +||-..+- .+..+....+++|+..-.   
T Consensus       177 tdI~rDG~~~G~d-----l~l~~~i~~~~~ipvIa---------------sGGi~s~~-di~~~~~~~~~~av~~g~---  232 (257)
T PRK02145        177 TSMDRDGTKSGFD-----LALTRAVSDAVPVPVIA---------------SGGVGSLQ-HLADGITEGHADAVLAAS---  232 (257)
T ss_pred             EEECCCCCCCCCC-----HHHHHHHHHCCCCCEEE---------------ECCCCCHH-HHHHHHHHCCCCEEEEHH---
T ss_conf             9984778778889-----79999998626998999---------------86899999-999999808984876532---


Q ss_pred             HHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             33479782018688999999999
Q gi|254780669|r  268 PDNAPSDGPNMINIKDLPKLLSQ  290 (301)
Q Consensus       268 P~~AlsD~~q~l~l~~l~~ll~~  290 (301)
                         ++  --..+++.++++.|.+
T Consensus       233 ---~~--~~~~~~i~e~k~~l~~  250 (257)
T PRK02145        233 ---IF--HYGEHTVGEAKRFMAE  250 (257)
T ss_pred             ---HH--HCCCCCHHHHHHHHHH
T ss_conf             ---67--7799899999999998


No 107
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional
Probab=82.58  E-value=4.4  Score=21.42  Aligned_cols=145  Identities=19%  Similarity=0.295  Sum_probs=73.5

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCEEEEECCC---------------------------------------HHHHHHH-HHH
Q ss_conf             245671248889998866528768852288---------------------------------------9999876-502
Q gi|254780669|r   95 KRGVGLKKGREIFRDLKKKYGFPILTDVHT---------------------------------------EQQCEAI-ADS  134 (301)
Q Consensus        95 frG~Gle~gL~il~e~k~~~glpv~TeV~~---------------------------------------~~~~e~~-~~~  134 (301)
                      ..+.-++++.++|++-|.+ .+||+.+-..                                       .+-++.+ ...
T Consensus       172 ~~~isl~eA~~ll~~~kie-klpvVd~~g~L~glit~kDi~k~~~~P~a~~D~~grL~VgAAVg~~~~~~eRa~~Lv~aG  250 (499)
T PTZ00314        172 RYPITLEDANDVLNRSRKG-VLPIVNDNGELVALVSRSDAVKNRDYPHASKDENKQLLVGAAISTREEDKERAAALIDAG  250 (499)
T ss_pred             CCCCCHHHHHHHHHHHHHC-CCEEECCCCCEEEEEECCHHHHHHHCCCHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCC
T ss_conf             5999999999999860331-230665789589986303487753387122201387899999478804899999999869


Q ss_pred             CCEEEECHHHCCC---HHHHHHHHHC--CCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE--------EECCC-CCCC
Q ss_conf             1578822576289---9999998505--9779983677789999999999997258780899--------51465-4440
Q gi|254780669|r  135 VDILQIPALLCRQ---TDLLTAAAQT--GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLF--------CERGT-SFGY  200 (301)
Q Consensus       135 vDilQIgA~~~rq---tdLl~a~a~t--~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~l--------cERG~-~fgy  200 (301)
                      +|+|=|-.-.-.+   -++++.+.+.  +.||..  |--.+.    .+++.+...|.+-|-+        |-|.. -+|+
T Consensus       251 vDvlvIDtAhGhs~~v~~~ik~ik~~~p~v~vIa--GNVaT~----~~a~~Li~aGAD~vkVGiGpGSiCTTR~v~GvGv  324 (499)
T PTZ00314        251 VDVLVLDSSQGNSIYQIDFIKWIKSTYPHLEVIA--GNVVTQ----DQAKNLIDAGADGIRIGMGSGSICTTQEVCAVGR  324 (499)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE--EEECHH----HHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCC
T ss_conf             9899981688772789999999885279884676--433109----9999999749987997535885510464346678


Q ss_pred             HHHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             100000001068885187168711777421223453212638899999999997189889998
Q gi|254780669|r  201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       201 ~~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      ..+-.=+.....-++++.|||-|-.=               | +.-.+++ |+|+|+|.+|+=
T Consensus       325 Pq~tAv~~~a~~a~~~gvpiIADGGI---------------r-~sGDi~K-AlAaGAd~VMlG  370 (499)
T PTZ00314        325 PQATAVYKVARYAHSRGVPCIADGGI---------------R-SSGDIVK-ALALGASCVMLG  370 (499)
T ss_pred             CHHHHHHHHHHHHCCCCCEEEECCCC---------------C-CHHHHHH-HHHCCCCEEEEC
T ss_conf             60567999999864499859914784---------------6-4318999-987289878608


No 108
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776    This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea . The oxaloacetate decarboxylase Na+ pump is the paradigm of the family of Na+ transport decarboxylases that present in bacteria and archaea. It a multi subunit enzyme consisting of a peripheral alpha-subunit and integral membrane subunits beta and gamma. The energy released by the decarboxylation reaction of oxaloacetate is coupled to Na+ ion pumping across the membrane.; GO: 0008948 oxaloacetate decarboxylase activity, 0006814 sodium ion transport.
Probab=82.18  E-value=4.6  Score=21.33  Aligned_cols=149  Identities=14%  Similarity=0.182  Sum_probs=89.6

Q ss_pred             HHHHHHHH-CCEEEE-----CHHHCCCHHHHHHHHHCCC-EEEEECC----CCCCHHHHHHHHHHHHHCCCCCEEEEEC-
Q ss_conf             99876502-157882-----2576289999999850597-7998367----7789999999999997258780899514-
Q gi|254780669|r  127 QCEAIADS-VDILQI-----PALLCRQTDLLTAAAQTGR-VINVKKG----QFLSPWEMHNILQKLHAHGAKDVLFCER-  194 (301)
Q Consensus       127 ~~e~~~~~-vDilQI-----gA~~~rqtdLl~a~a~t~k-pV~iKkg----q~~s~~e~~~a~eki~~~Gn~~i~lcER-  194 (301)
                      -++.+.++ +||+.|     =.|||++  =++|+.++|+ -|-.==-    .-.|++.|+-.++++...|.+-|.+=.- 
T Consensus        96 FV~~a~~NG~DVFRiFDALND~RNl~~--ai~a~Kk~g~dHvQg~iSYTtSPvHTl~~yl~la~~L~~~G~DSI~IKDMa  173 (616)
T TIGR01108        96 FVKKAVENGLDVFRIFDALNDPRNLQK--AIEAAKKHGADHVQGAISYTTSPVHTLEKYLELAKELLEMGVDSICIKDMA  173 (616)
T ss_pred             HHHHHHHCCCEEEEEECCCCCHHHHHH--HHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             999999759808995124588778999--999999738978999971246843678889999999998188605520200


Q ss_pred             CCCCCCHHHCCCCCCCHHHHH-HC-CCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEE--------EEEE
Q ss_conf             654440100000001068885-18-7168711777421223453212638899999999997189889--------9983
Q gi|254780669|r  195 GTSFGYNTLVTDMRSIPIMTS-MG-VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI--------FLET  264 (301)
Q Consensus       195 G~~fgy~~lvvD~~~i~~lk~-~~-~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGl--------fiE~  264 (301)
                      |.-..+.-.  ++  +..+|+ ++ +||=+- ||+|             ..|.+---..|+-+|+|++        +-=.
T Consensus       174 GlLTP~~AY--EL--V~alK~~~~n~pvhLH-~H~T-------------tGmA~~AllkA~EAG~d~iDTAisS~S~gtS  235 (616)
T TIGR01108       174 GLLTPKVAY--EL--VSALKKEFGNLPVHLH-SHAT-------------TGMAEMALLKAIEAGADMIDTAISSMSGGTS  235 (616)
T ss_pred             CCCCHHHHH--HH--HHHHHHHCCCEEEEEE-CCCC-------------HHHHHHHHHHHHHCCCCCCHHCCCCCCCCCC
T ss_conf             464415899--99--9999742397468863-2472-------------3379999998887078800200552347888


Q ss_pred             CCCHHHC----CCCCC--CCCCHHHHHHHHHHHHHHHH
Q ss_conf             6983347----97820--18688999999999999999
Q gi|254780669|r  265 HQDPDNA----PSDGP--NMINIKDLPKLLSQLLAIDK  296 (301)
Q Consensus       265 Hp~P~~A----lsD~~--q~l~l~~l~~ll~~l~~i~~  296 (301)
                      || |-+|    |.+-+  +-|+++.|+++-.=.+++|+
T Consensus       236 HP-ptE~lv~~L~~~gyD~gld~~~L~~i~~YFr~VRk  272 (616)
T TIGR01108       236 HP-PTETLVAALRGTGYDTGLDIELLLEIADYFRKVRK  272 (616)
T ss_pred             CC-HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             87-47999999705787431027999999999999999


No 109
>PRK13134 consensus
Probab=82.13  E-value=4.6  Score=21.31  Aligned_cols=192  Identities=17%  Similarity=0.130  Sum_probs=103.5

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-9706601------557688666322245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv  118 (301)
                      ++.||==   +.|...++.+.+.+.|+++. +|.-|.-      ..-+|+.-..  -.|..+++-++++++.+.++..|+
T Consensus        24 yitaG~P---~~e~s~~~i~~l~~~GaDiiEiGiPfSDP~ADGPvIq~A~~rAL--~~G~~~~~~~~~~~~~~~~~~~pi   98 (257)
T PRK13134         24 FLTAGFP---TSERFWDELEALDAAGADIIEVGVPFSDPVADGPVVAAASQRAL--ESGVTLRWIMDGLAARKGRLRAGL   98 (257)
T ss_pred             EEECCCC---CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             8707079---97999999999997799999978988887655899999999999--679987899999998744689998


Q ss_pred             EE--E---C---CCHHHHHHHHH-HCCEEEECHHHCCCHHHH-HHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             85--2---2---88999987650-215788225762899999-99850597-7998367778999999999999725878
Q gi|254780669|r  119 LT--D---V---HTEQQCEAIAD-SVDILQIPALLCRQTDLL-TAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       119 ~T--e---V---~~~~~~e~~~~-~vDilQIgA~~~rqtdLl-~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      +-  =   +   -...-++.+++ .+|-+=||---....+.+ .++.+.+. +|.+=-+  .++++.+   +++.+....
T Consensus        99 vlMtY~N~i~~yG~e~F~~~~~~aGvdGvIipDLP~eE~~~~~~~~~~~gi~~I~lvaP--tt~~~Ri---~~i~~~s~g  173 (257)
T PRK13134         99 VLMGYLNPFMQYGFERFVRDAADAGVAGCIIPDLPLDEDADLRALLAARGMDLIALVGP--NTGEGRM---REYAAVASG  173 (257)
T ss_pred             EEEECCHHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEECCC--CCCHHHH---HHHHHHCCC
T ss_conf             99853459997468999999986798759946999778899999999759826996389--9999999---999962888


Q ss_pred             CEE-EEECCCCCCCHHHCCCC-CCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             089-95146544401000000-01068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  188 DVL-FCERGTSFGYNTLVTDM-RSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       188 ~i~-lcERG~~fgy~~lvvD~-~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      =|. +.-.|+|=..+.+-.++ ..+..+|+ +.+||++---=|             .++-+.     ++..++||+.+=+
T Consensus       174 FIY~vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~v~-----~~~~~aDGvIVGS  235 (257)
T PRK13134        174 YVYVVSVMGTTGVRDGLPVEVADTLARARQCFSIPVALGFGIS-------------RPAQLE-----GLSHPPDAVIFGS  235 (257)
T ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCC-------------CHHHHH-----HHHCCCCEEEECH
T ss_conf             0899843556687645528899999999970699879980679-------------999999-----9970399999879


Q ss_pred             C
Q ss_conf             6
Q gi|254780669|r  265 H  265 (301)
Q Consensus       265 H  265 (301)
                      +
T Consensus       236 a  236 (257)
T PRK13134        236 A  236 (257)
T ss_pred             H
T ss_conf             9


No 110
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF). Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)-formimino-5-aminoimidazole-4-carboxamide ribonucleotide (PRFAR) to imidazole glycerol phosphate (ImGP) and 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR). This conversion involves two tightly coupled reactions in distinct active sites of IGPS. The two catalytic domains can be fused, like in fungi and plants, or peformed by a heterodimer (HisH-glutaminase and HisF-cyclase), like in bacteria.
Probab=82.09  E-value=4.6  Score=21.30  Aligned_cols=188  Identities=18%  Similarity=0.275  Sum_probs=116.3

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH-HCC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--2288999987650-215
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD-SVD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~-~vD  136 (301)
                      -.+.|+...+.+++...    =--.|.       +..|-  ..-+++++++.++..+|+.-  =|.+.++++.+.+ .+|
T Consensus        29 P~~~a~~~~~~gadelh----ivDld~-------a~~g~--~~n~~~i~~i~~~~~~pi~vGGGIrs~~~~~~~l~~Gad   95 (243)
T cd04731          29 PVELAKRYNEQGADELV----FLDITA-------SSEGR--ETMLDVVERVAEEVFIPLTVGGGIRSLEDARRLLRAGAD   95 (243)
T ss_pred             HHHHHHHHHHCCCCEEE----EECCCC-------CCCCC--CCHHHHHHHHHHHCCCCEEEEEEEEEHHHHHHHHHCCCC
T ss_conf             99999999986999999----970673-------20377--007999999998679868998506647999999977997


Q ss_pred             EEEECHHHCCCHHHHHHHHHC-CC--E---EEEEC------------CCCCCHHHHHHHHHHHHHCCCCCEEEEE--C-C
Q ss_conf             788225762899999998505-97--7---99836------------7778999999999999725878089951--4-6
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQT-GR--V---INVKK------------GQFLSPWEMHNILQKLHAHGAKDVLFCE--R-G  195 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t-~k--p---V~iKk------------gq~~s~~e~~~a~eki~~~Gn~~i~lcE--R-G  195 (301)
                      =+=|++....|.+++.++++. |.  .   +-+|+            ++-.+..+....++++...|...++++.  | |
T Consensus        96 kVvigs~~~~n~~~~~~~~~~~Gsq~Iv~siD~k~~~~~~~~v~~~~~~~~~~~~~~~~i~~~~~~G~geil~tdI~~DG  175 (243)
T cd04731          96 KVSINSAAVENPELIREIAKRFGSQCVVVSIDAKRRGDGGYEVYTHGGRKPTGLDAVEWAKEVEELGAGEILLTSMDRDG  175 (243)
T ss_pred             EEEECCCCCCCCCHHHHHHHHCCCCCEEEEEEEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             89989844237714357887569930999999765378962898469844126789999999984698789998725768


Q ss_pred             CCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCC
Q ss_conf             54440100000001068885-18716871177742122345321263889999999999718988999836983347978
Q gi|254780669|r  196 TSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD  274 (301)
Q Consensus       196 ~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD  274 (301)
                      ++-|++     +.-+..+++ ...|+|.               +||-+.+- .+.++--..|++|+.+=.      |+- 
T Consensus       176 t~~G~d-----~~l~~~i~~~~~~piI~---------------sGGi~~~~-di~~~l~~~~~~gv~~g~------~~~-  227 (243)
T cd04731         176 TKKGYD-----LELIRAVSSAVNIPVIA---------------SGGAGKPE-HFVEAFEEGGADAALAAS------IFH-  227 (243)
T ss_pred             CCCCCC-----HHHHHHHHHHCCCCEEE---------------ECCCCCHH-HHHHHHHHCCCEEEEEHH------HHH-
T ss_conf             566579-----99999999868999999---------------88999999-999999878982998822------767-


Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             201868899999999
Q gi|254780669|r  275 GPNMINIKDLPKLLS  289 (301)
Q Consensus       275 ~~q~l~l~~l~~ll~  289 (301)
                       -..+++.++++.|+
T Consensus       228 -~~~~~l~~~k~~L~  241 (243)
T cd04731         228 -FGEYTIAELKEYLA  241 (243)
T ss_pred             -CCCCCHHHHHHHHH
T ss_conf             -69989999999986


No 111
>PRK05211 consensus
Probab=81.74  E-value=4.7  Score=21.22  Aligned_cols=185  Identities=17%  Similarity=0.286  Sum_probs=114.0

Q ss_pred             HHHHHHHHHHHHHHCC----CCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH
Q ss_conf             9999999999655339----970660155768866632224567124888999886652876885--2288999987650
Q gi|254780669|r   60 AFMIAEKLYAICQSLN----IGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD  133 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~----~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~  133 (301)
                      -.++|+...+.+++..    +.+.               +.|.  ..-+++++++.++..+|+.-  =|.+.++++.+.+
T Consensus        23 P~~~ak~~~~~gadelhivDld~a---------------~~g~--~~n~~~I~~i~~~~~~Pl~vGGGIrs~~~i~~ll~   85 (248)
T PRK05211         23 IVPLAKRYAEEGADELVFYDITAS---------------SDGR--VVDKSWVSRVAEVIDIPFCVAGGIKSVEDAREILS   85 (248)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCC---------------CCCC--CCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHH
T ss_conf             999999999869998999978677---------------6787--21499999999767985896278013899999998


Q ss_pred             -HCCEEEECHHHCCCHHHHHHHHHC-CC--EEE-E--E--C--CC-------------CCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             -215788225762899999998505-97--799-8--3--6--77-------------7899999999999972587808
Q gi|254780669|r  134 -SVDILQIPALLCRQTDLLTAAAQT-GR--VIN-V--K--K--GQ-------------FLSPWEMHNILQKLHAHGAKDV  189 (301)
Q Consensus       134 -~vDilQIgA~~~rqtdLl~a~a~t-~k--pV~-i--K--k--gq-------------~~s~~e~~~a~eki~~~Gn~~i  189 (301)
                       .+|=+=|++...+|.+|+.++++. |.  .|. |  +  +  +.             -.+.++..-.++++...|...+
T Consensus        86 ~GadkViigs~a~~np~li~~~~~~fG~q~IvvsiD~~~~~~~~~~~v~~~~g~~~~~~~t~~~~~d~i~~~~~~G~geI  165 (248)
T PRK05211         86 FGADKISINSPALADPTLITRLADRFGVQCIVVGIDSWFDAETGKYQVYQYTGDESRTKATQWETLDWVKEVQKRGAGEI  165 (248)
T ss_pred             CCCCEEEECCHHHHCCHHHHHHHHHCCCCEEEEEEEEECCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCEE
T ss_conf             79988998976761961899999857993699999710255578579998258656530477369999999997598669


Q ss_pred             EEEEC---CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             99514---654440100000001068885-18716871177742122345321263889999999999718988999836
Q gi|254780669|r  190 LFCER---GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH  265 (301)
Q Consensus       190 ~lcER---G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~H  265 (301)
                      +++.=   |+.-||+     +.-+..+.+ ...|||.               +||-..+-. +..+-...|++|..+=. 
T Consensus       166 l~t~IdrDG~~~G~d-----l~l~~~i~~~~~iPvIa---------------sGGv~s~~d-i~~~~~~~~~~gvi~gs-  223 (248)
T PRK05211        166 VLNMMNQDGVRNGYD-----LAQLKKVRAICHVPLIA---------------SGGAGTMEH-FLEAFRDADVDGALAAS-  223 (248)
T ss_pred             EEEEECCCCCCCCCC-----HHHHHHHHHHCCCCEEE---------------ECCCCCHHH-HHHHHHHCCCHHHHHHH-
T ss_conf             998987899727889-----99999999746999999---------------888899999-99999867984133048-


Q ss_pred             CCHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             9833479782018688999999999
Q gi|254780669|r  266 QDPDNAPSDGPNMINIKDLPKLLSQ  290 (301)
Q Consensus       266 p~P~~AlsD~~q~l~l~~l~~ll~~  290 (301)
                           |+-  ...+++.++++.|.+
T Consensus       224 -----~~~--~~~i~l~e~k~~L~~  241 (248)
T PRK05211        224 -----VFH--KQIINIGELKQYLAA  241 (248)
T ss_pred             -----HHH--CCCCCHHHHHHHHHH
T ss_conf             -----888--899999999999998


No 112
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA). TPRS is a bifunctional tetrameric enzyme (2 alpha and 2 beta subunits) that catalyzes the last two steps of L-tryptophan biosynthesis. Alpha and beta subunit catalyze two distinct reactions which are both strongly stimulated by the formation of the complex. The alpha subunit catalyzes the cleavage of indole 3-glycerol phosphate (IGP) to indole and d-glyceraldehyde 3-phosphate (G3P). Indole is then channeled to the active site of the beta subunit, a PLP-dependent enzyme that catalyzes a replacement reaction to convert L-serine into L-tryptophan.
Probab=81.46  E-value=4.9  Score=21.16  Aligned_cols=184  Identities=20%  Similarity=0.292  Sum_probs=100.7

Q ss_pred             CHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--E---CC
Q ss_conf             99999999999999655339-9706601------55768866632224567124888999886652876885--2---28
Q gi|254780669|r   56 SHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--D---VH  123 (301)
Q Consensus        56 S~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--e---V~  123 (301)
                      +.+...++++.+.+.|.++. +|.-|.-      ..-+|+.-+.  -+|..+++.+++++++|++++.|++-  =   +.
T Consensus        12 ~~~~~~~~~~~l~~~G~d~iEiGiPfsDP~aDGpvIq~A~~~aL--~~g~~~~~~~~~~~~~r~~~~~pivlM~Y~N~i~   89 (242)
T cd04724          12 DLETTLEILKALVEAGADIIELGIPFSDPVADGPVIQAASERAL--ANGVTLKDVLELVKEIRKKNTIPIVLMGYYNPIL   89 (242)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHHHCCCCCEEEEEECHHHH
T ss_conf             97999999999997699999978998887765899999999999--7699499999999998734798889998445766


Q ss_pred             ---CHHHHHHHHHH-CCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE-EECCC
Q ss_conf             ---89999876502-1578822576289-999999850597-79983677789999999999997258780899-51465
Q gi|254780669|r  124 ---TEQQCEAIADS-VDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAKDVLF-CERGT  196 (301)
Q Consensus       124 ---~~~~~e~~~~~-vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~l-cERG~  196 (301)
                         ...-++.+++. +|-+=||-.-... .++..++.+.+. +|.+=-+  .++++.   ++++.+....=|.+ .-+|+
T Consensus        90 ~~G~e~F~~~~~~~Gv~GviipDLP~ee~~~~~~~~~~~~i~~I~lvsP--tt~~~r---i~~i~~~s~gfiY~vs~~Gv  164 (242)
T cd04724          90 QYGLERFLRDAKEAGVDGLIIPDLPPEEAEEFREAAKEYGLDLIFLVAP--TTPDER---IKKIAELASGFIYYVSRTGV  164 (242)
T ss_pred             HHCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCEEEEEECC--CCCHHH---HHHHHHHCCCEEEEEECCCC
T ss_conf             5289999999997599758706999578468999998659838899689--887899---99999747984999857777


Q ss_pred             CCCCHHHC-CC-CCCCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             44401000-00-0010688851-8716871177742122345321263889999999999718988999836
Q gi|254780669|r  197 SFGYNTLV-TD-MRSIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH  265 (301)
Q Consensus       197 ~fgy~~lv-vD-~~~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~H  265 (301)
                      | |-.+.. .+ ...+..+|+. ..||++---=+             .++-+    +..... +||+.+=++
T Consensus       165 T-G~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGI~-------------~~e~v----~~~~~~-aDGvIVGSa  217 (242)
T cd04724         165 T-GARTELPDDLKELIKRIRKYTDLPIAVGFGIS-------------TPEQA----AEVAKY-ADGVIVGSA  217 (242)
T ss_pred             C-CCCCCCHHHHHHHHHHHHHHCCCCEEEECCCC-------------CHHHH----HHHHHH-CCEEEECHH
T ss_conf             7-87755649999999999871689748743879-------------99999----999965-999998789


No 113
>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional
Probab=81.36  E-value=4.9  Score=21.14  Aligned_cols=227  Identities=18%  Similarity=0.216  Sum_probs=132.2

Q ss_pred             CCCEEEECCCCCCEEECCCCCE-----E------EEECCCCCCCHHHHHHHHHHHHHHHH-HCC-CCEEEECCCCCCCCC
Q ss_conf             1770683578772797699706-----9------99548634999999999999999655-339-970660155768866
Q gi|254780669|r   24 TNAAIHLGSGKNQVTFSNEQRF-----V------LIAGPCQIESHDHAFMIAEKLYAICQ-SLN-IGLVYKSSFDKANRS   90 (301)
Q Consensus        24 ~~~~~~ig~~~~~i~ig~~~~l-----~------iIAGPCsiES~e~~~~~A~~lk~~~~-~~~-~~~ifK~sfdKanRt   90 (301)
                      +-+.+.||.|.+.+++||+.=|     .      +-.--|---+++.   +.+.++++.. ++. +|-.+|.-+=- -|.
T Consensus        60 pir~V~iG~G~~~~~iGgE~Vl~RHektF~npt~~av~v~D~m~e~e---i~~r~~~i~~~~~~rvG~~l~~d~vA-vr~  135 (454)
T PRK04165         60 PVREVKIGTGERAVKIGGETVLYRHEKTFFNPTGIAVDVSDTMSEEE---IDERLKEINNFQFERVGEILKLDAVA-LRN  135 (454)
T ss_pred             CEEEEEECCCCEEEEECCCEEEEECCEEEECCCCEEEEECCCCCHHH---HHHHHHHHHHCEEEEECCEEEEEEEE-EEC
T ss_conf             80489865886047877816899601010079826999337777899---99999986512567723411520899-991


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHC-C--EEEECHHHCCCHH-HHHHHHHCCCEEEEECC
Q ss_conf             632224567124888999886652876885228899998765021-5--7882257628999-99998505977998367
Q gi|254780669|r   91 SLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSV-D--ILQIPALLCRQTD-LLTAAAQTGRVINVKKG  166 (301)
Q Consensus        91 S~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~v-D--ilQIgA~~~rqtd-Ll~a~a~t~kpV~iKkg  166 (301)
                          -.|-. ++=...-+.+.+.+++|++----++.-++...+++ |  =|=-+| +--|.+ +..-+.+.+.|+-++-+
T Consensus       136 ----~s~d~-~~fa~~vk~va~~~~~pliL~s~dp~vl~aaL~~~~~~kPLlyaA-t~~N~~~m~~LA~~~~~Pl~V~a~  209 (454)
T PRK04165        136 ----VSGDP-EKFAKAVKKVAETTELPLILCSFDPAVLKAALEVVADRRPLLYAA-TKDNWKEMAELAKEYNCPLVVSAP  209 (454)
T ss_pred             ----CCCCH-HHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHCCCCCEEEEC-CHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             ----78998-999999999972169977998389999999999745379755227-898899999999874984799779


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCEEEEECCC---CCCCHHHCCCCCCCHHHH---HHCCCEEECHHHHHHHCCCCCCCCCC
Q ss_conf             778999999999999725878089951465---444010000000106888---51871687117774212234532126
Q gi|254780669|r  167 QFLSPWEMHNILQKLHAHGAKDVLFCERGT---SFGYNTLVTDMRSIPIMT---SMGVPVIFDASHSVQQPGIHGNCSGG  240 (301)
Q Consensus       167 q~~s~~e~~~a~eki~~~Gn~~i~lcERG~---~fgy~~lvvD~~~i~~lk---~~~~PVi~D~SHs~q~p~~~~~~~gG  240 (301)
                         +++++..-++++.+.|.+++.|=- |+   .-.+.|. +-+|-..+-+   .+++|+|.=|.-+-.     +  ..-
T Consensus       210 ---~L~~L~~l~~~~~~~GikdlVLDp-g~~~~k~tl~~~-~~IRRaAik~~~r~~gYP~i~~p~~~~~-----~--d~~  277 (454)
T PRK04165        210 ---NLEELKSLVKKLQAAGIKDIVLDP-GTENLKETLDNF-TQIRRAAIKKGDRPLGYPIIAFPITAWM-----A--PPV  277 (454)
T ss_pred             ---CHHHHHHHHHHHHHCCCCCEEECC-CCCCHHHHHHHH-HHHHHHHHHCCCCCCCCCEEECCHHHCC-----C--CCC
T ss_conf             ---989999999999976985278889-974488999999-9999999863787778756730233205-----7--620


Q ss_pred             CHHHHHHHHHHHHHHCCCEEEEEECCCHHHCC
Q ss_conf             38899999999997189889998369833479
Q gi|254780669|r  241 ERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP  272 (301)
Q Consensus       241 ~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~Al  272 (301)
                      ...+-+.+.-+....-+.++++=-.-+|..++
T Consensus       278 ~~~~~E~~~As~~i~KYa~i~Vl~~~~~~~ll  309 (454)
T PRK04165        278 SASMKEAVLASILIIKYADIMVLHSIEPWALL  309 (454)
T ss_pred             CCHHHHHHHHHHHHHHHCCEEEECCCCHHHHH
T ss_conf             01789999999999874658997168878860


No 114
>pfam07745 Glyco_hydro_53 Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
Probab=81.23  E-value=4.9  Score=21.11  Aligned_cols=193  Identities=17%  Similarity=0.237  Sum_probs=95.1

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEECCC-CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHH
Q ss_conf             99999999999999655339970660155-76886663222456712488899988665287688522889999876502
Q gi|254780669|r   56 SHDHAFMIAEKLYAICQSLNIGLVYKSSF-DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADS  134 (301)
Q Consensus        56 S~e~~~~~A~~lk~~~~~~~~~~ifK~sf-dKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~  134 (301)
                      +.+...++|+++|+.|-++.+.+-|--+| |+..-..|..++++..+ .   |++.=..|    +.||+..-  ....-.
T Consensus        56 dl~~v~~~akrak~~GmkvlLdfHYSD~WADPg~Q~~P~aW~~~~~~-~---L~~~vy~y----T~~vl~~l--k~~Gv~  125 (332)
T pfam07745        56 DLDDVIEIAKRAKAAGMKVLLDFHYSDTWADPGKQTKPKAWASLDFE-Q---LKKALYNY----TKDVLNAL--KEAGIT  125 (332)
T ss_pred             CHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCHH-H---HHHHHHHH----HHHHHHHH--HHCCCC
T ss_conf             99999999999998799399986313554685557686333459999-9---99999999----99999999--986999


Q ss_pred             CCEEEECHHHC----------CC----HHHHHHHHHC------CCEEEEECCCCCCHHHHHHHHHHHHHCCCC-CEEEEE
Q ss_conf             15788225762----------89----9999998505------977998367778999999999999725878-089951
Q gi|254780669|r  135 VDILQIPALLC----------RQ----TDLLTAAAQT------GRVINVKKGQFLSPWEMHNILQKLHAHGAK-DVLFCE  193 (301)
Q Consensus       135 vDilQIgA~~~----------rq----tdLl~a~a~t------~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~-~i~lcE  193 (301)
                      .|++|||--.-          .|    ..||.+..+.      +..|+|--.+.-+.....-..+.+.+.|-+ +||   
T Consensus       126 pd~VQVGNEin~GmLwp~g~~~~~~~~a~ll~ag~~AVr~~~~~~ki~lHl~~~~~~~~~~~~fd~l~~~gvd~Dvi---  202 (332)
T pfam07745       126 PDMVQVGNEITSGMLWPEGKTPNWENLAKLLNSGYWAVKDVNPTIKVMIHLDNGEDNGTYRWWFDNLLAAGVDFDVI---  202 (332)
T ss_pred             CCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEE---
T ss_conf             64478641355664476889778999999999999999853999739999589877588999999999759980267---


Q ss_pred             CCCCCC--CHHHCCCCC-CCHHHH-HHCCCEEE-CHH----------------HHHHHCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             465444--010000000-106888-51871687-117----------------774212234532126388999999999
Q gi|254780669|r  194 RGTSFG--YNTLVTDMR-SIPIMT-SMGVPVIF-DAS----------------HSVQQPGIHGNCSGGERQYIVPLAKAA  252 (301)
Q Consensus       194 RG~~fg--y~~lvvD~~-~i~~lk-~~~~PVi~-D~S----------------Hs~q~p~~~~~~~gG~r~~v~~la~aa  252 (301)
                       |.|+.  ++.-+.+++ ++-.|. +++-||++ ..+                .+.+...+-.-+..|+++|+..+..+.
T Consensus       203 -G~SyYP~W~gtl~~l~~~l~~l~~~y~K~v~VvEtayp~t~~~~D~~~N~~~~~~~~~~~yp~t~~GQ~~~l~~l~~~v  281 (332)
T pfam07745       203 -GVSYYPFWSGTLENLRTNLKDMASRYGKPVMVVETAYPWTLEDGDGHGNPLPEYGFDLSGYPASVQGQATYLRDLAQLV  281 (332)
T ss_pred             -EEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             -6565422126399999999999999789679998168775656788888576422345799988899999999999999


Q ss_pred             HHHCCC--EEEE
Q ss_conf             971898--8999
Q gi|254780669|r  253 VAIGIA--GIFL  262 (301)
Q Consensus       253 ~a~G~d--Glfi  262 (301)
                      .+.+..  |+|-
T Consensus       282 ~~v~~~G~GvfY  293 (332)
T pfam07745       282 SAVPSDGLGVFY  293 (332)
T ss_pred             HHCCCCEEEEEE
T ss_conf             717998479999


No 115
>PRK13123 consensus
Probab=80.82  E-value=5.1  Score=21.02  Aligned_cols=215  Identities=16%  Similarity=0.145  Sum_probs=103.1

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-9706601------557688666322245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv  118 (301)
                      ++.||   --+.+...++.+.+.+.|+++. +|.=|.-      ..-+|+.-+.  -.|..+++-++++++.+.++-+-+
T Consensus        20 yitaG---~P~~~~~~~~i~~l~~~GaDiiElGiPFSDPvADGPvIq~A~~rAL--~~G~~~~~~~~~~~~~~~~~Pivl   94 (256)
T PRK13123         20 YIMAG---DGGLDGLKETIRFLEEAGVSAIEIGIPFSDPVADGPVIQLAGLRAL--ASGVSLKAILQALIEKETQIPLVI   94 (256)
T ss_pred             EECCC---CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHCCCCCCEEE
T ss_conf             86186---8997899999999997699999978998886665799999899998--679969999988763057998897


Q ss_pred             EEECCC------HHHHHHHHHH-CCEEEECHHHCCCH-HHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             852288------9999876502-15788225762899-99999850597-799836777899999999999972587808
Q gi|254780669|r  119 LTDVHT------EQQCEAIADS-VDILQIPALLCRQT-DLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAKDV  189 (301)
Q Consensus       119 ~TeV~~------~~~~e~~~~~-vDilQIgA~~~rqt-dLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~~i  189 (301)
                      +|=.-.      .+-++.+++. +|-+=||---.... ++..++.+.+. +|.+=-+  .|+++   -.+.+.+...-=|
T Consensus        95 MtY~N~i~~yG~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~gi~~I~liaP--tt~~~---Ri~~i~~~a~GFi  169 (256)
T PRK13123         95 MTYINPVFQYGIERFVEDLAETGVKGLIIPDLPYEHQDFIAPLLRDTDIALIPLVSL--TSPIE---RQKEIIKEAEGFI  169 (256)
T ss_pred             EEHHHHHHHCCHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEECCC--CCCHH---HHHHHHHCCCCCE
T ss_conf             404258987189999999997499789737999678999999999769977864089--99388---9999986078848


Q ss_pred             E-EEECCCCCCCHHHCCCCC-CCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             9-951465444010000000-10688851-87168711777421223453212638899999999997189889998369
Q gi|254780669|r  190 L-FCERGTSFGYNTLVTDMR-SIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQ  266 (301)
Q Consensus       190 ~-lcERG~~fgy~~lvvD~~-~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp  266 (301)
                      . +.-+|+|=..+.+..++. .+..+|+. .+||++---=|             .++-+..+     ...+||+.+=++-
T Consensus       170 Y~Vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~v~~~-----~~~aDGvIVGSai  231 (256)
T PRK13123        170 YAVAVNGVTGKRGNYRDDLDSHLEKLKSIAHIPVLAGFGIS-------------TLEDVERF-----NAVCDGVIVGSKI  231 (256)
T ss_pred             EEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCC-------------CHHHHHHH-----HHHCCEEEEHHHH
T ss_conf             99744556676533338899999999856899879976889-------------99999999-----7139999972999


Q ss_pred             CHHHCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             8334797820186889999999999999
Q gi|254780669|r  267 DPDNAPSDGPNMINIKDLPKLLSQLLAI  294 (301)
Q Consensus       267 ~P~~AlsD~~q~l~l~~l~~ll~~l~~i  294 (301)
                      -      +--..=..+++.++++++++-
T Consensus       232 v------~~i~~~~~~ei~~fi~~~k~~  253 (256)
T PRK13123        232 V------ELLHEGKEEEICEFIQAAKQK  253 (256)
T ss_pred             H------HHHHHCCHHHHHHHHHHHHHH
T ss_conf             9------999977989999999999987


No 116
>smart00518 AP2Ec AP endonuclease family 2. These endonucleases play a role in DNA repair. Cleave phosphodiester bonds at apurinic or apyrimidinic sites
Probab=80.79  E-value=5.1  Score=21.01  Aligned_cols=188  Identities=15%  Similarity=0.214  Sum_probs=98.9

Q ss_pred             CCCCCCCCCC-HHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCC-EEEEECCCC
Q ss_conf             6322245671-24888999886652876885228899998765021578822576289999999850597-799836777
Q gi|254780669|r   91 SLAGKRGVGL-KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGR-VINVKKGQF  168 (301)
Q Consensus        91 S~~sfrG~Gl-e~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~k-pV~iKkgq~  168 (301)
                      ||.+|+..-+ ++-.+-+++..++++++++  +|.+.-+...+.--++.+- +..+-..|| +.+...|. -|++-=|..
T Consensus        33 ~pr~w~~~~~~~~~~~~f~~~~~~~~i~~~--~Ha~YlINLas~~~e~~~k-S~~~l~~el-~~~~~lG~~~vV~HpGs~  108 (273)
T smart00518       33 NPRSWKGVRLSEETAEKFKEALKENNIDVS--VHAPYLINLASPDKEKVEK-SIERLIDEI-KRCEELGIKALVFHPGSY  108 (273)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCEE--EECCCEECCCCCCHHHHHH-HHHHHHHHH-HHHHHHCCCEEEECCCCC
T ss_conf             988899999999999999999998399668--6442100457998899999-999999999-999980998587345313


Q ss_pred             ------CCHHHHHHHHHHHHHCCCCCEEEEEC----CCCCCCHHHCCCCCCCHHH-HH-HCCCEEECHHHHHHHCCCCCC
Q ss_conf             ------89999999999997258780899514----6544401000000010688-85-187168711777421223453
Q gi|254780669|r  169 ------LSPWEMHNILQKLHAHGAKDVLFCER----GTSFGYNTLVTDMRSIPIM-TS-MGVPVIFDASHSVQQPGIHGN  236 (301)
Q Consensus       169 ------~s~~e~~~a~eki~~~Gn~~i~lcER----G~~fgy~~lvvD~~~i~~l-k~-~~~PVi~D~SHs~q~p~~~~~  236 (301)
                            ..+..+..+.+++.+....-.++.|-    |++.|++  +-+++.+... +. ..+=|++|--|.--    .|-
T Consensus       109 ~~~~~e~~i~~i~~~l~~vl~~~~~~~lllEntAGqG~~lG~~--~eeL~~ii~~~~~~~rvgvClDTcH~fA----aGy  182 (273)
T smart00518      109 LKQSKEEALNRIIESLNEVIDETKGVVILLETTAGKGSQIGST--FEDLKEIIDLIKELDRIGVCIDTCHIFA----AGY  182 (273)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCC--HHHHHHHHHHCCCCCCEEEEEECHHHHC----CCC
T ss_conf             5888899999999999999823698679974578998846868--9999999997378465378752020222----657


Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCC----C-----CCCCCCHHHHHHHHH
Q ss_conf             2126388999999999971898899983698334797----8-----201868899999999
Q gi|254780669|r  237 CSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS----D-----GPNMINIKDLPKLLS  289 (301)
Q Consensus       237 ~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~Als----D-----~~q~l~l~~l~~ll~  289 (301)
                      ...-...|...+-+-....|.+-+ .=.|-|=.+...    |     |.-.|.++-|..++.
T Consensus       183 di~t~~~~~~~l~~~~~~iGl~~l-~~iHlNDSk~~~GS~~DRH~~IG~G~IG~~~~~~l~~  243 (273)
T smart00518      183 DINTVEGFEKVLEEFENVLGLEYL-KAIHLNDSKIELGSGKDRHENLGEGYIGFEPFRLLMA  243 (273)
T ss_pred             CCCCHHHHHHHHHHHHHHHCHHHE-EEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHC
T ss_conf             868688899999999987385564-5887668876446788755567898668899999981


No 117
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis. It catalyzes the aldol condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a Schiff base formation between pyruvate and a lysine residue. The functional enzyme is a homotetramer consisting of a dimer of dimers. DHDPS is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways.
Probab=80.38  E-value=5.3  Score=20.92  Aligned_cols=89  Identities=12%  Similarity=0.198  Sum_probs=38.5

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCH
Q ss_conf             99954863499999999999999965533997066015576886663222456712488899988665287688522889
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTE  125 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~  125 (301)
                      .+|+| ++-.|-+...+.|+..++.|++..  .+.-|          +.++ +.-++-+++++++.+..++|++-     
T Consensus        71 ~vi~g-v~~~~t~~~i~~a~~A~~~Gadai--~v~pP----------~y~~-~s~~~l~~~~~~ia~a~~lPi~l-----  131 (284)
T cd00950          71 PVIAG-TGSNNTAEAIELTKRAEKAGADAA--LVVTP----------YYNK-PSQEGLYAHFKAIAEATDLPVIL-----  131 (284)
T ss_pred             EEEEE-CCCCCHHHHHHHHHHHHHCCCCEE--EECCC----------CCCC-CCHHHHHHHHHHHHHCCCCCEEE-----
T ss_conf             07750-787789999999999998399989--96266----------5789-79999999999997555997798-----


Q ss_pred             HHHHHHHHHCCEEEECHHHCC--CHHHHHHHHHCCCEEEEEC
Q ss_conf             999876502157882257628--9999999850597799836
Q gi|254780669|r  126 QQCEAIADSVDILQIPALLCR--QTDLLTAAAQTGRVINVKK  165 (301)
Q Consensus       126 ~~~e~~~~~vDilQIgA~~~r--qtdLl~a~a~t~kpV~iKk  165 (301)
                                  ..+|++.-.  ..+++.++++....+-+|-
T Consensus       132 ------------Yn~P~~tg~~l~~~~l~~L~~~pnv~giK~  161 (284)
T cd00950         132 ------------YNVPGRTGVNIEPETVLRLAEHPNIVGIKE  161 (284)
T ss_pred             ------------EECCCCCCCCCCHHHHHHHHCCCCEEEEEC
T ss_conf             ------------737641167888899999847999899985


No 118
>PRK13119 consensus
Probab=79.80  E-value=5.5  Score=20.80  Aligned_cols=192  Identities=10%  Similarity=0.143  Sum_probs=100.1

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH-HCCE
Q ss_conf             999548634999999999999999655339-9706601------5576886663222456712488899988665-2876
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANRSSLAGKRGVGLKKGREIFRDLKKK-YGFP  117 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanRtS~~sfrG~Gle~gL~il~e~k~~-~glp  117 (301)
                      .+.||   --+.|...++++.+.+.|+++. +|.=|--      ..-+|+--+  --.|..+++.+++++++|++ .++|
T Consensus        20 yltaG---~P~~e~s~~~l~~l~~~GadiiElGiPFSDP~ADGPvIq~A~~rA--L~~G~~~~~~~~~~~~ir~~~~~~p   94 (261)
T PRK13119         20 YITVG---DPDIRTTLALMHGMVANGADILELGVPFSDPMADGPVIQRAAERA--LANGISLRDVLDVVRKFRETDTQTP   94 (261)
T ss_pred             EECCC---CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHH--HHCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             86483---899899999999999669999997898888666589999999999--9779978899999998651489989


Q ss_pred             EEE--ECCC------HHHHHHHHHH-CCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             885--2288------9999876502-1578822576289-999999850597-799836777899999999999972587
Q gi|254780669|r  118 ILT--DVHT------EQQCEAIADS-VDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       118 v~T--eV~~------~~~~e~~~~~-vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn  186 (301)
                      ++-  =.-.      ..-++.+++. +|-+=||----.. .++..++.+.+. +|.+=-+ ..+.+.+    +++.+...
T Consensus        95 ivlMtY~N~i~~yG~e~F~~~~~~~GvdGvIipDLP~ee~~~~~~~~~~~gl~~I~lvaP-tt~~~Ri----~~i~~~a~  169 (261)
T PRK13119         95 VVLMGYLNPVHKMGYREFAQEAAKAGVDGVLTVDSPVETIDPLYRELKDNGVDCIFLIAP-TTTEDRI----KTIAELAG  169 (261)
T ss_pred             EEEEECHHHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEECC-CCCHHHH----HHHHHHCC
T ss_conf             899840378988629999999997598579836899788799999999759976443079-9989999----99997289


Q ss_pred             CCE-EEEECCCCCCCHHHCCCC-CCCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             808-995146544401000000-010688851-87168711777421223453212638899999999997189889998
Q gi|254780669|r  187 KDV-LFCERGTSFGYNTLVTDM-RSIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       187 ~~i-~lcERG~~fgy~~lvvD~-~~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      .=| .+.-+|+|=.......+. +.+..+|+. .+||++--.=|             .++-+.     .+..++||..+=
T Consensus       170 gFiY~vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~v~-----~~~~~aDGvIVG  231 (261)
T PRK13119        170 GFVYYVSLKGVTGAASLDTDEVSRKIEYLHQYIDIPIGVGFGIS-------------NAESAR-----KIGRVADAVIVG  231 (261)
T ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCC-------------CHHHHH-----HHHCCCCEEEEC
T ss_conf             81999736666687755548899999999863699879983659-------------999999-----987349999982


Q ss_pred             EC
Q ss_conf             36
Q gi|254780669|r  264 TH  265 (301)
Q Consensus       264 ~H  265 (301)
                      ++
T Consensus       232 Sa  233 (261)
T PRK13119        232 SR  233 (261)
T ss_pred             HH
T ss_conf             89


No 119
>PRK08610 fructose-bisphosphate aldolase; Reviewed
Probab=79.46  E-value=5.6  Score=20.73  Aligned_cols=77  Identities=22%  Similarity=0.354  Sum_probs=39.0

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC-CHH-HCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHH
Q ss_conf             78999999999999725878089951465444-010-0000001068885-18716871177742122345321263889
Q gi|254780669|r  168 FLSPWEMHNILQKLHAHGAKDVLFCERGTSFG-YNT-LVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQY  244 (301)
Q Consensus       168 ~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg-y~~-lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~  244 (301)
                      +.+|+|   |.+.+..+|.+ .+..-=|+..| |.. -..||.-+...++ .+.|.++   |     |+    ||=..  
T Consensus       155 ~T~pee---a~~Fv~~TgvD-~LAvaiGt~HG~yk~~p~l~~~~L~~I~~~~~vPLVL---H-----Gg----SGi~~--  216 (286)
T PRK08610        155 YADPKE---CQELVEKTGID-ALAPALGSVHGPYKGEPKLGFKEMEEIGLSTGLPLVL---H-----GG----TGIPT--  216 (286)
T ss_pred             CCCHHH---HHHHHHHHCCC-EEEEECCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEE---E-----CC----CCCCH--
T ss_conf             379999---99999973986-6731115544655899877899999998524999796---5-----89----99999--


Q ss_pred             HHHHHHHHHHHCCCEEEEEE
Q ss_conf             99999999971898899983
Q gi|254780669|r  245 IVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       245 v~~la~aa~a~G~dGlfiE~  264 (301)
                        ..-+.|+..|+.=+=+-|
T Consensus       217 --e~i~~ai~~Gi~KvNi~T  234 (286)
T PRK08610        217 --KDIQKAIPFGTAKINVNT  234 (286)
T ss_pred             --HHHHHHHHCCCEEEEECC
T ss_conf             --999999985984899671


No 120
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDP is a member of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.
Probab=79.23  E-value=5.7  Score=20.69  Aligned_cols=136  Identities=20%  Similarity=0.254  Sum_probs=81.8

Q ss_pred             HHHHHHHHHHHHHHCCE----EEEEC---CCHHHHHHHHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHH
Q ss_conf             24888999886652876----88522---88999987650-215788225762899999998505977998367778999
Q gi|254780669|r  101 KKGREIFRDLKKKYGFP----ILTDV---HTEQQCEAIAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPW  172 (301)
Q Consensus       101 e~gL~il~e~k~~~glp----v~TeV---~~~~~~e~~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~  172 (301)
                      ++-.+.++++|+..+-|    ++...   ....+++.+.+ -++++...+-.  -.++++.+.+.+..|..+=+   |++
T Consensus        39 ~~l~~~i~~~~~~~~~pfgvnl~~~~~~~~~~~~~~~~~~~~v~~v~~~~g~--p~~~v~~l~~~g~~v~~~v~---s~~  113 (236)
T cd04730          39 EALRAEIRKIRALTDKPFGVNLLVPSSNPDFEALLEVALEEGVPVVSFSFGP--PAEVVERLKAAGIKVIPTVT---SVE  113 (236)
T ss_pred             HHHHHHHHHHHHHCCCCEEECCCCCCCCCCHHHHHHHHHHCCCCEEEECCCC--CHHHHHHHHHCCCEEEEECC---CHH
T ss_conf             9999999999974699724433246776368999999997699999987989--78999999982998999589---899


Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCC-CCHH--HCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHH
Q ss_conf             99999999972587808995146544-4010--0000001068885-187168711777421223453212638899999
Q gi|254780669|r  173 EMHNILQKLHAHGAKDVLFCERGTSF-GYNT--LVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPL  248 (301)
Q Consensus       173 e~~~a~eki~~~Gn~~i~lcERG~~f-gy~~--lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~l  248 (301)
                      +.    ++..+.|.+-| +++ |.-- |+..  ....+.-+|.+++ ...|||.+=-=           . -.++     
T Consensus       114 ~A----~~a~~~GaD~i-v~q-G~eAGGH~g~~~~~~~~lv~~v~~~~~ipviaAGGI-----------~-~g~~-----  170 (236)
T cd04730         114 EA----RKAEAAGADAL-VAQ-GAEAGGHRGTFDIGTFALVPEVRDAVDIPVIAAGGI-----------A-DGRG-----  170 (236)
T ss_pred             HH----HHHHHCCCCEE-EEE-CCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEECCC-----------C-CHHH-----
T ss_conf             99----99998189989-997-777777889875556779999999829868965462-----------7-7899-----


Q ss_pred             HHHHHHHCCCEEEEEE
Q ss_conf             9999971898899983
Q gi|254780669|r  249 AKAAVAIGIAGIFLET  264 (301)
Q Consensus       249 a~aa~a~G~dGlfiE~  264 (301)
                      ..+++++|+||+++=|
T Consensus       171 i~aal~lGA~gV~~GT  186 (236)
T cd04730         171 IAAALALGADGVQMGT  186 (236)
T ss_pred             HHHHHHHCCCEEEECC
T ss_conf             9999980897999553


No 121
>TIGR00674 dapA dihydrodipicolinate synthase; InterPro: IPR005263   Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants. The enzyme catalyses the condensation of L-aspartate-beta-semialdehyde and pyruvate to dihydropicolinic acid via a ping-pong mechanism in which pyruvate binds to the enzyme by forming a Schiff-base with a lysine residue . Three other proteins are structurally related to DHDPS and probably also act via a similar catalytic mechanism. These are Escherichia coli N-acetylneuraminate lyase (4.1.3.3 from EC, IPR005264 from INTERPRO) (gene nanA), which catalyzes the condensation of N-acetyl-D-mannosamine and pyruvate to form N-acetylneuraminate; Sinorhizobium meliloti protein mosA , which is involved in the biosynthesis of the rhizopine 3-O-methyl-scyllo-inosamine; and E. coli hypothetical protein yjhH. The sequences of DHDPS from different sources are well-conserved. The structure takes the form of a homotetramer, in which 2 monomers are related by an approximate 2-fold symmetry . Each monomer comprises 2 domains: an 8-fold alpha-/beta-barrel, and a C-terminal alpha-helical domain. The fold resembles that of N-acetylneuraminate lyase. The active site lysine is located in the barrel domain, and has access via 2 channels on the C-terminal side of the barrel.   This family represents a subclass of dihydrodipicolinate synthase. ; GO: 0008840 dihydrodipicolinate synthase activity, 0019877 diaminopimelate biosynthetic process.
Probab=79.13  E-value=5.8  Score=20.67  Aligned_cols=167  Identities=17%  Similarity=0.254  Sum_probs=108.1

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCC---CCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEE
Q ss_conf             706999548634999999999999999655339---97066015576886663222456712488899988665287688
Q gi|254780669|r   43 QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN---IGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPIL  119 (301)
Q Consensus        43 ~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~---~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~  119 (301)
                      +|.-||||==|==.+| +++.++.++++|.+..   -+|+=||           +-+|+     .+||+.+.+...+|++
T Consensus        66 ~R~pvIaG~GsN~T~E-ai~l~~~a~~~G~dg~L~vtPyYNKP-----------~q~Gl-----~~HFkaia~~~~lPii  128 (288)
T TIGR00674        66 GRVPVIAGTGSNATEE-AIELTKFAEKLGVDGFLVVTPYYNKP-----------TQEGL-----YQHFKAIAEEVDLPII  128 (288)
T ss_pred             CCEEEEECCCCCHHHH-HHHHHHHHHHCCCCEEECCCCCCCCC-----------CCCHH-----HHHHHHHHHHCCCCEE
T ss_conf             8778985377325899-99999999868956884588755188-----------82138-----9999999987169889


Q ss_pred             EECCCHHHHHHHHHHCCEEEECHHHCCCH--HHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCC-CCCEEEEECC
Q ss_conf             52288999987650215788225762899--99999850597-79983677789999999999997258-7808995146
Q gi|254780669|r  120 TDVHTEQQCEAIADSVDILQIPALLCRQT--DLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHG-AKDVLFCERG  195 (301)
Q Consensus       120 TeV~~~~~~e~~~~~vDilQIgA~~~rqt--dLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~G-n~~i~lcERG  195 (301)
                                       .+-||.|.+.+.  |.+..+|+.-. .+=||--   |+ ++..+.|.+...+ .+=.++|  |
T Consensus       129 -----------------LYNvPsRTg~~l~peTv~rLA~~~~NI~aiKEa---~g-~l~~~~~i~~~~p~~dF~vls--G  185 (288)
T TIGR00674       129 -----------------LYNVPSRTGVSLEPETVKRLAEEPNNIVAIKEA---TG-NLERISEIKAITPDDDFVVLS--G  185 (288)
T ss_pred             -----------------EECCCCCCCCCCCHHHHHHHHCCCCCEEEEEEC---CC-CHHHHHHHHHHCCCCCEEEEE--C
T ss_conf             -----------------842876410178628999973016770688726---88-889999999866898538884--7


Q ss_pred             CCCCCHHHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHH--------------HCCCEEE
Q ss_conf             54440100000001068885187168711777421223453212638899999999997--------------1898899
Q gi|254780669|r  196 TSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVA--------------IGIAGIF  261 (301)
Q Consensus       196 ~~fgy~~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a--------------~G~dGlf  261 (301)
                            |   |.-..|.|.-=+-=||-=.+|-.             .+.+..|.+.+..              -=++-||
T Consensus       186 ------D---D~l~l~~~~~Gg~GVISV~~N~~-------------P~~~~emv~~a~~G~~~~A~EIh~kL~~L~~~LF  243 (288)
T TIGR00674       186 ------D---DALTLPILALGGKGVISVTSNVA-------------PKLMKEMVENALEGDFAEAREIHQKLMPLFKALF  243 (288)
T ss_pred             ------C---CCHHHHHHHHCCCEEEEHHHHHH-------------HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             ------8---61136999818961673005556-------------8999999999853897899999987888988752


Q ss_pred             EEECCCHHHC
Q ss_conf             9836983347
Q gi|254780669|r  262 LETHQDPDNA  271 (301)
Q Consensus       262 iE~Hp~P~~A  271 (301)
                      +||=|=|=++
T Consensus       244 ~etNPIPVK~  253 (288)
T TIGR00674       244 IETNPIPVKT  253 (288)
T ss_pred             CCCCCHHHHH
T ss_conf             8889878999


No 122
>PRK12581 oxaloacetate decarboxylase; Provisional
Probab=79.06  E-value=5.8  Score=20.65  Aligned_cols=184  Identities=15%  Similarity=0.106  Sum_probs=98.8

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEE-CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEE-------CCC
Q ss_conf             34999999999999999655339970660-1557688666322245671248889998866528768852-------288
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAICQSLNIGLVYK-SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTD-------VHT  124 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~~~~~~~~ifK-~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~Te-------V~~  124 (301)
                      +-=+.++.+.+|+.+.++|-... . +|- ++||-+.|-    .++--+ +.|+.+++.-....+-.+.-       -+.
T Consensus        30 tr~~t~d~l~ia~~ld~~G~~si-E-~wGGAtfd~~~rf----l~EdPw-erlr~lr~~~pnt~lqmLlRg~n~vgy~~y  102 (468)
T PRK12581         30 TRLSIEDMLPVLTILDKIGYYSL-E-CWGGATFDACIRF----LNEDPW-ERLRTLKKGLPNTRLQMLLRGQNLLGYRHY  102 (468)
T ss_pred             HHCCHHHHHHHHHHHHHCCCCEE-E-ECCCCCHHHHHHH----HCCCHH-HHHHHHHHHCCCCCEEEEHHHHHHCCCCCC
T ss_conf             50889999999999997298789-8-3588109999987----487989-999999985789734300112332011458


Q ss_pred             HH-----HHHHHHH-HCCEEEECHHHCCCH-----HHHHHHHHCCCEEEEEC----CCCCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             99-----9987650-215788225762899-----99999850597799836----777899999999999972587808
Q gi|254780669|r  125 EQ-----QCEAIAD-SVDILQIPALLCRQT-----DLLTAAAQTGRVINVKK----GQFLSPWEMHNILQKLHAHGAKDV  189 (301)
Q Consensus       125 ~~-----~~e~~~~-~vDilQIgA~~~rqt-----dLl~a~a~t~kpV~iKk----gq~~s~~e~~~a~eki~~~Gn~~i  189 (301)
                      ++     .++..++ .+|+++|  |-+-|.     .-++++.+.|+-+..-=    ...-+++-++..++.+.+.|.+-|
T Consensus       103 pddvv~~fv~~~~~~Gidvfri--FD~LNd~~n~~~ai~~vk~~G~~~~~~i~yt~sp~ht~~yy~~~ak~l~~~Gad~I  180 (468)
T PRK12581        103 ADDIVDKFISLSAQNGIDVFRI--FDALNDPRNIQQALRAVKKTGKEAQLCIAYTTSPVHTLNYYLSLVKELVEMGADSI  180 (468)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEE--ECCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEE
T ss_conf             8289999999999759987997--31467678999999999963874899999668975549999999999997399989


Q ss_pred             EEEECC-CCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             995146-54440100000001068885-187168711777421223453212638899999999997189889998
Q gi|254780669|r  190 LFCERG-TSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       190 ~lcERG-~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      .++.=. ..-.+.-    ..-|..+|+ .++||-+ -||.+          .|   +...-..+|+.+|+|.+=.-
T Consensus       181 ~iKDmaGlL~P~~a----~~LV~~lK~~~~iPI~~-HtH~t----------~G---la~a~~laAieAGaDiVD~A  238 (468)
T PRK12581        181 CIKDMAGILTPKAA----KELVSGIKAMTNLPLIV-HTHAT----------SG---ISQMTYLAAVEAGADRIDTA  238 (468)
T ss_pred             EEECCCCCCCHHHH----HHHHHHHHHCCCCCEEE-EECCC----------CC---HHHHHHHHHHHCCCCEEEEC
T ss_conf             98478777688999----99999998367986599-82588----------75---49999999998199999744


No 123
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain.  DCR in E. coli  is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the flavin and iron-sulfur cofactors. Metabolism of unsaturated fatty acids requires auxiliary enzymes in addition to those used in b-oxidation. After a given number of cycles through the b-oxidation pathway, those unsaturated fatty acyl-CoAs with double bonds at even-numbered carbon positions contain 2-trans, 4-cis double bonds that can not be modified by enoyl-CoA hydratase. DCR utilizes NADPH to remove the C4-C5 double bond. DCR can catalyze the reduction of both natural fatty acids with cis double bonds, as well as substrates containing trans double bonds. The reaction is initiated by hybrid transfer from NADPH to FAD, which in turn transfers electrons, one at a time, to FMN via the 4Fe-4S cluster. The fully reduced FMN provi
Probab=78.31  E-value=6.1  Score=20.51  Aligned_cols=46  Identities=22%  Similarity=0.181  Sum_probs=27.7

Q ss_pred             HHHHHHHH---CCCEEEEEC------CCCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             99999850---597799836------777899999999999972587808995146
Q gi|254780669|r  149 DLLTAAAQ---TGRVINVKK------GQFLSPWEMHNILQKLHAHGAKDVLFCERG  195 (301)
Q Consensus       149 dLl~a~a~---t~kpV~iKk------gq~~s~~e~~~a~eki~~~Gn~~i~lcERG  195 (301)
                      ++++++.+   .+.||.+|=      ....+++|++..+..+...|- +.+-+-+|
T Consensus       192 Eiv~aVr~~vg~d~~v~~Ris~~d~~~~G~~~~e~~~~~~~l~~~Gv-D~i~vs~G  246 (353)
T cd02930         192 EIVRAVRAAVGEDFIIIYRLSMLDLVEGGSTWEEVVALAKALEAAGA-DILNTGIG  246 (353)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEEECCC
T ss_conf             99999999709987499973601268999899999999999998199-99996377


No 124
>PRK13121 consensus
Probab=78.23  E-value=6.1  Score=20.49  Aligned_cols=217  Identities=16%  Similarity=0.130  Sum_probs=109.3

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCC-----CCCCCC-CCCCCCHHHHHHHHHHHHH-HCCE
Q ss_conf             999548634999999999999999655339-9706601557688-----666322-2456712488899988665-2876
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKAN-----RSSLAG-KRGVGLKKGREIFRDLKKK-YGFP  117 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKan-----RtS~~s-frG~Gle~gL~il~e~k~~-~glp  117 (301)
                      .+.||   --+.+..+++++.+.+.|+++. +|.=|.  -+.|-     +++..+ -.|..+++.+++++++|++ ..+|
T Consensus        22 y~taG---~P~~~~s~~~~~~l~~~GaDiiElGiPfS--DP~ADGPvIq~A~~rAL~~G~~~~~~~~~~~~~r~~~~~~P   96 (265)
T PRK13121         22 FITAG---DPDPAKTVELMHALVEGGADVIELGVPFS--DPMADGPVIQRASERALAHGVSLRQVLAMVKEFRETNQTTP   96 (265)
T ss_pred             EEECC---CCCHHHHHHHHHHHHHCCCCEEEECCCCC--CCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             87071---89989999999999976999999789889--97765899999999999779984677999998310379999


Q ss_pred             EEEE-CCCH-------HHHHHHHHH-CCEEEECHHHCC-CHHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             8852-2889-------999876502-157882257628-9999999850597-799836777899999999999972587
Q gi|254780669|r  118 ILTD-VHTE-------QQCEAIADS-VDILQIPALLCR-QTDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       118 v~Te-V~~~-------~~~e~~~~~-vDilQIgA~~~r-qtdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn  186 (301)
                      ++-= -.++       .-++.+++. +|-+=||-.--. ..++..++.+.+. +|.+=-+  .|+++.+   +++.+...
T Consensus        97 ivlM~Y~N~i~~yG~e~F~~~~~~aGvdGlIipDLP~eE~~~~~~~~~~~gl~~I~lvaP--tt~~~Ri---~~i~~~~~  171 (265)
T PRK13121         97 VVLMGYANPIERMGYDAFAAAARAAGVDGVLVVDYPPEECEEFAAKMRAAGIDPIFLLAP--TSTDERI---AAVARVAS  171 (265)
T ss_pred             EEEEEHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEEECC--CCCHHHH---HHHHHHCC
T ss_conf             898621459999719999999987298734348999899999999998659966899589--9989999---99996289


Q ss_pred             CCE-EEEECCCCCCCHHHCC-CC-CCCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             808-9951465444010000-00-010688851-8716871177742122345321263889999999999718988999
Q gi|254780669|r  187 KDV-LFCERGTSFGYNTLVT-DM-RSIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       187 ~~i-~lcERG~~fgy~~lvv-D~-~~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                      -=| .+.-.|+| |-++... ++ ..+..+|+. .+||++---=|             .++-+     +.+..++||+.+
T Consensus       172 gFiY~Vs~~GvT-G~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~~-----~~v~~~ADGvIV  232 (265)
T PRK13121        172 GYVYYVSLKGVT-GAATLDVSSVAAKLPAIRSHVPLPVGVGFGIR-------------DAATA-----RAVAEVADAVVI  232 (265)
T ss_pred             CEEEEEECCCCC-CCCCCCHHHHHHHHHHHHHCCCCCEEEECCCC-------------CHHHH-----HHHHHCCCEEEE
T ss_conf             809997555566-77756628899999999854799859976889-------------89999-----999811999998


Q ss_pred             EECCCHHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             8369833479782018688999999999999
Q gi|254780669|r  263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLA  293 (301)
Q Consensus       263 E~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~  293 (301)
                      =+.---.-.-++.  .-..+.+.+++++|++
T Consensus       233 GSaiV~~i~~~~~--e~~~~~v~~fi~~lk~  261 (265)
T PRK13121        233 GSRLVQLIEQAPP--ERAAAALTDFLAELRA  261 (265)
T ss_pred             CHHHHHHHHHCCH--HHHHHHHHHHHHHHHH
T ss_conf             4899999985785--7689999999999999


No 125
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed
Probab=78.22  E-value=6.1  Score=20.49  Aligned_cols=192  Identities=14%  Similarity=0.189  Sum_probs=95.2

Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCC-----E
Q ss_conf             99999996553399706601557688666322245671248889998866528768852288999987650215-----7
Q gi|254780669|r   63 IAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD-----I  137 (301)
Q Consensus        63 ~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vD-----i  137 (301)
                      +++.+.+...+...+.|---        |+...+-.|++.-..+.+.+.+++.+||.--.-+....+.+.+.+|     |
T Consensus        30 ~~~Avi~AAee~~sPvIlq~--------s~~~~~~~g~~~~~~~~~~~a~~~~VPV~lHLDH~~~~e~~~~ai~~GftSV  101 (284)
T PRK12737         30 TLQVVVETAAELRSPVILAG--------TPGTISYAGADYIIAIAEVAARKYNIPLALHLDHHEDLDDIKKKVRAGIRSV  101 (284)
T ss_pred             HHHHHHHHHHHHCCCEEEEC--------CHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEE
T ss_conf             99999999999789989996--------7538877799999999999999879999998899999999999998199879


Q ss_pred             EEECHH-----HCCCHHHHHHHH-HCCCEE----------------EEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             882257-----628999999985-059779----------------9836777899999999999972587808995146
Q gi|254780669|r  138 LQIPAL-----LCRQTDLLTAAA-QTGRVI----------------NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERG  195 (301)
Q Consensus       138 lQIgA~-----~~rqtdLl~a~a-~t~kpV----------------~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG  195 (301)
                      .-=++.     |.+.|-=+.+.+ ..|.+|                .-+...+.+|++   |.+.+..+|. +.+..-=|
T Consensus       102 M~DgS~lp~eeNi~~T~~vv~~Ah~~gv~VEaElG~igg~ed~~~~~~~~~~~T~pee---a~~Fv~~Tgv-D~LAvaiG  177 (284)
T PRK12737        102 MIDGSHLSFEENIAIVKEVVEFCHRYDASVEAELGRLGGQEDDLVVDEKDAMYTNPDA---AAEFVERTGI-DSLAVAIG  177 (284)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCHHHCCCHHH---HHHHHHHHCC-CEEEECCC
T ss_conf             8709999999999999999998645288699963112576777666641113179999---9999999698-98700037


Q ss_pred             CCCC-CHH-HCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC-----
Q ss_conf             5444-010-0000001068885-1871687117774212234532126388999999999971898899983698-----
Q gi|254780669|r  196 TSFG-YNT-LVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD-----  267 (301)
Q Consensus       196 ~~fg-y~~-lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~-----  267 (301)
                      +..| |.. -..||--+..+++ ++.|.++--+.             |..   ...-+.|+..|+.=+=+-|.-.     
T Consensus       178 t~HG~yk~~p~L~~d~L~~I~~~~~iPLVLHGgS-------------G~~---~e~i~~ai~~Gi~KiNi~T~l~~a~~~  241 (284)
T PRK12737        178 TAHGLYKGEPKLDFDRLEEIREKVSIPLVLHGAS-------------GVP---DEDVKKAISLGICKVNVATELKIAFSD  241 (284)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCC-------------CCC---HHHHHHHHHCCEEEEEECHHHHHHHHH
T ss_conf             5356759998578999999998639998966899-------------999---999999997795899858589999999


Q ss_pred             -HHHCCCCCCCCCCHH
Q ss_conf             -334797820186889
Q gi|254780669|r  268 -PDNAPSDGPNMINIK  282 (301)
Q Consensus       268 -P~~AlsD~~q~l~l~  282 (301)
                       =.+.+.+.+...+|.
T Consensus       242 ~~~~~l~~~p~~~d~~  257 (284)
T PRK12737        242 AVKKYFYENPKANDPR  257 (284)
T ss_pred             HHHHHHHHCCCCCCHH
T ss_conf             9999998787868969


No 126
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure. Specific for this family is the conserved phosphate binding site at the edges of strands 7 and 8. The phosphate comes either from the substrate, as in the case of inosine monophosphate dehydrogenase (IMPDH), or from ribulose-5-phosphate 3-epimerase (RPE) or from cofactors, like FMN.
Probab=77.94  E-value=6.2  Score=20.44  Aligned_cols=171  Identities=15%  Similarity=0.172  Sum_probs=91.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCH-------HHHHH
Q ss_conf             99999999999965533997066015576886663222456712488899988665287688522889-------99987
Q gi|254780669|r   58 DHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTE-------QQCEA  130 (301)
Q Consensus        58 e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~-------~~~e~  130 (301)
                      +...+.++.+.+.|...   ..+.-      +  ..+.+..+ ...-+..+++++.++.|+.-.+...       ...+.
T Consensus        12 ~~~~E~a~~~~~aGa~~---i~~~~------~--~~~~~~~~-~~~~~~i~~~~~~t~~P~~v~~~~~~~~~~~~~~~~~   79 (200)
T cd04722          12 GDPVELAKAAAEAGADA---IIVGT------R--SSDPEEAE-TDDKEVLKEVAAETDLPLGVQLAINDAAAAVDIAAAA   79 (200)
T ss_pred             CCHHHHHHHHHHCCCCE---EEECC------C--CCCHHHHH-HHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHH
T ss_conf             78999999998688736---88648------8--79824616-9999999999970799879984205666677599999


Q ss_pred             H-HHHCCEEEECHHHCC----CHHHHHHHHHC--CCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHH
Q ss_conf             6-502157882257628----99999998505--9779983677789999999999997258780899514654440100
Q gi|254780669|r  131 I-ADSVDILQIPALLCR----QTDLLTAAAQT--GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL  203 (301)
Q Consensus       131 ~-~~~vDilQIgA~~~r----qtdLl~a~a~t--~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~l  203 (301)
                      + ...+|.+.|+.-.-.    ..++++++.+.  +.+|..|-...   ++..  ..+....|..-|.+.-.+...+-.+.
T Consensus        80 ~~~~g~d~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~vi~~~~~~---~~~~--~~~a~~~g~~~v~~~~~~~~~~~~~~  154 (200)
T cd04722          80 ARAAGADGVEIHGAVGYLAREDLELIRELREAVPDVKVVVKLSPT---GELA--AAAAEEAGVDEVGLGNGGGGGGGRDA  154 (200)
T ss_pred             HHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCCC---CHHH--HHHHHHCCCCEEEECCCCCCCCCCCC
T ss_conf             998399989978999654300689999999844896499968999---9999--99999809979997087467888766


Q ss_pred             -CCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             -000001068885-18716871177742122345321263889999999999718988999
Q gi|254780669|r  204 -VTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       204 -vvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                       ..++.-++..++ ...||+.+--=               ..  +.-++.++..|+||+.+
T Consensus       155 ~~~~~~~~~~~~~~~~ipvi~~gGi---------------~~--~~~~~~~~~~gAdgv~v  198 (200)
T cd04722         155 VPIADLLLILAKRGSKVPVIAGGGI---------------ND--PEDAAEALALGADGVIV  198 (200)
T ss_pred             CCHHHHHHHHHHHHCCCCEEEECCC---------------CC--HHHHHHHHHCCCCEEEE
T ss_conf             6116899999998579998997587---------------99--99999999859988981


No 127
>PRK08104 consensus
Probab=77.92  E-value=6.3  Score=20.43  Aligned_cols=113  Identities=19%  Similarity=0.139  Sum_probs=84.1

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEEEE-ECCCHHHHHH
Q ss_conf             34999999999999999655339970660155768866632224567124888999886652-876885-2288999987
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPILT-DVHTEQQCEA  130 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv~T-eV~~~~~~e~  130 (301)
                      .+++.+++..+++.+.+-|.+..         .       -.+|.+   .+++.+++++++| ++-|-. -|.+.+|++.
T Consensus        22 r~~~~~~a~~la~al~~gGi~~i---------E-------iTlrt~---~a~~~I~~l~~~~p~~~vGaGTV~~~e~~~~   82 (212)
T PRK08104         22 VINKLEHAVPLAKALVAGGVRVL---------E-------VTLRTP---CALEAIRAIAKEVPEAIVGAGTVLNPQQLAE   82 (212)
T ss_pred             ECCCHHHHHHHHHHHHHCCCCEE---------E-------EECCCC---HHHHHHHHHHHHCCCCEEEEEECCCHHHHHH
T ss_conf             77999999999999998799889---------9-------968881---4999999999868985685420267999999


Q ss_pred             HHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             650-2157882257628999999985059779983677789999999999997258780899514
Q gi|254780669|r  131 IAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       131 ~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      +.+ .++.+=-|-   -+.++++.+.+.+.|+.   +=-+||.|...|.+    .|.+-+-+---
T Consensus        83 ai~aGA~FiVSP~---~~~~v~~~a~~~~i~~i---PGv~TpsEi~~A~~----~G~~~vKlFPA  137 (212)
T PRK08104         83 VTEAGAQFAISPG---LTEELLKAATEGTIPLI---PGISTVSELMLGMD----YGLTEFKFFPA  137 (212)
T ss_pred             HHHCCCCEEECCC---CCHHHHHHHHHCCCCEE---CCCCCHHHHHHHHH----CCCCEEEECCC
T ss_conf             9985999998489---99999999998299765---67699999999998----79997997876


No 128
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases. TBP aldolase is a tetrameric class II aldolase that catalyzes the reversible condensation of dihydroxyacetone phosphate with glyceraldehyde 3-phsophate to produce tagatose 1,6-bisphosphate. There is an absolute requirement for a divalent metal ion, usually zinc, and in addition the enzymes are activated by monovalent cations such as Na+. The type A and type B Class II FBPA's differ in the presence and absence of distinct indels in the sequence that result in differing loop lengths in the structures.
Probab=77.89  E-value=6.3  Score=20.43  Aligned_cols=174  Identities=18%  Similarity=0.260  Sum_probs=88.2

Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCC-----E
Q ss_conf             99999996553399706601557688666322245671248889998866528768852288999987650215-----7
Q gi|254780669|r   63 IAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD-----I  137 (301)
Q Consensus        63 ~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vD-----i  137 (301)
                      +++.+.+...+...+.|.--        |+...+-.|++.--.+++.+.+++.+||.--.-+....|.+.+.+|     |
T Consensus        25 ~~~avi~AAee~~sPvIlq~--------s~~~~~~~g~~~~~~~~~~~a~~~~VPV~lHLDH~~~~e~i~~ai~~Gf~SV   96 (276)
T cd00947          25 TLKAILEAAEETRSPVILQI--------SEGAIKYAGLELLVAMVKAAAERASVPVALHLDHGSSFELIKRAIRAGFSSV   96 (276)
T ss_pred             HHHHHHHHHHHHCCCEEEEC--------CHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEE
T ss_conf             99999999999689999997--------8617765899999999999999779999996687678999999998399879


Q ss_pred             EEECH-----HHCCCHHHHHHHH-HCCCEEE--------------EECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             88225-----7628999999985-0597799--------------83677789999999999997258780899514654
Q gi|254780669|r  138 LQIPA-----LLCRQTDLLTAAA-QTGRVIN--------------VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTS  197 (301)
Q Consensus       138 lQIgA-----~~~rqtdLl~a~a-~t~kpV~--------------iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~  197 (301)
                      .-=++     -|.+.|-=+.+.+ ..|..|=              -....+.+|++   |.+.+..+|. +.+..-=|+.
T Consensus        97 M~DgS~lp~eeNi~~T~~vv~~ah~~gv~VEaElG~vgg~ed~~~~~~~~~T~pee---a~~Fv~~Tgv-D~LAvaiGn~  172 (276)
T cd00947          97 MIDGSHLPFEENVAKTKEVVELAHAYGVSVEAELGRIGGEEDGVVGDEGLLTDPEE---AEEFVEETGV-DALAVAIGTS  172 (276)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCCCCCHHH---HHHHHHHHCC-CEEEEECCCC
T ss_conf             85289899999999999999999981984899864046756776665333489999---9999998598-8787641643


Q ss_pred             CC-CHH--HCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             44-010--0000001068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  198 FG-YNT--LVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       198 fg-y~~--lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      .| |..  -..||--+..+++ ...|.++   |     |+    ||=..    ..-+.++..|+.=+=+-|
T Consensus       173 HG~yk~~~p~L~~~~L~~I~~~~~vPLVl---H-----Gg----SG~~~----e~i~~ai~~Gi~KiNi~T  227 (276)
T cd00947         173 HGAYKGGEPKLDFDRLKEIAERVNVPLVL---H-----GG----SGIPD----EQIRKAIKLGVCKININT  227 (276)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHCCCCEEE---E-----CC----CCCCH----HHHHHHHHCCCEEEEECH
T ss_conf             44568999864889999999973998797---5-----79----99999----999999984975998673


No 129
>TIGR01358 DAHP_synth_II 3-deoxy-7-phosphoheptulonate synthase; InterPro: IPR002480   Members of the 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthetase family (2.5.1.54 from EC) catalyse the first step in aromatic amino acid biosynthesis from chorismate. Class I (see IPR006218 from INTERPRO) includes bacterial and yeast enzymes; class II includes higher plants and various microorganisms .   The first step in the common pathway leading to the biosynthesis of aromatic compounds is the stereospecific condensation of phosphoenolpyruvate (PEP) and D-erythrose-4-phosphate (E4P) giving rise to 3-deoxy-D-arabino-heptulosonate-7-phosphate (DAHP). This reaction is catalyzed by DAHP synthase, a metal-activated enzyme, which in microorganisms is the target for negative-feedback regulation by pathway intermediates or by end products.; GO: 0003849 3-deoxy-7-phosphoheptulonate synthase activity, 0009073 aromatic amino acid family biosynthetic process.
Probab=77.88  E-value=6.3  Score=20.43  Aligned_cols=59  Identities=20%  Similarity=0.293  Sum_probs=41.5

Q ss_pred             CCEEEECHHHCCCHH--HHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC-CEEEEEC
Q ss_conf             157882257628999--99998505977998367778999999999999725878-0899514
Q gi|254780669|r  135 VDILQIPALLCRQTD--LLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAK-DVLFCER  194 (301)
Q Consensus       135 vDilQIgA~~~rqtd--Ll~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~-~i~lcER  194 (301)
                      .-++|||-|. ||-|  =++=+....-||-||=|..+.|++.+.-+|.+.=...+ .+-|+.|
T Consensus       261 aH~lWIGeRT-RQlDGAHvEfl~gv~NPiGiKvGP~m~pd~ll~lie~LdP~~~PGRLtli~R  322 (450)
T TIGR01358       261 AHLLWIGERT-RQLDGAHVEFLRGVRNPIGIKVGPSMTPDELLRLIERLDPENEPGRLTLISR  322 (450)
T ss_pred             CCCCCCCCCC-CCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCEEEEEE
T ss_conf             5531136510-2134889999863368503653886668899988654077998963688883


No 130
>PRK09389 (R)-citramalate synthase; Provisional
Probab=77.39  E-value=6.5  Score=20.34  Aligned_cols=18  Identities=22%  Similarity=0.263  Sum_probs=8.5

Q ss_pred             CHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999996553
Q gi|254780669|r   56 SHDHAFMIAEKLYAICQS   73 (301)
Q Consensus        56 S~e~~~~~A~~lk~~~~~   73 (301)
                      |.++-+++|+.|.++|.+
T Consensus        21 s~eeKl~ia~~L~~lGv~   38 (487)
T PRK09389         21 TPEEKLEIARKLDELGVD   38 (487)
T ss_pred             CHHHHHHHHHHHHHCCCC
T ss_conf             999999999999976999


No 131
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=77.31  E-value=6.5  Score=20.32  Aligned_cols=47  Identities=15%  Similarity=0.227  Sum_probs=23.3

Q ss_pred             HHHHHHHH---CCCEEEEEC------CCCCCHHHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             99999850---597799836------7778999999999999725878089951465
Q gi|254780669|r  149 DLLTAAAQ---TGRVINVKK------GQFLSPWEMHNILQKLHAHGAKDVLFCERGT  196 (301)
Q Consensus       149 dLl~a~a~---t~kpV~iKk------gq~~s~~e~~~a~eki~~~Gn~~i~lcERG~  196 (301)
                      ++++++-+   -+-||-++=      .-.++++|+...++.+...|.+ .+-+-+|.
T Consensus       204 Eii~avr~~vg~d~~v~~Ris~~d~~~~G~~~~d~~~~~~~l~~~GvD-~i~vs~G~  259 (338)
T cd04733         204 EIYDAIRAAVGPGFPVGIKLNSADFQRGGFTEEDALEVVEALEEAGVD-LVELSGGT  259 (338)
T ss_pred             HHHHHHHHHHCCCCEEEEEECHHHHCCCCCCHHHHHHHHHHHHHCCCC-EEEECCCC
T ss_conf             999999997199886999845354247999989999999999876998-89946885


No 132
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit; InterPro: IPR001095 This entry contains the alpha subunit the acetyl coenzyme A carboxylase complex (). It catalyzes the first step in the synthesis of long-chain fatty acids which involves the carboxylation of acetyl-CoA to malonyl-CoA. The acetyl-CoA carboxylase complex () is a heterohexamer of biotin carboxyl carrier protein, biotin carboxylase and two non-identical carboxyl transferase subunits (alpha and beta) in a 2:2 association . The reaction involves two steps:  Biotin carrier protein + ATP + HCO_3^- -> Carboxybiotin carrier protein + ADP + P_i   Carboxybiotin carrier protein + Acetyl-CoA -> Malonyl-CoA + Biotin carrier protein ; GO: 0003989 acetyl-CoA carboxylase activity, 0006633 fatty acid biosynthetic process, 0009317 acetyl-CoA carboxylase complex.
Probab=77.01  E-value=1.8  Score=23.99  Aligned_cols=30  Identities=23%  Similarity=0.473  Sum_probs=23.8

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCH
Q ss_conf             663222456712488899988665287688522889
Q gi|254780669|r   90 SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTE  125 (301)
Q Consensus        90 tS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~  125 (301)
                      -.|.+||     |+|++++.+ ++|++||+|=|=++
T Consensus       140 P~P~GYR-----KALrLm~~A-erF~~PIi~fiDT~  169 (329)
T TIGR00513       140 PAPEGYR-----KALRLMKMA-ERFNLPIITFIDTP  169 (329)
T ss_pred             CCCCCHH-----HHHHHHHHH-HHCCCCEEEEECCC
T ss_conf             8796047-----999999877-76179858865388


No 133
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional
Probab=77.00  E-value=6.6  Score=20.27  Aligned_cols=217  Identities=21%  Similarity=0.283  Sum_probs=115.4

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEE------CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-970660------1557688666322245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYK------SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK------~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv  118 (301)
                      .+.||   --+.|..+++++.+.+.|+++. +|.=|-      |..-+|+.-+.  -.|..+++.+++++++|++.+.|+
T Consensus        14 y~taG---~P~~e~~~~~~~~l~~~Gad~iEiGiPfSDP~aDGpvIq~a~~~AL--~~G~~~~~~f~~~~~~r~~~~~pi   88 (256)
T PRK13111         14 YITAG---DPDLETSLEILKALVEAGADIIELGIPFSDPVADGPVIQRASLRAL--AAGVTLADVLELLREIRAKPTIPI   88 (256)
T ss_pred             EEECC---CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             87070---8998999999999996599999978887887665799999999999--779969999999999860689988


Q ss_pred             EEECC--------CHHHHHHHHHH-CCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             85228--------89999876502-1578822576289-999999850597-7998367778999999999999725878
Q gi|254780669|r  119 LTDVH--------TEQQCEAIADS-VDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       119 ~TeV~--------~~~~~e~~~~~-vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      +-=--        ...-++.+++. +|-+=||---... .++.+++.+.+. +|.+=-+  .++++.+   +.+.+....
T Consensus        89 vlM~Y~N~i~~~G~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~gi~~I~lvaP--tt~~~Ri---~~i~~~s~g  163 (256)
T PRK13111         89 VLMTYYNPIFQYGVEAFAADAAEAGVDGLIIPDLPPEEAEEFRAAAKKHGIDLIFLVAP--TTTDERL---KKIASHASG  163 (256)
T ss_pred             EEEEECCHHHHHCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCEEEEEECC--CCCHHHH---HHHHHHCCC
T ss_conf             99850308987099999999997599779816999788899999999759808999699--9988999---999962698


Q ss_pred             CEEE-EECCCCCCCHH-HCCCC-CCCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             0899-51465444010-00000-010688851-87168711777421223453212638899999999997189889998
Q gi|254780669|r  188 DVLF-CERGTSFGYNT-LVTDM-RSIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       188 ~i~l-cERG~~fgy~~-lvvD~-~~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      =|.+ .-.|+| |-++ +-.++ ..+..+|+. ..||++---=|             .++-+.     .+.-++||+.+=
T Consensus       164 fiY~vs~~GvT-G~~~~~~~~~~~~i~~ik~~t~~Pi~vGFGIs-------------~~e~v~-----~~~~~aDGvIVG  224 (256)
T PRK13111        164 FVYYVSRAGVT-GARSADAADVADLLARLKAHTDLPVAVGFGIS-------------TPEQAA-----AIAEGADGVIVG  224 (256)
T ss_pred             EEEEEECCCCC-CCCCCCHHHHHHHHHHHHHCCCCCEEEECCCC-------------CHHHHH-----HHHCCCCEEEEC
T ss_conf             59998567767-88766628899999999870689758852889-------------999999-----997459999986


Q ss_pred             ECCCHHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             369833479782018688999999999999
Q gi|254780669|r  264 THQDPDNAPSDGPNMINIKDLPKLLSQLLA  293 (301)
Q Consensus       264 ~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~  293 (301)
                      ++---.-+.+|..+  .++.+.+++++++.
T Consensus       225 Saiv~~i~~~~~~~--~~~~v~~f~~~lk~  252 (256)
T PRK13111        225 SALVKIIEAADPEE--ALAALAEFVKELKA  252 (256)
T ss_pred             HHHHHHHHHCCHHH--HHHHHHHHHHHHHH
T ss_conf             89999998439777--89999999999999


No 134
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively.
Probab=76.87  E-value=6.7  Score=20.24  Aligned_cols=133  Identities=19%  Similarity=0.230  Sum_probs=70.7

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCE-EEECCCCCCC------C---C-----CCCCCCCCCCHHHHHHH
Q ss_conf             706999548634999999999999999655339970-6601557688------6---6-----63222456712488899
Q gi|254780669|r   43 QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGL-VYKSSFDKAN------R---S-----SLAGKRGVGLKKGREIF  107 (301)
Q Consensus        43 ~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~-ifK~sfdKan------R---t-----S~~sfrG~Gle~gL~il  107 (301)
                      +|+.+=|||-. .+.|++..+++    .    ..|+ ..|..+.++-      |   .     +-.+|.-.|++.-++.+
T Consensus        10 NPi~~AaG~~~-~~~e~~~~l~~----~----G~G~v~~kTit~~p~~GNp~PR~~r~~~~~iN~~G~~n~G~~~~~~~l   80 (294)
T cd04741          10 PPLMNAAGPWC-TTLEDLLELAA----S----STGAVTTRSSTLAGRPGNPEPRYYAFPLGSINSLGLPNLGLDYYLEYI   80 (294)
T ss_pred             CCCEECCCCCC-CCHHHHHHHHH----C----CCEEEEECCCCCCCCCCCCCCEEEECCCHHHHHCCCCCCCHHHHHHHH
T ss_conf             97887458999-99999999997----6----960999284387677799998488555146664447884889999999


Q ss_pred             HHHHHH---HCCEEEEECCC--HHHHHHHH-------HHCCEEEECHHHCC----------CH----HHHHHHHH-CCCE
Q ss_conf             988665---28768852288--99998765-------02157882257628----------99----99999850-5977
Q gi|254780669|r  108 RDLKKK---YGFPILTDVHT--EQQCEAIA-------DSVDILQIPALLCR----------QT----DLLTAAAQ-TGRV  160 (301)
Q Consensus       108 ~e~k~~---~glpv~TeV~~--~~~~e~~~-------~~vDilQIgA~~~r----------qt----dLl~a~a~-t~kp  160 (301)
                      +++++.   .+.|++.-+..  .+..+.++       .++|.+-+-- -|-          +.    ++++++.+ +.+|
T Consensus        81 ~~~~~~~~~~~~pvi~si~g~~~d~~~~~~~~~~~~~~~aD~ielNi-ScPn~~g~~~~~~~~~~~~~~~~~v~~~~~~P  159 (294)
T cd04741          81 RTISDGLPGSAKPFFISVTGSAEDIAAMYKKIAAHQKQFPLAMELNL-SCPNVPGKPPPAYDFDATLEYLTAVKAAYSIP  159 (294)
T ss_pred             HHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEE-CCCCCCCCHHHCCCHHHHHHHHHHHHHCCCCC
T ss_conf             99865465558708998999836799999999865225564799970-37898873100139999999999998415785


Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHCC
Q ss_conf             9983677789999999999997258
Q gi|254780669|r  161 INVKKGQFLSPWEMHNILQKLHAHG  185 (301)
Q Consensus       161 V~iKkgq~~s~~e~~~a~eki~~~G  185 (301)
                      |.+|=..+.+..++..+++-+.+..
T Consensus       160 v~vKlsP~~~~~~~~~~~~~~~~~~  184 (294)
T cd04741         160 VGVKTPPYTDPAQFDTLAEALNAFA  184 (294)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCC
T ss_conf             5997289888789999999986578


No 135
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism]
Probab=76.68  E-value=5.3  Score=20.90  Aligned_cols=170  Identities=18%  Similarity=0.188  Sum_probs=103.3

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHHH-CC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--22889999876502-15
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIADS-VD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~~-vD  136 (301)
                      ..++|+...+.|+...     --      =|-+..|+|.     ++.|+.++....+||+-  =+-++.|+..+..+ +|
T Consensus        68 p~~ia~~Ye~~GAa~i-----SV------LTd~~~F~Gs-----~e~L~~v~~~v~~PvL~KDFiiD~yQI~~Ar~~GAD  131 (254)
T COG0134          68 PVEIAKAYEEGGAAAI-----SV------LTDPKYFQGS-----FEDLRAVRAAVDLPVLRKDFIIDPYQIYEARAAGAD  131 (254)
T ss_pred             HHHHHHHHHHHCCEEE-----EE------ECCCCCCCCC-----HHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHCCCC
T ss_conf             9999999997398489-----99------6376646987-----899999998558982644677889999999980856


Q ss_pred             EEEECHHHCCC---HHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH
Q ss_conf             78822576289---999999850597799836777899999999999972587808995146544401000000010688
Q gi|254780669|r  137 ILQIPALLCRQ---TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM  213 (301)
Q Consensus       137 ilQIgA~~~rq---tdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l  213 (301)
                      .+.+.+.-.-+   -+|+..+.+-|--+++-=+   +.+|+.-|.    ..|.+=|-+--|.    +.++-+|+.....+
T Consensus       132 avLLI~~~L~~~~l~el~~~A~~LGm~~LVEVh---~~eEl~rAl----~~ga~iIGINnRd----L~tf~vdl~~t~~l  200 (254)
T COG0134         132 AVLLIVAALDDEQLEELVDRAHELGMEVLVEVH---NEEELERAL----KLGAKIIGINNRD----LTTLEVDLETTEKL  200 (254)
T ss_pred             CHHHHHHHCCHHHHHHHHHHHHHCCCCEEEEEC---CHHHHHHHH----HCCCCEEEEECCC----CCHHEECHHHHHHH
T ss_conf             199999963999999999999976992389978---999999999----6799889983788----40210068899998


Q ss_pred             HHHCCC-EEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE----CCCHHHC
Q ss_conf             851871-687117774212234532126388999999999971898899983----6983347
Q gi|254780669|r  214 TSMGVP-VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET----HQDPDNA  271 (301)
Q Consensus       214 k~~~~P-Vi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~----Hp~P~~A  271 (301)
                      -.. .| =.+=.|-|       |  . ...+-+..    ....|+||++|-+    ++||.+|
T Consensus       201 a~~-~p~~~~~IsES-------G--I-~~~~dv~~----l~~~ga~a~LVG~slM~~~~~~~a  248 (254)
T COG0134         201 APL-IPKDVILISES-------G--I-STPEDVRR----LAKAGADAFLVGEALMRADDPEEA  248 (254)
T ss_pred             HHH-CCCCCEEEECC-------C--C-CCHHHHHH----HHHCCCCEEEECHHHHCCCCHHHH
T ss_conf             844-87775899617-------9--8-99999999----997489989963888569998999


No 136
>PRK02048 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional
Probab=76.37  E-value=6.9  Score=20.16  Aligned_cols=116  Identities=12%  Similarity=0.206  Sum_probs=70.5

Q ss_pred             CCCEEEECCCCCCEEECCCCCEEEEECCCCCCCHH--HHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             17706835787727976997069995486349999--9999999999965533997066015576886663222456712
Q gi|254780669|r   24 TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHD--HAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK  101 (301)
Q Consensus        24 ~~~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e--~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle  101 (301)
                      ..+.|.+    |+|.+||++|..+ ---+.-.+.+  ...+-...|.+.|..+-             |-+..+.      
T Consensus        10 ~Tr~V~v----G~v~iGg~~Pi~v-QSMt~t~T~d~~atv~Qi~~l~~aGceiV-------------Rvtvp~~------   65 (613)
T PRK02048         10 ETSEVNI----GATPLGGPNPIRI-QSMTNTSTMDTEACVAQAKRIIDAGGEYV-------------RLTTQGV------   65 (613)
T ss_pred             CCEEEEE----CCCCCCCCCCEEE-EECCCCCCCCHHHHHHHHHHHHHCCCCEE-------------EECCCCH------
T ss_conf             6547898----6965579996766-64699986158999999999998599989-------------9888999------


Q ss_pred             HHHHHHHHHHHH-----HCCEEEEECCCHHHHH-HHHHHCCEEEECHHHCCC--------------------------HH
Q ss_conf             488899988665-----2876885228899998-765021578822576289--------------------------99
Q gi|254780669|r  102 KGREIFRDLKKK-----YGFPILTDVHTEQQCE-AIADSVDILQIPALLCRQ--------------------------TD  149 (301)
Q Consensus       102 ~gL~il~e~k~~-----~glpv~TeV~~~~~~e-~~~~~vDilQIgA~~~rq--------------------------td  149 (301)
                      +.-+-|+++|++     +.+|++.|||-...+. .+++.+|-+.|--=|.-+                          ..
T Consensus        66 ~~a~al~~I~~~l~~~~~~iPlvADIHF~~~~A~~a~~~~~kvRINPGN~~~~~~~~~~~~~~~~~~~~~~~~i~e~~~p  145 (613)
T PRK02048         66 REAENLMNINIGLRSQGYMVPLVADVHFNPKVADVAAQYAEKVRINPGNYVDPGRTFKKLEYTDEEYAAEIQKIRERFVP  145 (613)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99984999999986279989879732788799999998538687889977666555332222067788888989998899


Q ss_pred             HHHHHHHCCCEEEE
Q ss_conf             99998505977998
Q gi|254780669|r  150 LLTAAAQTGRVINV  163 (301)
Q Consensus       150 Ll~a~a~t~kpV~i  163 (301)
                      |++++.+.++|+-|
T Consensus       146 ~v~~~k~~~~~iRI  159 (613)
T PRK02048        146 FLNICKENHTAIRI  159 (613)
T ss_pred             HHHHHHHCCCCEEE
T ss_conf             99999976997798


No 137
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain. YqjM is involved in the oxidative stress response of Bacillus subtilis.  Like the other OYE members, each monomer of YqjM contains FMN as a non-covalently bound cofactor and uses NADPH as a reducing agent.   The YqjM enzyme exists as a homotetramer that is assembled as a dimer of catalytically dependent dimers, while other OYE members exist only as monomers or dimers. Moreover, the protein displays a shared active site architecture where an arginine finger at the COOH terminus of one monomer extends into the active site of the adjacent monomer and is directly involved in substrate recognition. Another remarkable difference in the binding of the ligand in YqjM is represented by the contribution of the NH2-terminal tyrosine instead of a COOH-terminal tyrosine in OYE and its homologs.
Probab=75.96  E-value=7.1  Score=20.08  Aligned_cols=44  Identities=9%  Similarity=0.064  Sum_probs=28.7

Q ss_pred             HHHHHHHH---CCCEEEEECC------CCCCHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             99999850---5977998367------77899999999999972587808995
Q gi|254780669|r  149 DLLTAAAQ---TGRVINVKKG------QFLSPWEMHNILQKLHAHGAKDVLFC  192 (301)
Q Consensus       149 dLl~a~a~---t~kpV~iKkg------q~~s~~e~~~a~eki~~~Gn~~i~lc  192 (301)
                      +.++++.+   .+.||.+|=.      -..+++|++..+..+...|-+=+-+.
T Consensus       209 Eii~aVr~~vg~d~~vgvRis~~d~~~~g~~~~e~~~~a~~l~~~gvd~i~vs  261 (336)
T cd02932         209 EVVDAVRAVWPEDKPLFVRISATDWVEGGWDLEDSVELAKALKELGVDLIDVS  261 (336)
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             99999999839988706896452357899899999999999997599789955


No 138
>PRK13114 consensus
Probab=75.93  E-value=7.1  Score=20.08  Aligned_cols=217  Identities=12%  Similarity=0.118  Sum_probs=110.6

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCE
Q ss_conf             999548634999999999999999655339-9706601------55768866632224567124888999886652-876
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFP  117 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glp  117 (301)
                      ++.||=   -+.|...++.+.+.+.|+++. +|.-|.-      ..-+|+.-+.  -.|..+++.+++++++++++ +.|
T Consensus        18 yitaG~---P~~~~t~~~i~~l~~~GaDiiEiGiPFSDP~ADGpvIq~A~~rAL--~~G~~l~~~f~~v~~~r~~~~~~P   92 (266)
T PRK13114         18 FITGGD---PTPGDTAANLDALVAGGADVIELGMPFTDPMADGPAIQAANLRSL--AAGTTTADIFRIAAEFRQRHPEVP   92 (266)
T ss_pred             EECCCC---CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             870718---998999999999997699999979998886776899999999999--869979999999999874189988


Q ss_pred             EEE--ECCC-----H-HHHHHHHHH-CCEEEECHHHCC-CHHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             885--2288-----9-999876502-157882257628-9999999850597-799836777899999999999972587
Q gi|254780669|r  118 ILT--DVHT-----E-QQCEAIADS-VDILQIPALLCR-QTDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       118 v~T--eV~~-----~-~~~e~~~~~-vDilQIgA~~~r-qtdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn  186 (301)
                      ++-  =...     . .-++.+++. +|-+=||----. ..++..++.+.+. +|.+=-+  .|.++++   +++.+...
T Consensus        93 ivlM~Y~N~i~~~G~~~F~~~~~~aGvdG~IipDLP~eE~~~~~~~~~~~gi~~I~liaP--tt~~~Ri---~~i~~~a~  167 (266)
T PRK13114         93 LVLMGYANPMVRRGPDWFAAECKKAGVDGVICVDIPPEEDAELGPALRAAGIDPIRLATP--TTDAARL---PAVLEGAS  167 (266)
T ss_pred             EEEEEEHHHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEECC--CCCHHHH---HHHHHHCC
T ss_conf             799863019998649999999997499779845899788899999999749972677569--9979999---99997389


Q ss_pred             C-CEEEEECCCCCCCHHH-CCCC-CCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             8-0899514654440100-0000-01068885-18716871177742122345321263889999999999718988999
Q gi|254780669|r  187 K-DVLFCERGTSFGYNTL-VTDM-RSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       187 ~-~i~lcERG~~fgy~~l-vvD~-~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                      . =..+.-+|+| |.++. ..++ ..+..+|+ +.+||++---=|             .++-+.     .+...+||+.+
T Consensus       168 gFiY~vs~~GvT-G~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~~~-----~~~~~ADGvIV  228 (266)
T PRK13114        168 GFLYYVSVAGIT-GMQQAAQASIEAAVARIKAATDLPVAVGFGVR-------------TPEQAA-----AIARVADGVVV  228 (266)
T ss_pred             CCEEEEECCCCC-CCCCCCHHHHHHHHHHHHHHCCCCEEEECCCC-------------CHHHHH-----HHHHCCCEEEE
T ss_conf             958998445566-77656658899999999970799869983669-------------899999-----99800999998


Q ss_pred             EECCCH--HHCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             836983--3479782018688999999999999999
Q gi|254780669|r  263 ETHQDP--DNAPSDGPNMINIKDLPKLLSQLLAIDK  296 (301)
Q Consensus       263 E~Hp~P--~~AlsD~~q~l~l~~l~~ll~~l~~i~~  296 (301)
                      =+.---  ++...|+.     ..++++.++|+.--+
T Consensus       229 GSaiVk~I~e~~~~~~-----~~v~~~~k~l~~~i~  259 (266)
T PRK13114        229 GSAFVDLIGEHGADAA-----APVEELTKTLADAIH  259 (266)
T ss_pred             CHHHHHHHHHCCCCHH-----HHHHHHHHHHHHHHH
T ss_conf             1999999987371556-----899999999999999


No 139
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=75.86  E-value=7.1  Score=20.07  Aligned_cols=157  Identities=15%  Similarity=0.107  Sum_probs=101.0

Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH----CCEEE-EECCCHHHH
Q ss_conf             4999999999999999655339970660155768866632224567124888999886652----87688-522889999
Q gi|254780669|r   54 IESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY----GFPIL-TDVHTEQQC  128 (301)
Q Consensus        54 iES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~----glpv~-TeV~~~~~~  128 (301)
                      .++.+++..+++.|.+-|.+..                =-.+|.+   .+++.+++++++|    ++-|- --|.+++|+
T Consensus        21 ~~~~~~a~~~~~al~~gGi~~i----------------EITl~tp---~a~~~i~~l~~~~~~~p~~~iGaGTV~~~e~~   81 (209)
T PRK06552         21 GESKEEALKISLAVIKGGIKAI----------------EVTYTNP---FASEVIKELVERYKDDPEVLIGAGTVLDAVTA   81 (209)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEE----------------EEECCCC---CHHHHHHHHHHHHCCCCCEEEEEECCCCHHHH
T ss_conf             2899999999999998799889----------------9967897---59999999999817799818988727489999


Q ss_pred             HHHHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCC
Q ss_conf             87650-21578822576289999999850597799836777899999999999972587808995146544401000000
Q gi|254780669|r  129 EAIAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM  207 (301)
Q Consensus       129 e~~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~  207 (301)
                      +.+.+ .+|.+=-|.   -+.++++++.+.+.|+.   +=-+||.|...|.+    .|.+-+-+-.- ..+         
T Consensus        82 ~~a~~aGA~FiVSP~---~~~~v~~~a~~~~i~~i---PG~~TpsEi~~A~~----~Ga~~vKlFPA-~~~---------  141 (209)
T PRK06552         82 RQAILAGAQFIVSPS---FNRETAKICNRYQIPYL---PGCMTVTEIVTALE----AGVDIVKLFPG-STV---------  141 (209)
T ss_pred             HHHHHCCCCEEECCC---CCHHHHHHHHHCCCCEE---CCCCCHHHHHHHHH----CCCCEEEECCH-HHC---------
T ss_conf             999985998897699---98999999998599641---79799999999998----69995885833-324---------


Q ss_pred             CCCHHHHHHC--CC-EEECHHHHHHHCCCCCCCCCCCHHHHHHHHHH-HHHHCCCEEEE
Q ss_conf             0106888518--71-68711777421223453212638899999999-99718988999
Q gi|254780669|r  208 RSIPIMTSMG--VP-VIFDASHSVQQPGIHGNCSGGERQYIVPLAKA-AVAIGIAGIFL  262 (301)
Q Consensus       208 ~~i~~lk~~~--~P-Vi~D~SHs~q~p~~~~~~~gG~r~~v~~la~a-a~a~G~dGlfi  262 (301)
                       +...+|...  +| +=+=||-.+            ..+-+...-++ +.++|+-|-++
T Consensus       142 -G~~yikal~~p~p~~~~~ptGGV------------~~~N~~~~l~aG~~~vgvGs~l~  187 (209)
T PRK06552        142 -GPSFISAIKGPLPQVNIMVTGGV------------SLDNVKDWFAAGADAVGIGGELN  187 (209)
T ss_pred             -CHHHHHHHHCCCCCCCEEECCCC------------CHHHHHHHHHCCCCEEEECHHHC
T ss_conf             -89999998664899928863899------------98889999987998899865770


No 140
>PRK08064 cystathionine beta-lyase; Provisional
Probab=75.77  E-value=5.7  Score=20.71  Aligned_cols=19  Identities=5%  Similarity=0.230  Sum_probs=9.7

Q ss_pred             CCCHHHHHHHHHHHHHHHH
Q ss_conf             8688999999999999999
Q gi|254780669|r  278 MINIKDLPKLLSQLLAIDK  296 (301)
Q Consensus       278 ~l~l~~l~~ll~~l~~i~~  296 (301)
                      .+-+++.++|+.+|.+==+
T Consensus       363 SvGlE~~~DLi~DL~qAL~  381 (390)
T PRK08064        363 SVGLENVDDLIADFEQALS  381 (390)
T ss_pred             EECCCCHHHHHHHHHHHHH
T ss_conf             9600899999999999999


No 141
>pfam04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase. This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilisation pathway found mainly in pathogenic bacteria.
Probab=74.81  E-value=7.6  Score=19.89  Aligned_cols=137  Identities=20%  Similarity=0.232  Sum_probs=57.1

Q ss_pred             HHHHHHHHHHHHCCEEEEECC------------CHHHHHHHHH-HCCEEEECHHHCCC----HHHHHHHHHCCCEEEEEC
Q ss_conf             888999886652876885228------------8999987650-21578822576289----999999850597799836
Q gi|254780669|r  103 GREIFRDLKKKYGFPILTDVH------------TEQQCEAIAD-SVDILQIPALLCRQ----TDLLTAAAQTGRVINVKK  165 (301)
Q Consensus       103 gL~il~e~k~~~glpv~TeV~------------~~~~~e~~~~-~vDilQIgA~~~rq----tdLl~a~a~t~kpV~iKk  165 (301)
                      |++-.+.+|+..++||+-=+-            ..++++.+.+ .+||+-+-|-+-..    -+|++++-+.+.+++-  
T Consensus        20 ~~~dI~aik~~v~vPIIGi~K~~~~~~~VyITPt~~ev~~l~~aGadiIA~DaT~R~RP~~~~~lv~~i~~~~~l~MA--   97 (192)
T pfam04131        20 GVNNIKAIRAIVDLPIIGIVKRDLPDSPVRITPTMKDIDELANAGADIIALDGTDRPRPVDIESFIKRIKEKGQLAMA--   97 (192)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCCCEECCCHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCEEEE--
T ss_conf             999999999858998799985678999816558899999999859999998467898975899999999981998899--


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHH
Q ss_conf             77789999999999997258780899514654440100000001068885187168711777421223453212638899
Q gi|254780669|r  166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYI  245 (301)
Q Consensus       166 gq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v  245 (301)
                       --.+.+|.+.|.    ..|.+=|--|-+|.+-....--.||.-+..+.+.+.|||..-                 |-.-
T Consensus        98 -D~st~eea~~A~----~~G~D~I~TTL~GYT~~t~~~~pD~~ll~~l~~~~~pvIaEG-----------------ri~t  155 (192)
T pfam04131        98 -DCSTFEEGLNAH----KLGVDIVGTTLSGYTGGSNPAEPDFQLVKTLSEAGCFVIAEG-----------------RYNT  155 (192)
T ss_pred             -ECCCHHHHHHHH----HCCCCEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEC-----------------CCCC
T ss_conf             -749999999999----859999982325578999999997899999986899399857-----------------9899


Q ss_pred             HHHHHHHHHHCCCEEEEE
Q ss_conf             999999997189889998
Q gi|254780669|r  246 VPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       246 ~~la~aa~a~G~dGlfiE  263 (301)
                      |..++.|+.+|++.+-+-
T Consensus       156 Pe~a~~a~~~GA~aVVVG  173 (192)
T pfam04131       156 PELAKKAIEIGADAVTVG  173 (192)
T ss_pred             HHHHHHHHHCCCCEEEEC
T ss_conf             999999998399899989


No 142
>pfam01180 DHO_dh Dihydroorotate dehydrogenase.
Probab=73.97  E-value=7.9  Score=19.76  Aligned_cols=147  Identities=18%  Similarity=0.132  Sum_probs=74.8

Q ss_pred             EEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCE-EEECCCCCC---C---C------C--CCCCCCCCCCH
Q ss_conf             797699706999548634999999999999999655339970-660155768---8---6------6--63222456712
Q gi|254780669|r   37 VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGL-VYKSSFDKA---N---R------S--SLAGKRGVGLK  101 (301)
Q Consensus        37 i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~-ifK~sfdKa---n---R------t--S~~sfrG~Gle  101 (301)
                      ++|-  +|+.+=|||.. .+++.....+..        ..|+ +.|+.+.++   |   |      .  +-.+|..+|++
T Consensus         9 l~~~--nPi~lAsG~~~-~~~~~~~~~~~~--------g~G~vv~ktit~~~~~gnp~Pr~~~~~~~~~n~~G~~n~g~~   77 (290)
T pfam01180         9 LKFK--NPIGLASGFDK-FGEEALKWLALG--------KFGAIEIKSVTPEPQPGNPTPRVFRLPEGVLNAMGLNNPGLD   77 (290)
T ss_pred             EECC--CCCEECCCCCC-CCHHHHHHHHCC--------CCCEEEECCCCCCCCCCCCCCEEEECCCHHHHHCCCCCCHHH
T ss_conf             8879--98788867688-869999998718--------967799483485626699987799837014421565773079


Q ss_pred             HHHHHHHHHHHHH--CCEEEEECCC---HH---HHHHHHHHCCEEEE---------CHHHCCCHHHHHHHHH-----CCC
Q ss_conf             4888999886652--8768852288---99---99876502157882---------2576289999999850-----597
Q gi|254780669|r  102 KGREIFRDLKKKY--GFPILTDVHT---EQ---QCEAIADSVDILQI---------PALLCRQTDLLTAAAQ-----TGR  159 (301)
Q Consensus       102 ~gL~il~e~k~~~--glpv~TeV~~---~~---~~e~~~~~vDilQI---------gA~~~rqtdLl~a~a~-----t~k  159 (301)
                      .-++-+.+.++++  .+||+.-+..   .+   -++.+.+++|.+-+         +.-..++.++...+.+     +++
T Consensus        78 ~~~~~~~~~~~~~~~~~~vi~si~g~~~~d~~~~~~~~~~~ad~iElNiScPn~~~~~~~~~~~~~~~~i~~~v~~~~~~  157 (290)
T pfam01180        78 AVLEELLKRRKEYPRPLGIILSKAGSTVEDYVEVARKIGPFADYLELNVSCPNTPGLRALQTDPELAAILLKVVKEVSKV  157 (290)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCEEEEEEECCCCCCCHHHCCCHHHHHHHHHHHHHCCCC
T ss_conf             99999998777538885378624669999999999999743588999985368876133404298999999998750478


Q ss_pred             EEEEECCCCCCH-HHHHHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             799836777899-99999999997258780899514654
Q gi|254780669|r  160 VINVKKGQFLSP-WEMHNILQKLHAHGAKDVLFCERGTS  197 (301)
Q Consensus       160 pV~iKkgq~~s~-~e~~~a~eki~~~Gn~~i~lcERG~~  197 (301)
                      ||.+|=+...+- .+...+++.   .|...|-.+-+..+
T Consensus       158 Pv~vKlsp~~~~~~~~~~a~~~---~~a~gv~gi~~~nt  193 (290)
T pfam01180       158 PVLVKLAPDLTDIVIIDIADVA---AGEDGLTGINATNT  193 (290)
T ss_pred             CEEEEECCCCCCHHHHHHHHHH---CCCCCEEEEEECCC
T ss_conf             7389838987746899999997---18377689996587


No 143
>PRK11858 aksA trans-homoaconitate synthase; Reviewed
Probab=73.09  E-value=8.3  Score=19.62  Aligned_cols=175  Identities=17%  Similarity=0.191  Sum_probs=83.6

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH-HCCEEEEEC-CCHHHH
Q ss_conf             863499999999999999965533997066015576886663222456712488899988665-287688522-889999
Q gi|254780669|r   51 PCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKK-YGFPILTDV-HTEQQC  128 (301)
Q Consensus        51 PCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~-~glpv~TeV-~~~~~~  128 (301)
                      |...=|.++-.++|+.|.++|.+..=.|     |+   ..|..         -.+..+.+.+. ....+++=. ....++
T Consensus        19 ~g~~fs~~~K~~ia~~L~~~GV~~IEvG-----~P---~~~~~---------e~~~~~~i~~~~l~~~i~~~~R~~~~di   81 (378)
T PRK11858         19 PGVVFTNEEKLAIARMLDEIGVDQIEAG-----FP---AVSED---------EKEAIKAIAKLGLNASILAWNRAVKSDI   81 (378)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEEE-----CC---CCCCC---------HHHHHHHHHHCCCCCEEEEECCCCHHHH
T ss_conf             9999999999999999998198999994-----77---77834---------8999999985679845887403578779


Q ss_pred             HHHHHH-CCEEEECHHHC-----C-----C-------HHHHHHHHHCCCEE--EEECCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             876502-15788225762-----8-----9-------99999985059779--983677789999999999997258780
Q gi|254780669|r  129 EAIADS-VDILQIPALLC-----R-----Q-------TDLLTAAAQTGRVI--NVKKGQFLSPWEMHNILQKLHAHGAKD  188 (301)
Q Consensus       129 e~~~~~-vDilQIgA~~~-----r-----q-------tdLl~a~a~t~kpV--~iKkgq~~s~~e~~~a~eki~~~Gn~~  188 (301)
                      +.+.+. +|.+.|..-..     .     -       .+.+..+.+.|..|  ...-..-.+++.....++...+.|.+.
T Consensus        82 ~~a~~~g~~~v~i~~~~Sd~h~~~~l~~t~~e~l~~~~~~v~~Ak~~Gl~v~f~~eD~~r~~~~~l~~~~~~a~~~Gad~  161 (378)
T PRK11858         82 DASIDCGVDAVHIFIATSDIHLKYKLKKTREEVLERLVEAVEYAKDHGLYVSFSAEDASRTDLDFLIEAAKAAEEAGADR  161 (378)
T ss_pred             HHHHHCCCCEEEEEECCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCE
T ss_conf             99985796989999606799999996899899999999999999976986999440125689999999999999749989


Q ss_pred             EEEEEC-CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEE
Q ss_conf             899514-654440100000001068885-187168711777421223453212638899999999997189889
Q gi|254780669|r  189 VLFCER-GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI  260 (301)
Q Consensus       189 i~lcER-G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGl  260 (301)
                      |.+|.- |......  +  ..-+-.+++ .+.|+-+- .|             -++-+...-+.+|+.+|++-+
T Consensus       162 I~l~DT~G~~~P~~--v--~~~v~~l~~~~~~~i~~H-~H-------------Nd~GlAvANalaAv~AGa~~v  217 (378)
T PRK11858        162 VRFCDTVGILDPFT--M--YELVKELVEAVDIPIEVH-CH-------------NDFGMATANAIAGIEAGATQV  217 (378)
T ss_pred             EEECCCCCCCCHHH--H--HHHHHHHHHHCCCCEEEE-EE-------------CCCCHHHHHHHHHHHHCCCEE
T ss_conf             99636556669999--9--999999997269855999-70-------------775559999999998099989


No 144
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain.  FCB2 (AKA L-lactate:cytochrome c oxidoreductase) is a respiratory enzyme located in the intermembrane space of fungal mitochondria which catalyzes the oxidation of L-lactate to pyruvate. FCB2 also participates in a short electron-transport chain involving cytochrome c and cytochrome oxidase which ultimately directs the reducing equivalents gained from L-lactate oxidation to oxygen, yielding one molecule of ATP for every L-lactate molecule consumed. FCB2  is composed of 2 domains: a C-terminal flavin-binding domain, which includes the active site for lacate oxidation, and an N-terminal b2-cytochrome domain, required for efficient cytochrome c reduction. FCB2 is a homotetramer and contains two noncovalently bound cofactors, FMN and heme per subunit.
Probab=72.78  E-value=8.4  Score=19.58  Aligned_cols=88  Identities=15%  Similarity=0.125  Sum_probs=47.5

Q ss_pred             HHHHHHHH-CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHH---CCCCCCCHHHHH------HCC
Q ss_conf             99999850-59779983677789999999999997258780899514654440100---000001068885------187
Q gi|254780669|r  149 DLLTAAAQ-TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL---VTDMRSIPIMTS------MGV  218 (301)
Q Consensus       149 dLl~a~a~-t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~l---vvD~~~i~~lk~------~~~  218 (301)
                      +-++.+.+ ++.|+.||==  ++++|-..|+    ..|.+-|++---|-    +.|   ..-+..+|..++      -.+
T Consensus       203 ~di~~lr~~~~~plivKGI--l~~~DA~~A~----~~G~dgIiVSNHGG----RqLD~~~~~i~~Lp~I~~~~~av~~~~  272 (344)
T cd02922         203 DDIKWLRKHTKLPIVLKGV--QTVEDAVLAA----EYGVDGIVLSNHGG----RQLDTAPAPIEVLLEIRKHCPEVFDKI  272 (344)
T ss_pred             HHHHHHHHHCCCCEEECCC--CCHHHHHHHH----HCCCCEEEEECCCC----CCCCCCCCHHHHHHHHHHHHHHHCCCE
T ss_conf             9999999866997010025--7799999999----65998899718862----125788318999899999889858870


Q ss_pred             CEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             168711777421223453212638899999999997189889998
Q gi|254780669|r  219 PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       219 PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      ||++|--               -|.=. .+. .|+|+|+|.+|+=
T Consensus       273 ~v~~DgG---------------iR~G~-DV~-KAlALGA~aV~iG  300 (344)
T cd02922         273 EVYVDGG---------------VRRGT-DVL-KALCLGAKAVGLG  300 (344)
T ss_pred             EEEECCC---------------CCCHH-HHH-HHHHCCCCEEEEC
T ss_conf             8997188---------------57578-999-9997699989767


No 145
>PRK13139 consensus
Probab=72.72  E-value=8.5  Score=19.57  Aligned_cols=213  Identities=15%  Similarity=0.139  Sum_probs=112.9

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-9706601------557688666322245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv  118 (301)
                      .+.||=   -+.|..+++++.+.+.|.++. +|.-|.-      ..-.|+.-+.  -.|..+++.+++++++++++++|+
T Consensus        21 yitaG~---P~~e~s~~~~~~l~~~GaDiiElGiPFSDP~ADGpvIq~A~~~AL--~~G~~~~~~~~~~~~~~~~~~~pi   95 (254)
T PRK13139         21 HIVLGY---PSLQANREVIRAMVAGGVDLMELQIPFSEPMADGPVILKANQAAL--AGGFKVRECFDFAREVVAAFNIPF   95 (254)
T ss_pred             EECCCC---CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHHHCCCCCE
T ss_conf             855848---997999999999996699999978988886665899999999999--769979999999999972489768


Q ss_pred             EEECC-------C-HHHHHHHHHH-CCEEEECHHHCCCH-HHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             85228-------8-9999876502-15788225762899-99999850597-7998367778999999999999725878
Q gi|254780669|r  119 LTDVH-------T-EQQCEAIADS-VDILQIPALLCRQT-DLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       119 ~TeV~-------~-~~~~e~~~~~-vDilQIgA~~~rqt-dLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      +-=--       . ..-++.+++. +|-+=||---.... ++..++.+.+. +|.+=-+  .|+++.+   +++.+....
T Consensus        96 vlM~Y~N~i~~~G~e~F~~~~~~~Gv~GvIipDLP~eE~~~~~~~~~~~gl~~I~lvaP--tt~~~Ri---~~i~~~a~g  170 (254)
T PRK13139         96 LFMTYYNILFKYGVERFIDEVADIGVKGLIVPDLPPEQAQDYIAQCRAKGMAPIGIYAP--TSTDERM---GKIAAAADG  170 (254)
T ss_pred             EEEEEHHHHHHCCHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEEECC--CCCHHHH---HHHHHCCCC
T ss_conf             99952599987099999999997599858647999788999999998469757999458--9998999---999851698


Q ss_pred             CEE-EEECCCCCCCHHHCCCCC-CCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             089-951465444010000000-1068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  188 DVL-FCERGTSFGYNTLVTDMR-SIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       188 ~i~-lcERG~~fgy~~lvvD~~-~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      =|. +.-.|+|-..+.+-.++. .+..+|+ +..||++---=|             .++-+     ..+..++||+.+=+
T Consensus       171 FiY~vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGI~-------------~~e~v-----~~~~~~aDGvIVGS  232 (254)
T PRK13139        171 FIYCVARRGVTGSKTSFDEHVGAFLHRCRAATPLPLAVGFGVK-------------SAADV-----DYLKGKADIAVVGS  232 (254)
T ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCC-------------CHHHH-----HHHHCCCCEEEECH
T ss_conf             6999966666798866458899999999855899879973779-------------99999-----99971699999888


Q ss_pred             CCCHHHCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             6983347978201868899999999999
Q gi|254780669|r  265 HQDPDNAPSDGPNMINIKDLPKLLSQLL  292 (301)
Q Consensus       265 Hp~P~~AlsD~~q~l~l~~l~~ll~~l~  292 (301)
                      +--  +.+-++    ..+.+++++++++
T Consensus       233 aiV--k~ie~~----g~~~v~~f~~~lr  254 (254)
T PRK13139        233 QAI--RLFDEA----GAAAVEPFFRSLR  254 (254)
T ss_pred             HHH--HHHHHC----CHHHHHHHHHHHC
T ss_conf             999--999975----9999999999709


No 146
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=72.72  E-value=8.5  Score=19.57  Aligned_cols=118  Identities=17%  Similarity=0.166  Sum_probs=85.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEEEE-ECCCHHHHHH
Q ss_conf             34999999999999999655339970660155768866632224567124888999886652-876885-2288999987
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPILT-DVHTEQQCEA  130 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv~T-eV~~~~~~e~  130 (301)
                      .+++.+++..+++.+.+-|.+..         .       -.+|.+   .+++.+++++++| ++-|-. -|.+++|++.
T Consensus        22 r~~~~~~a~~~~~al~~gGi~~i---------E-------ITlrt~---~a~~~I~~l~~~~p~~~vGaGTVl~~e~~~~   82 (212)
T PRK06015         22 LIDDVEHAVPLARALARGGLPAI---------E-------ITLRTP---AALDAIRAVAAEVEEAIVGAGTILNAKQFED   82 (212)
T ss_pred             ECCCHHHHHHHHHHHHHCCCCEE---------E-------EECCCC---CHHHHHHHHHHHCCCCEEEEEECCCHHHHHH
T ss_conf             77999999999999998799889---------9-------968995---1999999999869996795421156999999


Q ss_pred             HHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             650-215788225762899999998505977998367778999999999999725878089951465444
Q gi|254780669|r  131 IAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFG  199 (301)
Q Consensus       131 ~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg  199 (301)
                      +.+ .++.+=-|.   -+.++++.+.+.+.|+.   +=-+||.|...|.+    .|.+-|-+-.-+...|
T Consensus        83 a~~aGA~FiVSP~---~~~~v~~~a~~~~i~~i---PGv~TpsEi~~A~~----~G~~~vKlFPA~~~gG  142 (212)
T PRK06015         83 AAKAGSRFIVSPG---TTQELLAAANDSDVPLL---PGAITPSEVMALRE----EGYTVLKFFPAEQAGG  142 (212)
T ss_pred             HHHCCCCEEECCC---CCHHHHHHHHHCCCCEE---CCCCCHHHHHHHHH----CCCCEEEECCCCCCCC
T ss_conf             9984998998589---99999999998399773---78699999999998----7999899784300168


No 147
>cd03084 phosphohexomutase The alpha-D-phosphohexomutase superfamily includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Members of this family include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). These enzymes play important and diverse roles in carbohydrate metabolism in organisms from bacteria to humans. Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Probab=72.68  E-value=8.5  Score=19.56  Aligned_cols=26  Identities=35%  Similarity=0.482  Sum_probs=13.5

Q ss_pred             CCEEEE-ECCCCCCHHHHHHHH-HHHHH
Q ss_conf             977998-367778999999999-99972
Q gi|254780669|r  158 GRVINV-KKGQFLSPWEMHNIL-QKLHA  183 (301)
Q Consensus       158 ~kpV~i-Kkgq~~s~~e~~~a~-eki~~  183 (301)
                      ++.+.+ ++|.+++.+++.... .++..
T Consensus       186 DR~~~vd~~G~~i~gd~~~~lla~~l~~  213 (355)
T cd03084         186 DRLIVVDENGGFLDGDELLALLAVELFL  213 (355)
T ss_pred             CEEEEECCCCEEECCCHHHHHHHHHHHH
T ss_conf             7799994897278844899999999997


No 148
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. Members of this protein family are 4-hydroxy-2-oxovalerate aldolase, also called 4-hydroxy-2-ketovalerate aldolase and 2-oxo-4-hydroxypentanoate aldolase. This enzyme, part of the pathway for the meta-cleavage of catechol, produces pyruvate and acetaldehyde. Acetaldehyde is then converted by acetaldehyde dehydrogenase (acylating) (DmpF; EC 1.2.1.10) to acetyl-CoA. The two enzymes are tightly associated.
Probab=72.67  E-value=8.5  Score=19.56  Aligned_cols=202  Identities=16%  Similarity=0.174  Sum_probs=114.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCCCCCC-CCCCCCCCHHHHHHHHHHHHHH-----CCEEEEECCCHHH
Q ss_conf             999999999999999655339-97066015576886663-2224567124888999886652-----8768852288999
Q gi|254780669|r   55 ESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSL-AGKRGVGLKKGREIFRDLKKKY-----GFPILTDVHTEQQ  127 (301)
Q Consensus        55 ES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKanRtS~-~sfrG~Gle~gL~il~e~k~~~-----glpv~TeV~~~~~  127 (301)
                      =|.|+..++++.|.+.|.... +++     .+--..+|+ ++|--.   .-.++++.+++..     ..-.+..+...++
T Consensus        21 fs~e~k~~ia~~Ld~aGVd~IEvg~-----g~g~~~ss~~~g~~~~---~d~e~i~~~~~~~~~ak~~~l~~pg~~~~~d   92 (333)
T TIGR03217        21 FTIEQVRAIAAALDEAGVDAIEVTH-----GDGLGGSSFNYGFSAH---TDLEYIEAAADVVKRAKVAVLLLPGIGTVHD   92 (333)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEEC-----CCCCCCCCCCCCCCCC---CCHHHHHHHHHHHCCCCEEEEECCCCCCHHH
T ss_conf             8999999999999971989899606-----8888887433578889---9499999999874248056996478666999


Q ss_pred             HHHHHH-HCCEEEECHHHCCCHHH----HHHHHHCCCEE--EEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCC
Q ss_conf             987650-21578822576289999----99985059779--983677789999999999997258780899514654440
Q gi|254780669|r  128 CEAIAD-SVDILQIPALLCRQTDL----LTAAAQTGRVI--NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY  200 (301)
Q Consensus       128 ~e~~~~-~vDilQIgA~~~rqtdL----l~a~a~t~kpV--~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy  200 (301)
                      ++...+ .+|++.|.. .|-..+.    ++.+.+.|..|  ++-.....+++.+...++.+.+.|.+-|.+|.-   +|+
T Consensus        93 l~~a~~~gv~~vri~~-~~te~d~~~~~i~~ak~~G~~v~~~~~~s~~~~~e~l~~~a~~~~~~Gad~I~i~DT---~G~  168 (333)
T TIGR03217        93 LKAAYDAGARTVRVAT-HCTEADVSEQHIGMARELGMDTVGFLMMSHMTPPEKLAEQAKLMESYGADCVYIVDS---AGA  168 (333)
T ss_pred             HHHHHHCCCCEEEEEE-CCCHHHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEECCC---CCC
T ss_conf             9999966999789863-166788899999999976980999975056899999999999998569999997596---446


Q ss_pred             HHHCCCCC-CCHHHHH-HC--CCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCCC
Q ss_conf             10000000-1068885-18--71687117774212234532126388999999999971898899983698334797820
Q gi|254780669|r  201 NTLVTDMR-SIPIMTS-MG--VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP  276 (301)
Q Consensus       201 ~~lvvD~~-~i~~lk~-~~--~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~  276 (301)
                      -+ --++. -+..+|+ ++  .|+=|- +|             -+..+...-+.+|+.+|++.+  ++--+.   +--++
T Consensus       169 ~~-P~~v~~~v~~l~~~~~~~i~ig~H-~H-------------NnlGlAvANslaAi~aGa~~V--D~Ti~G---lGe~a  228 (333)
T TIGR03217       169 ML-PDDVRDRVRALKAVLKPETQVGFH-AH-------------HNLSLAVANSIAAIEAGATRI--DASLRG---LGAGA  228 (333)
T ss_pred             CC-HHHHHHHHHHHHHHCCCCCEEEEE-EE-------------CCCCHHHHHHHHHHHCCCCEE--EECCCC---CCCCC
T ss_conf             89-999999999999862997548898-61-------------787729999999998199999--762744---88988


Q ss_pred             CCCCHHHHHHHH
Q ss_conf             186889999999
Q gi|254780669|r  277 NMINIKDLPKLL  288 (301)
Q Consensus       277 q~l~l~~l~~ll  288 (301)
                      -..+++.|-..+
T Consensus       229 GNa~lE~lVa~l  240 (333)
T TIGR03217       229 GNAPLEVFVAVL  240 (333)
T ss_pred             CCCHHHHHHHHH
T ss_conf             873499999999


No 149
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed
Probab=72.64  E-value=8.5  Score=19.55  Aligned_cols=178  Identities=14%  Similarity=0.169  Sum_probs=88.0

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHC
Q ss_conf             99999999999999655339970660155768866632224567124888999886652876885228899998765021
Q gi|254780669|r   56 SHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSV  135 (301)
Q Consensus        56 S~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~v  135 (301)
                      +.|++.-+.+..    .+...+.|---        |+...+-.|.+.-..+.+.+.+++.+||.--.-+....|.+.+.+
T Consensus        27 n~e~~~Avi~AA----ee~~sPvIlq~--------s~~~~~~~g~~~~~~~~~~~a~~~~VPV~lHLDH~~~~e~i~~ai   94 (283)
T PRK07998         27 NLETTISILNAI----ERSGLPNFIQI--------APTNAQLSGYDYIYEIVKRHADKMDVPVSLHLDHGKTFEDVKQAV   94 (283)
T ss_pred             CHHHHHHHHHHH----HHHCCCEEEEC--------CHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHH
T ss_conf             999999999999----99786989997--------750675559999999999999986998999758889999999999


Q ss_pred             C-----EEEECH-----HHCCCHHHHHHHH-HCCCEEEEEC--------------CCCCCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             5-----788225-----7628999999985-0597799836--------------7778999999999999725878089
Q gi|254780669|r  136 D-----ILQIPA-----LLCRQTDLLTAAA-QTGRVINVKK--------------GQFLSPWEMHNILQKLHAHGAKDVL  190 (301)
Q Consensus       136 D-----ilQIgA-----~~~rqtdLl~a~a-~t~kpV~iKk--------------gq~~s~~e~~~a~eki~~~Gn~~i~  190 (301)
                      |     |.-=|+     -|.+.|--+.+.+ ..|..|=--=              ..+-+|++   |.+.+..+|.+ .+
T Consensus        95 ~~GftSVM~DgS~l~~eeNi~~Tk~vv~~Ah~~gv~VEaElG~i~G~ed~~~~~~~~~T~Pee---a~~Fv~~TgvD-~L  170 (283)
T PRK07998         95 RAGFTSVMIDGAALPFEENIAFTQEAVDFCKSYGVPVEAELGAILGKEDDHVSEADCKTEPEK---VKTFVERTGCD-ML  170 (283)
T ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCCCCCCCCHHH---HHHHHHHHCCC-EE
T ss_conf             739988986099899999999999999999776997999853535754777775203899999---99999986889-99


Q ss_pred             EEECCCCCCCHHH-CCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             9514654440100-000001068885-18716871177742122345321263889999999999718988999836
Q gi|254780669|r  191 FCERGTSFGYNTL-VTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH  265 (301)
Q Consensus       191 lcERG~~fgy~~l-vvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~H  265 (301)
                      ..-=|+..|+..- -.|+.-+..+++ ...|.++   |     |+    ||=..    ..-+.|+..|+.=+=+-|.
T Consensus       171 AvaiGt~HG~~~~p~l~~~~l~~I~~~~~iPLVL---H-----Gg----SGi~~----e~i~~ai~~Gi~KiNi~Te  231 (283)
T PRK07998        171 AVSIGNVHGLDDIPRIDIPLLKRIAEVSPVPLVI---H-----GG----SGIPP----DILRSFVNYRVAKVNIASD  231 (283)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHCCCCEEE---E-----CC----CCCCH----HHHHHHHHCCCEEEEECHH
T ss_conf             6404664567878863899999988647987898---6-----99----99999----9999999869869995868


No 150
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=72.40  E-value=8.6  Score=19.52  Aligned_cols=113  Identities=18%  Similarity=0.152  Sum_probs=83.1

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEEEE-ECCCHHHHHH
Q ss_conf             34999999999999999655339970660155768866632224567124888999886652-876885-2288999987
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPILT-DVHTEQQCEA  130 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv~T-eV~~~~~~e~  130 (301)
                      ..++.|++..+++.+.+-|.+..         .       -.+|.+   .+++.+++++++| ++.|-. -|.+++|++.
T Consensus        22 r~~~~~~a~~i~~al~~gGi~~i---------E-------iTl~tp---~a~~~I~~l~~~~p~~~vGaGTV~~~e~~~~   82 (212)
T PRK05718         22 VINKLEDAVPLAKALVAGGLPVL---------E-------VTLRTP---AALEAIRAIRKEVPEALIGAGTVLNPEQLAQ   82 (212)
T ss_pred             ECCCHHHHHHHHHHHHHCCCCEE---------E-------EECCCC---HHHHHHHHHHHHCCCCEEEEEEECCHHHHHH
T ss_conf             74899999999999998799789---------9-------957896---1999999999758981796533134889999


Q ss_pred             HHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             650-2157882257628999999985059779983677789999999999997258780899514
Q gi|254780669|r  131 IAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       131 ~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      +.+ .++.+=-|-   -+.++++++-+.+.|+.   +=-+||.|...|.+    .|.+-+-+---
T Consensus        83 a~~aGA~FiVSP~---~~~~v~~~a~~~~i~~i---PGv~TpsEi~~A~~----~G~~~vK~FPA  137 (212)
T PRK05718         83 AIEAGAQFIVSPG---LTPPLLKACQDGPIPLI---PGVNTPSELMLAME----LGLRTFKFFPA  137 (212)
T ss_pred             HHHCCCCEEECCC---CCHHHHHHHHHCCCCEE---CCCCCHHHHHHHHH----CCCCEEEECCC
T ss_conf             9984998998489---98999999998199765---78699999999998----79998997876


No 151
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=72.02  E-value=8.8  Score=19.46  Aligned_cols=110  Identities=20%  Similarity=0.126  Sum_probs=81.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEEE-EECCCHHHHHH
Q ss_conf             34999999999999999655339970660155768866632224567124888999886652-87688-52288999987
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPIL-TDVHTEQQCEA  130 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv~-TeV~~~~~~e~  130 (301)
                      ..++.+++..+++.|.+-|.+..                =-.+|.+   .+++.+++++++| ++-|- --|.+.+|++.
T Consensus        20 r~~~~~~a~~~~~al~~gGi~~i----------------EiTl~t~---~a~~~I~~l~~~~p~~~iGaGTV~~~e~~~~   80 (210)
T PRK07455         20 RAPDLELGLQMAEAVAAGGMRLI----------------EITWNSD---QPAELISQLREKLPECIIGTGTLLTLEDLEE   80 (210)
T ss_pred             ECCCHHHHHHHHHHHHHCCCCEE----------------EEECCCC---CHHHHHHHHHHHCCCCEEEEEECCCHHHHHH
T ss_conf             75999999999999998799889----------------9968998---8999999999878996898881878999999


Q ss_pred             HHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             650-2157882257628999999985059779983677789999999999997258780899
Q gi|254780669|r  131 IAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLF  191 (301)
Q Consensus       131 ~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~l  191 (301)
                      +.+ .++.+=-|.   -+.++++++.+.+.|+.   +=-+||.|...|.++    |.+-+-+
T Consensus        81 a~~aGA~FiVSP~---~~~~vi~~a~~~~i~~i---PGv~TpsEi~~A~~~----G~~~vKl  132 (210)
T PRK07455         81 AIAAGAQFCFTPH---VDLELIQAAVAADIPII---PGALTPTEIVTAWQA----GASCVKV  132 (210)
T ss_pred             HHHCCCCEEECCC---CCHHHHHHHHHCCCCEE---CCCCCHHHHHHHHHC----CCCEEEE
T ss_conf             9986999998688---88999999998299765---886999999999986----9984775


No 152
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase. IMPDH catalyzes the NAD-dependent oxidation of inosine 5'-monophosphate (IMP) to xanthosine 5' monophosphate (XMP). It is a rate-limiting step in the de novo synthesis of the guanine nucleotides. There is often a CBS domain inserted in the middle of this domain, which is proposed to play a regulatory role. IMPDH is a key enzyme in the regulation of cell proliferation and differentiation. It has been identified as an attractive target for developing chemotherapeutic agents.
Probab=71.87  E-value=8.9  Score=19.44  Aligned_cols=135  Identities=19%  Similarity=0.273  Sum_probs=77.4

Q ss_pred             CHHHHHHHHHHHHHHCCEEEEECC--CHHHHHHHHH-HCCEEEECHHHCCCH---HHHHHHHHC--CCEEEEECCCCCCH
Q ss_conf             124888999886652876885228--8999987650-215788225762899---999998505--97799836777899
Q gi|254780669|r  100 LKKGREIFRDLKKKYGFPILTDVH--TEQQCEAIAD-SVDILQIPALLCRQT---DLLTAAAQT--GRVINVKKGQFLSP  171 (301)
Q Consensus       100 le~gL~il~e~k~~~glpv~TeV~--~~~~~e~~~~-~vDilQIgA~~~rqt---dLl~a~a~t--~kpV~iKkgq~~s~  171 (301)
                      +++-.+..+.+|.++-+.+.+-+.  +.+.++.+.+ .+|++=|-.-+-.+.   ++++.+.+.  +.||.  -|--.++
T Consensus        69 ~e~~~~~v~~vk~~~~v~aaig~~~~~~~r~~~l~~ag~d~i~IDvAhG~~~~~~~~ik~ir~~~p~~~Ii--aGNV~T~  146 (325)
T cd00381          69 IEEQAEEVRKVKGRLLVGAAVGTREDDKERAEALVEAGVDVIVIDSAHGHSVYVIEMIKFIKKKYPNVDVI--AGNVVTA  146 (325)
T ss_pred             HHHHHHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHCCCCEEEEECHHCCCHHHHHHHHHHHHHCCCCCEE--ECCCCCH
T ss_conf             89999999975047699999766862899999999769989998700034588999999999768997568--6456689


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCC----------CCCCHHHCCCCCCCHH----HHHHCCCEEECHHHHHHHCCCCCCC
Q ss_conf             9999999999725878089951465----------4440100000001068----8851871687117774212234532
Q gi|254780669|r  172 WEMHNILQKLHAHGAKDVLFCERGT----------SFGYNTLVTDMRSIPI----MTSMGVPVIFDASHSVQQPGIHGNC  237 (301)
Q Consensus       172 ~e~~~a~eki~~~Gn~~i~lcERG~----------~fgy~~lvvD~~~i~~----lk~~~~PVi~D~SHs~q~p~~~~~~  237 (301)
                      +    +++.+...|.+ .+.+--|.          -+||..+    .++..    -++++.|||-|-.=           
T Consensus       147 e----~a~~L~~~GaD-~vkVGiG~GS~CtTr~~tGvG~Pq~----sai~~~a~~~~~~~v~iiaDGGi-----------  206 (325)
T cd00381         147 E----AARDLIDAGAD-GVKVGIGPGSICTTRIVTGVGVPQA----TAVADVAAAARDYGVPVIADGGI-----------  206 (325)
T ss_pred             H----HHHHHHHCCCC-EEEECCCCCCCCCCCCCCCCCCCHH----HHHHHHHHHHHCCCCCEEECCCC-----------
T ss_conf             9----99999866998-9997575777766601017887458----89999999763449858944873-----------


Q ss_pred             CCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             1263889999999999718988999
Q gi|254780669|r  238 SGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       238 ~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                          | ..-.++| |+++|+|.+|+
T Consensus       207 ----~-~~Gdi~K-Ala~GAd~VMl  225 (325)
T cd00381         207 ----R-TSGDIVK-ALAAGADAVML  225 (325)
T ss_pred             ----C-CHHHHHH-HHHCCCCEEEE
T ss_conf             ----3-1078888-87528878984


No 153
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain.  Enoate reductase catalyzes the NADH-dependent reduction of carbon-carbon double bonds of several molecules, including nonactivated 2-enoates, alpha,beta-unsaturated aldehydes, cyclic ketones, and methylketones. ERs are similar to 2,4-dienoyl-CoA reductase from E. coli and to the old yellow enzyme from Saccharomyces cerevisiae.
Probab=71.49  E-value=9  Score=19.38  Aligned_cols=62  Identities=18%  Similarity=0.130  Sum_probs=37.6

Q ss_pred             HCCEEEECH----HHCCCH------------------------HHHHHHHH---CCCEEEEECCC---------------
Q ss_conf             215788225----762899------------------------99999850---59779983677---------------
Q gi|254780669|r  134 SVDILQIPA----LLCRQT------------------------DLLTAAAQ---TGRVINVKKGQ---------------  167 (301)
Q Consensus       134 ~vDilQIgA----~~~rqt------------------------dLl~a~a~---t~kpV~iKkgq---------------  167 (301)
                      ..|.++|-|    +|..||                        +.++++-+   .+-||.+|=..               
T Consensus       163 GfDgVEIH~ah~GyLl~qFlSp~~N~RtDeYGGSlenR~Rf~~Evi~aVR~~vg~d~~v~~R~s~~~~~~~~~~g~~~~~  242 (382)
T cd02931         163 GFDGVEIHAVHEGYLLDQFTISLFNKRTDKYGGSLENRLRFAIEIVEEIKARCGEDFPVSLRYSVKSYIKDLRQGALPGE  242 (382)
T ss_pred             CCCEEEECCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHH
T ss_conf             99989962453035899854873589886458987885618999999999970988738999656334566545788577


Q ss_pred             -----CCCHHHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             -----78999999999999725878089951465
Q gi|254780669|r  168 -----FLSPWEMHNILQKLHAHGAKDVLFCERGT  196 (301)
Q Consensus       168 -----~~s~~e~~~a~eki~~~Gn~~i~lcERG~  196 (301)
                           ..+++|.+..+..+...|- +.+-+..|.
T Consensus       243 ~~~~~g~~l~e~~~~~~~l~~~G~-D~l~vs~g~  275 (382)
T cd02931         243 EFQEKGRDLEEGLKAAKILEEAGY-DALDVDAGS  275 (382)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCC-CEEECCCCC
T ss_conf             788876359999999999998398-889647774


No 154
>PRK08185 hypothetical protein; Provisional
Probab=70.96  E-value=9.3  Score=19.31  Aligned_cols=164  Identities=13%  Similarity=0.200  Sum_probs=82.0

Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCC-----EEEECH-----HHCCCH-HHHHHHHHCCCEEEEEC----
Q ss_conf             248889998866528768852288999987650215-----788225-----762899-99999850597799836----
Q gi|254780669|r  101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD-----ILQIPA-----LLCRQT-DLLTAAAQTGRVINVKK----  165 (301)
Q Consensus       101 e~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vD-----ilQIgA-----~~~rqt-dLl~a~a~t~kpV~iKk----  165 (301)
                      ++-..+...+.+++.+||.--.-+....|.+.+.+|     |..=++     -|.+.| ++++-+.+.|..|=--=    
T Consensus        54 ~~~~~~~~~~a~~~~VpV~lHLDH~~~~e~~~~ai~~GFsSVM~DgS~lp~eeNi~~Tk~vv~~ah~~gv~VEaElG~vg  133 (283)
T PRK08185         54 DDFFAYVRERAQRSPVPFVIHLDHGASVEDVMRAIRCGFTSVMIDGSLLPYEENVALTKEVVELAHKVGVSVEGELGTIG  133 (283)
T ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCC
T ss_conf             99999999999877998999899999999999999829987986389899999999999999999865983899862367


Q ss_pred             ------------CCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC-CH---HHCCCCCCCHHHHH-HCCCEEECHHHHH
Q ss_conf             ------------7778999999999999725878089951465444-01---00000001068885-1871687117774
Q gi|254780669|r  166 ------------GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFG-YN---TLVTDMRSIPIMTS-MGVPVIFDASHSV  228 (301)
Q Consensus       166 ------------gq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg-y~---~lvvD~~~i~~lk~-~~~PVi~D~SHs~  228 (301)
                                  ..+.+|++   |.+.+..+|.+ .+..-=|+..| |.   .--.||--+..+++ ...|.++   |  
T Consensus       134 ~~e~~~~~~~~~~~~T~pee---a~~Fv~~TgvD-~LAvaiGn~HG~Yk~~~~p~l~~~~l~~I~~~~~vPLVL---H--  204 (283)
T PRK08185        134 NTGTSVEGGVSQIIYTDPEQ---AEDFVSRTGVD-TLAVAIGTAHGIYPKDKKPKLQMDILKEINERVDIPLVL---H--  204 (283)
T ss_pred             CCCCCCCCCCCCCCCCCHHH---HHHHHHHHCCC-EEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEE---E--
T ss_conf             76877666642000489999---99999987999-786332554555578898423789999999864999897---5--


Q ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC------HHHCCCCCCCCCCHHHH
Q ss_conf             212234532126388999999999971898899983698------33479782018688999
Q gi|254780669|r  229 QQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD------PDNAPSDGPNMINIKDL  284 (301)
Q Consensus       229 q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~------P~~AlsD~~q~l~l~~l  284 (301)
                         |+    | |..   ...-+.|+..|+.=+=+-|--.      =.+.+.+.+..+.+.++
T Consensus       205 ---Gg----S-G~~---~e~i~~ai~~Gv~KiNi~T~l~~a~~~~~~~~l~~~p~~~d~~~~  255 (283)
T PRK08185        205 ---GG----S-ANP---DAEIAESVTLGVGKINISSDMKYAFFQKVREILVANPSWWEPNVI  255 (283)
T ss_pred             ---CC----C-CCC---HHHHHHHHHCCEEEEEECHHHHHHHHHHHHHHHHHCCCCCCHHHH
T ss_conf             ---89----9-999---999999998693799848679999999999999859775787999


No 155
>PRK05835 fructose-bisphosphate aldolase; Provisional
Probab=70.89  E-value=9.3  Score=19.30  Aligned_cols=194  Identities=15%  Similarity=0.186  Sum_probs=85.4

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEEEEECCCHHHHHHHHHH
Q ss_conf             99999999999999655339970660155768866632224567124888999886652-87688522889999876502
Q gi|254780669|r   56 SHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPILTDVHTEQQCEAIADS  134 (301)
Q Consensus        56 S~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv~TeV~~~~~~e~~~~~  134 (301)
                      +.|++.-+.+...+.    .-+.|---        |+...+-.|++....+++.+.+++ ++||.--.-+....|.+.+.
T Consensus        26 n~e~~~avi~AAee~----~sPvIlq~--------s~~~~~~~g~~~~~~~~~~~a~~~a~VPValHLDH~~~~e~~~~a   93 (307)
T PRK05835         26 NFEMLNAIFEAGNEE----NSPLFIQA--------SEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKA   93 (307)
T ss_pred             CHHHHHHHHHHHHHH----CCCEEEEE--------CHHHHHHCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHH
T ss_conf             999999999999997----89989995--------733776679899999999999866999989989999999999999


Q ss_pred             CC-----EEEECHH-----HCCCH-HHHHHHHHCCCEEEEEC----------------CCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             15-----7882257-----62899-99999850597799836----------------7778999999999999725878
Q gi|254780669|r  135 VD-----ILQIPAL-----LCRQT-DLLTAAAQTGRVINVKK----------------GQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       135 vD-----ilQIgA~-----~~rqt-dLl~a~a~t~kpV~iKk----------------gq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      +|     |.-=++.     |.+.| +.++-+.+.|.+|=--=                ..+.+|++   |.+.+..+|.+
T Consensus        94 i~~GFsSVM~DgS~l~~eeNI~~tk~vve~ah~~gv~VEaElG~i~G~Ed~~~~~~~~~~~T~pee---a~~Fv~~TgvD  170 (307)
T PRK05835         94 VKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIEDNISVDEKDAVLVNPKE---AEQFVKESQVD  170 (307)
T ss_pred             HHCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHH---HHHHHHHHCHH
T ss_conf             981998799519989999999999999999987098699974312566777676653223479999---99999874707


Q ss_pred             CEEEEECCCCCC---CHH-HCCCCCCCHHHHH-HCCCEEECHHHHHHH-----CCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             089951465444---010-0000001068885-187168711777421-----223453212638899999999997189
Q gi|254780669|r  188 DVLFCERGTSFG---YNT-LVTDMRSIPIMTS-MGVPVIFDASHSVQQ-----PGIHGNCSGGERQYIVPLAKAAVAIGI  257 (301)
Q Consensus       188 ~i~lcERG~~fg---y~~-lvvD~~~i~~lk~-~~~PVi~D~SHs~q~-----p~~~~~~~gG~r~~v~~la~aa~a~G~  257 (301)
                       .+..-=|+..|   |.. -..||--+...++ ...|.++--+-.+..     -...|+..-|-.-.-+..-+.|+..|+
T Consensus       171 -~LAvaiGn~HG~yk~~g~p~l~~~~L~~I~~~~~vPLVLHGgSgvpd~~~~~~~~~gg~~~~~~G~~~e~i~~ai~~Gv  249 (307)
T PRK05835        171 -YLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGI  249 (307)
T ss_pred             -HHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCEEECCCCCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCC
T ss_conf             -9999866557777778997678899999984179987956898760788888750266567888999999999998697


Q ss_pred             CEEEEEEC
Q ss_conf             88999836
Q gi|254780669|r  258 AGIFLETH  265 (301)
Q Consensus       258 dGlfiE~H  265 (301)
                      .=+=|-|.
T Consensus       250 ~KiNI~Td  257 (307)
T PRK05835        250 NKVNTDTD  257 (307)
T ss_pred             EEEEECHH
T ss_conf             69986877


No 156
>pfam01070 FMN_dh FMN-dependent dehydrogenase.
Probab=70.61  E-value=9.4  Score=19.26  Aligned_cols=104  Identities=21%  Similarity=0.318  Sum_probs=61.9

Q ss_pred             CCEEEECH--HHCCCHHHHHHHHH-CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCC-CCCCHHHCCCCCCC
Q ss_conf             15788225--76289999999850-5977998367778999999999999725878089951465-44401000000010
Q gi|254780669|r  135 VDILQIPA--LLCRQTDLLTAAAQ-TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGT-SFGYNTLVTDMRSI  210 (301)
Q Consensus       135 vDilQIgA--~~~rqtdLl~a~a~-t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~-~fgy~~lvvD~~~i  210 (301)
                      +|..|-|-  +..||.+-++.+.+ ++.||.+| |. +|++|-    ++..+.|.+-|++--.|- .+..  -..-...+
T Consensus       143 vD~~~~g~r~~d~r~~~~i~~l~~~~~~PvivK-GI-~s~eDA----~~a~~~Gv~~I~VSnHGGRqlD~--~~~t~~~L  214 (301)
T pfam01070       143 VDTPVLGNRERDLRNGDDLAWLRDQWKGPLVLK-GI-LSPEDA----KRAVEAGVDGIVVSNHGGRQLDG--APATIDAL  214 (301)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEE-CC-CCHHHH----HHHHHCCCCEEEECCCCCCCCCC--CCCHHHHH
T ss_conf             268765778532043999999998669988998-28-999999----99998599999964998544688--86799999


Q ss_pred             HHHHH-H--CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             68885-1--87168711777421223453212638899999999997189889998
Q gi|254780669|r  211 PIMTS-M--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       211 ~~lk~-~--~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      |..++ .  .+||++|-               |-|.= ...+ .|+|+|+|..++=
T Consensus       215 ~eI~~~v~~~~~i~~DG---------------GIR~G-~DV~-KAlALGA~~V~iG  253 (301)
T pfam01070       215 PEIVAAVGGRIPVLVDG---------------GIRRG-TDVL-KALALGADAVLLG  253 (301)
T ss_pred             HHHHHHHCCCEEEEECC---------------CCCCC-HHHH-HHHHCCCCEEEEC
T ss_conf             99999856774899638---------------74762-6899-9998089866556


No 157
>PRK13136 consensus
Probab=70.18  E-value=9.6  Score=19.20  Aligned_cols=192  Identities=17%  Similarity=0.246  Sum_probs=99.1

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-9706601------557688666322245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv  118 (301)
                      .+.||=   =+.|...++++.+.+.|.++. +|.=|.-      ..-.|+.-+  --.|..+++.+++++++|++..+|+
T Consensus        17 yitaG~---P~~e~s~~~~~~l~~~G~DiiElGiPfSDP~ADGpvIq~A~~rA--L~~G~~~~~~~~~v~~~r~~~~~pi   91 (253)
T PRK13136         17 YLTAGD---GGLERSLESLLALAKGGVNILEVGVPFSDPVADGPVIQEASIRA--LAQGTTLHDVLTLITSFRQHSEIPI   91 (253)
T ss_pred             EECCCC---CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHH--HHCCCCHHHHHHHHHHHCCCCCCCE
T ss_conf             864848---99899999999999659998997899888666579999999999--9869979999999998225789888


Q ss_pred             EE--E---CCC--HHHHHHHHH-HCCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             85--2---288--999987650-21578822576289-999999850597-79983677789999999999997258780
Q gi|254780669|r  119 LT--D---VHT--EQQCEAIAD-SVDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAKD  188 (301)
Q Consensus       119 ~T--e---V~~--~~~~e~~~~-~vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~~  188 (301)
                      +-  =   +..  .+-++.+++ .+|-+=||---... .++..++.+.+. +|.+     .+|.--..-.+++.+....=
T Consensus        92 vlM~Y~N~i~~~G~~f~~~~~~~GvdGlIipDLP~eE~~~~~~~~~~~~i~~I~l-----iaPtt~~eRi~~i~~~a~gF  166 (253)
T PRK13136         92 ILFTYFNPLLAAGDKIYQQMKSAGVDGCLVVDLPVEEAAPHLTACKTAKIAPILL-----ISPSTTQERLKKINEHGEGM  166 (253)
T ss_pred             EEECCCHHHHHHHHHHHHHHHHCCCCCEECCCCCHHHHHHHHHHHHHCCCCCEEE-----ECCCCCHHHHHHHHHCCCCE
T ss_conf             9986517999979999999997498720067899777699999999758871255-----26899889999999608981


Q ss_pred             E-EEEECCCCCCCHHHCCCC-CCCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             8-995146544401000000-010688851-8716871177742122345321263889999999999718988999836
Q gi|254780669|r  189 V-LFCERGTSFGYNTLVTDM-RSIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH  265 (301)
Q Consensus       189 i-~lcERG~~fgy~~lvvD~-~~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~H  265 (301)
                      | .+.-.|+|=..+.+-.++ ..+..+|+. ..||++---=|             .++-+..+.+    . +||+.+=++
T Consensus       167 iY~vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~v~~~~~----~-ADGvIVGSa  228 (253)
T PRK13136        167 LYYVCRPGTTGVRATLPENFPAKMNQIKSMTSLPIVTGFGIA-------------NRKMAAQALQ----Y-ADGFVIGSL  228 (253)
T ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCC-------------CHHHHHHHHH----H-CCEEEECHH
T ss_conf             999855523687644638899999999972699869971549-------------9999999982----2-999998589


No 158
>pfam00809 Pterin_bind Pterin binding enzyme. This family includes a variety of pterin binding enzymes that all adopt a TIM barrel fold. The family includes dihydropteroate synthase EC:2.5.1.15 as well as a group methyltransferase enzymes including methyltetrahydrofolate, corrinoid iron-sulfur protein methyltransferase (MeTr) that catalyses a key step in the Wood-Ljungdahl pathway of carbon dioxide fixation. It transfers the N5-methyl group from methyltetrahydrofolate (CH3-H4folate) to a cob(I)amide centre in another protein, the corrinoid iron-sulfur protein. MeTr is a member of a family of proteins that includes methionine synthase and methanogenic enzymes that activate the methyl group of methyltetra-hydromethano(or -sarcino)pterin.
Probab=70.15  E-value=9.6  Score=19.20  Aligned_cols=164  Identities=19%  Similarity=0.246  Sum_probs=102.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHC-CCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHH
Q ss_conf             99999999999999965533-99706601557688666322245671248889998866528768852288999987650
Q gi|254780669|r   55 ESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIAD  133 (301)
Q Consensus        55 ES~e~~~~~A~~lk~~~~~~-~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~  133 (301)
                      -+.+.+++-|+.+.+-|++. .+|+.-  +.+.|..-   +... -++.-+.+++.+++ .++++--|-..++-++.+.+
T Consensus        16 ~~~~~a~~~a~~~i~~GAdiIDIG~eS--TrPga~~v---~~~e-E~~Rl~pvl~~l~~-~~~~iSIDT~~~~v~~~al~   88 (208)
T pfam00809        16 LSPDKALEQAREMVEEGADIIDIGGES--TRPGAGMV---SGEE-ELERLVPVLEALRD-QDVPISIDTFNAEVAEAALK   88 (208)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCC--CCCCCCCC---CHHH-HHHHHHHHHHHHHC-CCCCEEEECCCHHHHHHHHH
T ss_conf             899999999999998799899868976--89998646---8899-99999999998635-79828997984999999998


Q ss_pred             -HCCEEE-ECHHHCCCHHHHHHHHHCCCEEEEECC----CCCC---------HHHH----HHHHHHHHHCCCC-CEEEEE
Q ss_conf             -215788-225762899999998505977998367----7789---------9999----9999999725878-089951
Q gi|254780669|r  134 -SVDILQ-IPALLCRQTDLLTAAAQTGRVINVKKG----QFLS---------PWEM----HNILQKLHAHGAK-DVLFCE  193 (301)
Q Consensus       134 -~vDilQ-IgA~~~rqtdLl~a~a~t~kpV~iKkg----q~~s---------~~e~----~~a~eki~~~Gn~-~i~lcE  193 (301)
                       .+|++- |-++ -+..++++.+++++.|+.+=.-    +.+.         .+++    ..-++++.+.|-+ +=++..
T Consensus        89 ~G~~iINDvsg~-~~d~~~~~~~a~~~~~~vlmh~~~~p~~~~~~~~~~~dv~~~i~~~~~~~i~~~~~~Gi~~~~IiiD  167 (208)
T pfam00809        89 AGADIINDSSGG-KDDPEMAPLAAEYGAPVVLMHMDGNPQGMQENPEYRVDVVEELLRFLTERLEAAEAAGVPPERIILD  167 (208)
T ss_pred             CCCCEEEECHHH-HCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHEEEC
T ss_conf             199389870121-0377999999973999998668999865332676530699999999999999999879897779971


Q ss_pred             CCCCCCCH--HHCCCCCCCHHHHHH-CCCEEECHHH
Q ss_conf             46544401--000000010688851-8716871177
Q gi|254780669|r  194 RGTSFGYN--TLVTDMRSIPIMTSM-GVPVIFDASH  226 (301)
Q Consensus       194 RG~~fgy~--~lvvD~~~i~~lk~~-~~PVi~D~SH  226 (301)
                      =|+-||-+  ...--++++..++++ ++|+.+=.|-
T Consensus       168 PGiGF~k~~~~n~~ll~~l~~~~~~~~~Pilvg~SR  203 (208)
T pfam00809       168 PGIGFGKTEEHNLELLRTLDALRELRGYPLLVGGSR  203 (208)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             887888986778999986999972489828998246


No 159
>PRK13138 consensus
Probab=69.35  E-value=10  Score=19.09  Aligned_cols=217  Identities=15%  Similarity=0.170  Sum_probs=111.6

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH-HCCEEEE--E
Q ss_conf             634999999999999999655339-9706601------5576886663222456712488899988665-2876885--2
Q gi|254780669|r   52 CQIESHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANRSSLAGKRGVGLKKGREIFRDLKKK-YGFPILT--D  121 (301)
Q Consensus        52 CsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanRtS~~sfrG~Gle~gL~il~e~k~~-~glpv~T--e  121 (301)
                      |.--+.|...++++.+.+.|+++. +|.-|.-      ..-+|+.-+.  -+|..+++.+++++++++. ..+|++-  =
T Consensus        21 aG~P~~e~t~~~~~~l~~~GadiiEiGiPFSDP~ADGPvIq~A~~rAL--~~G~~~~~~~~~~~~ir~~~~~~pivlM~Y   98 (264)
T PRK13138         21 LGDPDYDSCIIWADALIRGGAGILELGIPFSDPVADGPVIQKAFKRAL--AHPFSMDKILEITAEIHKLHPEIPLVYLTY   98 (264)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHCCCCCCCCEEEEEE
T ss_conf             879998999999999997799989979988886665899999999999--779908897446776033589888897521


Q ss_pred             ---C--C-CHHHHHHHHHH-CCEEEECHHHC---CCHHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCCCE-
Q ss_conf             ---2--8-89999876502-15788225762---89999999850597-799836777899999999999972587808-
Q gi|254780669|r  122 ---V--H-TEQQCEAIADS-VDILQIPALLC---RQTDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAKDV-  189 (301)
Q Consensus       122 ---V--~-~~~~~e~~~~~-vDilQIgA~~~---rqtdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~~i-  189 (301)
                         |  . ...-++.+++. +|-+=||----   ...++..++.+.+. .|.+=-+ . +.++   -.+++.+...-=| 
T Consensus        99 ~N~i~~~G~e~F~~~~~~~GvdGlIipDLP~e~~E~~~~~~~~~~~~i~~I~liaP-t-t~~~---Ri~~i~~~s~gFiY  173 (264)
T PRK13138         99 FNPLFSMGLEAFTERAKNSGIQGLIIPDLPFDTPEAEEFFSQLERKKIDFIHLVTP-A-TTED---RIQSMKSFASGFIY  173 (264)
T ss_pred             HHHHHHHCHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHHHHCCCCEEEECCC-C-CCHH---HHHHHHHHCCCEEE
T ss_conf             23898848999999998769775853689865033599999999869986752179-9-9899---99999973888089


Q ss_pred             EEEECCCCCCCHHHCCCCC-CCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9951465444010000000-1068885-1871687117774212234532126388999999999971898899983698
Q gi|254780669|r  190 LFCERGTSFGYNTLVTDMR-SIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD  267 (301)
Q Consensus       190 ~lcERG~~fgy~~lvvD~~-~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~  267 (301)
                      .+.-.|+|-..+.+..++. .+..+|+ +..||++---=|             .++.+    + .+..++||+.+=+.--
T Consensus       174 ~Vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~~----~-~~~~~ADGvIVGSaiv  235 (264)
T PRK13138        174 YVTSYGVTGERGAIASGLEDRIQMVRKIVGLPVCAGFGIS-------------TADQA----K-EISTYADGVIIGSAVQ  235 (264)
T ss_pred             EEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCC-------------CHHHH----H-HHHHCCCEEEECHHHH
T ss_conf             8754566787655537699999999974389838860679-------------89999----9-9983499999819999


Q ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             33479782018688999999999999
Q gi|254780669|r  268 PDNAPSDGPNMINIKDLPKLLSQLLA  293 (301)
Q Consensus       268 P~~AlsD~~q~l~l~~l~~ll~~l~~  293 (301)
                      ---.-...+..-..+.+..++++|+.
T Consensus       236 ~~i~~~~~~~~~~~~~v~~~~~~lk~  261 (264)
T PRK13138        236 KIIEENGSDRENCADKLFAYASEIRA  261 (264)
T ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99997278777899999999999999


No 160
>pfam00290 Trp_syntA Tryptophan synthase alpha chain.
Probab=69.15  E-value=10  Score=19.06  Aligned_cols=217  Identities=20%  Similarity=0.253  Sum_probs=112.7

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCC-----CCCCCC-CCCCCCHHHHHHHHHHHHHH-CCE
Q ss_conf             999548634999999999999999655339-9706601557688-----666322-24567124888999886652-876
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKAN-----RSSLAG-KRGVGLKKGREIFRDLKKKY-GFP  117 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKan-----RtS~~s-frG~Gle~gL~il~e~k~~~-glp  117 (301)
                      .+.||=   -+.+...++.+.+.+.|+++. +|.=|.  -+.|-     +++..+ -+|..+++.+++++++|+++ ..|
T Consensus        14 yi~aG~---P~~~~~~~~i~~l~~~GaDiiEiGiPFS--DP~ADGpvIq~A~~~AL~~G~~~~~~~~~~~~~r~~~~~~p   88 (258)
T pfam00290        14 FVTAGD---PDLETTLEILEALEEAGADAIELGIPFS--DPLADGPTIQRANLRALAGGMTLDQTLELVEEIRNKGTSVP   88 (258)
T ss_pred             EEECCC---CCHHHHHHHHHHHHHCCCCEEEECCCCC--CCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             870738---9989999999999976999999789988--87665899999999999869969999999998551289988


Q ss_pred             EEE--EC-----C-CHHHHHHHHHH-CCEEEECHHHCCCH-HHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             885--22-----8-89999876502-15788225762899-99999850597-799836777899999999999972587
Q gi|254780669|r  118 ILT--DV-----H-TEQQCEAIADS-VDILQIPALLCRQT-DLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       118 v~T--eV-----~-~~~~~e~~~~~-vDilQIgA~~~rqt-dLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn  186 (301)
                      ++-  =.     . ...-++.+++. +|-+=||-.-.... ++..++.+.+. +|.+     .+|.--..-++++.....
T Consensus        89 ivlM~Y~N~i~~~G~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~~l~~I~l-----vsPtt~~~Ri~~i~~~s~  163 (258)
T pfam00290        89 IVLMTYYNPVLNYGIERFYAQAAEAGVDGLIIPDLPPEEADPLREAAEKHGIDLIFL-----VAPTTSDERLKTISEAAS  163 (258)
T ss_pred             EEEEEECHHHHHCCHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEE-----ECCCCCHHHHHHHHHHCC
T ss_conf             899852088987299999999997599778707999889999999998458435888-----458881999999996089


Q ss_pred             CCEE-EEECCCCCCCHHHCCCCC-CCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             8089-951465444010000000-10688851-87168711777421223453212638899999999997189889998
Q gi|254780669|r  187 KDVL-FCERGTSFGYNTLVTDMR-SIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       187 ~~i~-lcERG~~fgy~~lvvD~~-~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      .=|. +.-.|+|=..+.+..++. .+..+|+. ..||++---=|             .++-+.     .+..++||+.+=
T Consensus       164 gFiY~vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~v~-----~~~~~aDGvIVG  225 (258)
T pfam00290       164 GFVYLVSRAGVTGARNAFNAQLDELVERLKKYTNVPVAVGFGIS-------------TPEHVK-----KIAAGADGVIVG  225 (258)
T ss_pred             CEEEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECCC-------------CHHHHH-----HHHCCCCEEEEC
T ss_conf             80899853445676555638899999999860699848994579-------------999999-----998159999984


Q ss_pred             ECCCHH--HCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             369833--47978201868899999999999
Q gi|254780669|r  264 THQDPD--NAPSDGPNMINIKDLPKLLSQLL  292 (301)
Q Consensus       264 ~Hp~P~--~AlsD~~q~l~l~~l~~ll~~l~  292 (301)
                      ++---.  +...|.  .-.++.+.+++++|+
T Consensus       226 Saiv~~i~~~~~~~--~~~~~~v~~fv~~lk  254 (258)
T pfam00290       226 SAIVDIIEENLDDP--EQMLAKLEEFVGKLK  254 (258)
T ss_pred             HHHHHHHHHCCCCH--HHHHHHHHHHHHHHH
T ss_conf             99999999704068--899999999999999


No 161
>PRK13113 consensus
Probab=69.11  E-value=10  Score=19.05  Aligned_cols=215  Identities=15%  Similarity=0.195  Sum_probs=110.1

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC-CE
Q ss_conf             999548634999999999999999655339-9706601------557688666322245671248889998866528-76
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYG-FP  117 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~g-lp  117 (301)
                      .+.||   --+.+..+++++.+.+.|.++. +|.=|.-      ..-.|+.-+.  -.|..+++.+++++++++++. +|
T Consensus        22 yitaG---~P~~e~s~~~~~~l~~~GaDiiElGiPFSDP~ADGPvIq~A~~rAL--~~G~~~~~~~~~v~~~r~~~~~~P   96 (263)
T PRK13113         22 YVMAG---DPDYDTSLEVMRGLPAAGVDIIELGMPFTDPMADGPTIQLAGQRAL--EGGMTLDRTLDMVRAFRKEDDTTP   96 (263)
T ss_pred             EECCC---CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             87382---8997999999999997699999978988887765899999999999--779838899999997512389988


Q ss_pred             EEE--ECCC------HHHHHHHHHH-CCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             885--2288------9999876502-1578822576289-999999850597-799836777899999999999972587
Q gi|254780669|r  118 ILT--DVHT------EQQCEAIADS-VDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       118 v~T--eV~~------~~~~e~~~~~-vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn  186 (301)
                      ++-  =.-.      ..-++.+++. +|-+=||-.--.. .++..++.+.+. +|.+--+  .|+++.+   +++.+...
T Consensus        97 ivlM~Y~N~i~~~G~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~~l~~I~lvaP--tt~~~Ri---~~i~~~a~  171 (263)
T PRK13113         97 IVMMGYYNPIYSRGVDRFLAEAKEAGIDGLIVVDLPPEEDSELCLPAQAAGLNFIRLATP--TTDDRRL---PKVLQNTS  171 (263)
T ss_pred             EEEEECHHHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEECC--CCCHHHH---HHHHHCCC
T ss_conf             899831368988569999999877794369717999788899999999779867999479--9999999---99983389


Q ss_pred             CC-EEEEECCCCCCCHHHCCCCC-CCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             80-89951465444010000000-1068885-187168711777421223453212638899999999997189889998
Q gi|254780669|r  187 KD-VLFCERGTSFGYNTLVTDMR-SIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       187 ~~-i~lcERG~~fgy~~lvvD~~-~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      .= ..+.-+|+|=..+.+-.++. .+..+|+ +..||++---=+             .++-+     ..+...+||+.+=
T Consensus       172 gFiY~Vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGI~-------------~~e~~-----~~~~~~ADGvIVG  233 (263)
T PRK13113        172 GFVYYVSITGITGAAAAQAADVAPEVARIKAATDLPVIVGFGIT-------------TPEAA-----QAIAGVADGCVVG  233 (263)
T ss_pred             CCEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCC-------------CHHHH-----HHHHCCCCEEEEC
T ss_conf             84899834556687755437799999999854799889983789-------------98999-----9997339999986


Q ss_pred             ECCCHHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             369833479782018688999999999999
Q gi|254780669|r  264 THQDPDNAPSDGPNMINIKDLPKLLSQLLA  293 (301)
Q Consensus       264 ~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~  293 (301)
                      ++---  -+.++   -++.++..++++|++
T Consensus       234 Sa~v~--~i~e~---~~~~~~~~~v~~l~~  258 (263)
T PRK13113        234 SAIVK--LIGEG---RPVAEVLAFVATLAD  258 (263)
T ss_pred             HHHHH--HHHHC---CCHHHHHHHHHHHHH
T ss_conf             89999--99828---998999999999999


No 162
>cd00452 KDPG_aldolase KDPG and KHG aldolase. This family belongs to the class I adolases whose reaction mechanism involves Schiff base formation between a substrate carbonyl and lysine residue in the active site. 2-keto-3-deoxy-6-phosphogluconate (KDPG) aldolase,  is best known for its role in the Entner-Doudoroff pathway of bacteria, where it catalyzes the reversible cleavage of KDPG to pyruvate and glyceraldehyde-3-phosphate. 2-keto-4-hydroxyglutarate (KHG) aldolase, which has enzymatic specificity toward glyoxylate, forming KHG in the presence of pyruvate, and is capable of regulating glyoxylate levels in the glyoxylate bypass, an alternate pathway when bacteria are grown on acetate carbon sources.
Probab=69.09  E-value=10  Score=19.05  Aligned_cols=109  Identities=22%  Similarity=0.238  Sum_probs=81.3

Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEE-EEECCCHHHHHHH
Q ss_conf             4999999999999999655339970660155768866632224567124888999886652-8768-8522889999876
Q gi|254780669|r   54 IESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPI-LTDVHTEQQCEAI  131 (301)
Q Consensus        54 iES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv-~TeV~~~~~~e~~  131 (301)
                      .++.+.++.+++.+.+.|.+..         .       -.+|.+   .+++.+++++++| ++-| .-.|++++|++.+
T Consensus        12 ~~~~~~a~~~~~al~~~Gi~~i---------E-------itl~t~---~a~~~i~~l~~~~~~~~iGaGTV~~~~~~~~a   72 (190)
T cd00452          12 GDDAEDALALAEALIEGGIRAI---------E-------ITLRTP---GALEAIRALRKEFPEALIGAGTVLTPEQADAA   72 (190)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEE---------E-------EECCCC---HHHHHHHHHHHHCCCCEEEECCCCCHHHHHHH
T ss_conf             7999999999999998699889---------9-------967880---29999999998689808965234779999999


Q ss_pred             HH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             50-2157882257628999999985059779983677789999999999997258780899
Q gi|254780669|r  132 AD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLF  191 (301)
Q Consensus       132 ~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~l  191 (301)
                      .+ .++.+=-|.   -+.++++.+.+.+.|+.   +=-+||.|...|.+    .|.+-+-+
T Consensus        73 ~~aGa~FivsP~---~~~~v~~~a~~~~~~~i---PGv~TpsEi~~A~~----~G~~~vK~  123 (190)
T cd00452          73 IAAGAQFIVSPG---LDPEVVKAANRAGIPLL---PGVATPTEIMQALE----LGADIVKL  123 (190)
T ss_pred             HHCCCCEEECCC---CCHHHHHHHHHCCCCEE---CCCCCHHHHHHHHH----CCCCEEEE
T ss_conf             985998997377---99999999998299665---78799999999998----79998998


No 163
>pfam01081 Aldolase KDPG and KHG aldolase. This family includes the following members: 4-hydroxy-2-oxoglutarate aldolase (KHG-aldolase) Phospho-2-dehydro-3-deoxygluconate aldolase (KDPG-aldolase)
Probab=69.02  E-value=10  Score=19.04  Aligned_cols=110  Identities=22%  Similarity=0.173  Sum_probs=82.1

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEEEE-ECCCHHHHHH
Q ss_conf             34999999999999999655339970660155768866632224567124888999886652-876885-2288999987
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPILT-DVHTEQQCEA  130 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv~T-eV~~~~~~e~  130 (301)
                      ..++.+++..+++.|.+.|.+..         .       -.+|.+   .+++.+++++++| ++-|-. -|.+.+|++.
T Consensus        15 r~~~~~~a~~~~~al~~~Gi~~i---------E-------iTl~t~---~a~~~I~~l~~~~p~~~iGaGTV~~~e~~~~   75 (196)
T pfam01081        15 VIKDKEDALPLAEALAAGGIRVL---------E-------VTLRTP---CALDAIRLLRKNRPDALVGAGTVLNAQQLAE   75 (196)
T ss_pred             ECCCHHHHHHHHHHHHHCCCCEE---------E-------EECCCH---HHHHHHHHHHHHCCCCEEEEEECCCHHHHHH
T ss_conf             77999999999999998799889---------9-------947982---7999999999649996799983768999999


Q ss_pred             HHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             650-2157882257628999999985059779983677789999999999997258780899
Q gi|254780669|r  131 IAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLF  191 (301)
Q Consensus       131 ~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~l  191 (301)
                      +.+ .++.+=-|-   -+.++++++.+.+.|+.   +=-+||.|...|.+    .|.+-+-+
T Consensus        76 a~~aGA~FivSP~---~~~~v~~~a~~~~i~~i---PGv~TpsEi~~A~~----~G~~~vKl  127 (196)
T pfam01081        76 AAEAGAQFVVSPG---LTADLLKHAVDVKIPLI---PGVSTPSEIMLGLD----LGLTRFKF  127 (196)
T ss_pred             HHHCCCCEEECCC---CHHHHHHHHHHCCCCEE---CCCCCHHHHHHHHH----CCCCEEEE
T ss_conf             9974999999787---63999999997399663---78599999999998----79998997


No 164
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional
Probab=68.97  E-value=10  Score=19.04  Aligned_cols=219  Identities=17%  Similarity=0.178  Sum_probs=112.9

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-9706601------557688666322245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv  118 (301)
                      .+.||   --+.|..+++++.+.+.|+++. +|.=|.-      ..-+|+.-+.  -.|..+++.+++++++++++..|+
T Consensus        20 y~taG---~P~~e~s~~~~~~l~~~GaDiiElGiPfSDP~ADGpvIq~A~~~AL--~~G~~~~~~~~~v~~~r~~~~~Pi   94 (263)
T CHL00200         20 FITAG---DPDIVITKKALKILDKKGADIIELGIPYSDPLADGPIIQEASNRAL--KQGINLNKILSILSEVNGEIKAPI   94 (263)
T ss_pred             EECCC---CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHHHCCCCCE
T ss_conf             87073---8987899999999997699999978988886665899999999999--779877789999999860679988


Q ss_pred             EE--ECC------CHHHHHHHHHH-CCEEEECHHHCCCH-HHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             85--228------89999876502-15788225762899-99999850597-7998367778999999999999725878
Q gi|254780669|r  119 LT--DVH------TEQQCEAIADS-VDILQIPALLCRQT-DLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       119 ~T--eV~------~~~~~e~~~~~-vDilQIgA~~~rqt-dLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      +-  =.-      ..+-++.+++. +|-+=||---...- ++..++.+.+. +|.+=-+ ..+.+.+..+++.    ...
T Consensus        95 vlMtY~N~i~~yG~e~F~~~~~~~GvdGlIipDLP~eE~~~~~~~~~~~gl~~I~lvaP-tt~~~Ri~~i~~~----a~G  169 (263)
T CHL00200         95 VIFTYYNPVLHYGINKFIKKISQAGVKGLIIPDLPYEESDYLISVCNLYNIELILLIAP-TSSKSRIQKIARA----APG  169 (263)
T ss_pred             EEEEEHHHHHHCCHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEEECC-CCCHHHHHHHHHH----CCC
T ss_conf             99862068887388999999998499868747999788899999998558621666478-9969999999972----898


Q ss_pred             CE-EEEECCCCCCCHHHCCCC-CCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             08-995146544401000000-01068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  188 DV-LFCERGTSFGYNTLVTDM-RSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       188 ~i-~lcERG~~fgy~~lvvD~-~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      =| .+.-.|+|=..+.+-.++ ..+..+|+ +..||++---=|             .++-+    +....+|+||+.+=+
T Consensus       170 FiY~vs~~GvTG~~~~~~~~l~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~v----~~~~~~~aDGvIVGS  232 (263)
T CHL00200        170 CIYLVSTTGVTGLKTELDKKLKKLIETIKKMTNKPIILGFGIS-------------TSEQI----KQIKGWNINGIVIGS  232 (263)
T ss_pred             CEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCC-------------CHHHH----HHHHHCCCCEEEECH
T ss_conf             0898533655687544518799999999973699848735879-------------99999----999745999999878


Q ss_pred             CCCHHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             69833479782018688999999999999
Q gi|254780669|r  265 HQDPDNAPSDGPNMINIKDLPKLLSQLLA  293 (301)
Q Consensus       265 Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~  293 (301)
                      +-----.-++..+  .++.+.+++++||+
T Consensus       233 aiV~~i~~~~~~~--~~~~i~~f~~~lk~  259 (263)
T CHL00200        233 ACVQILLGSSPEK--GLDQLSEFCKVAKK  259 (263)
T ss_pred             HHHHHHHHCCHHH--HHHHHHHHHHHHHH
T ss_conf             9999998559076--89999999999999


No 165
>PRK11320 prpB 2-methylisocitrate lyase; Provisional
Probab=68.27  E-value=11  Score=18.94  Aligned_cols=51  Identities=18%  Similarity=0.095  Sum_probs=25.9

Q ss_pred             HCCCCEEEECCCCCCC--CCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCC
Q ss_conf             3399706601557688--666322245671248889998866528768852288
Q gi|254780669|r   73 SLNIGLVYKSSFDKAN--RSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHT  124 (301)
Q Consensus        73 ~~~~~~ifK~sfdKan--RtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~  124 (301)
                      +.+...+|-++|--+.  ..-|+- .-+.+++-+...+++.+..++||+-|.-+
T Consensus        35 ~aGF~a~~~sG~~~saa~lG~PD~-gl~t~~e~~~~~~~I~~a~~lPviaD~Dt   87 (292)
T PRK11320         35 RAGFQAIYLSGGGVAAASLGLPDL-GITTLDDVLIDVRRITDACDLPLLVDIDT   87 (292)
T ss_pred             HCCCCEEEECHHHHHHHHCCCCCC-CCCCHHHHHHHHHHHHHCCCCCEEEECCC
T ss_conf             859999996429998885699984-54778899999999983558887987767


No 166
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain. Two types of IDIs have been characterized at present. The long known IDI-1 is only dependent on divalent metals for activity, whereas IDI-2 requires a metal, FMN and NADPH. IDI-2 catalyzes the interconversion of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP) in the mevalonate pathway.
Probab=68.15  E-value=11  Score=18.93  Aligned_cols=138  Identities=19%  Similarity=0.184  Sum_probs=71.2

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEEEEE
Q ss_conf             706999548634999999999999999655339970660155768866632224567124888999886652-8768852
Q gi|254780669|r   43 QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPILTD  121 (301)
Q Consensus        43 ~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv~Te  121 (301)
                      .|| +|+++-.  ..+...++-+.|.+++.+..++..--+ .    |.   ..+.+.   ..+.++-+++.. ..++...
T Consensus        53 ~P~-~I~AMTG--G~~~~~~iN~~LA~aA~~~gi~m~vGS-q----~~---al~~~~---~~~sf~vvR~~~p~~~l~aN  118 (326)
T cd02811          53 APL-LISAMTG--GSEKAKEINRNLAEAAEELGIAMGVGS-Q----RA---ALEDPE---LAESFTVVREAPPNGPLIAN  118 (326)
T ss_pred             CCE-EEECCCC--CCHHHHHHHHHHHHHHHHCCCCEEECC-H----HH---HHCCCC---HHHHHHHHHHHCCCCEEEEE
T ss_conf             875-8875557--975565889999999998199778342-2----88---753921---66567899875887627863


Q ss_pred             C-------CCHHHHHHHHH--HCCEEEECHHHC----------CCHH-----HHHHHHHCCCEEEEEC-CCCCCHHHHHH
Q ss_conf             2-------88999987650--215788225762----------8999-----9999850597799836-77789999999
Q gi|254780669|r  122 V-------HTEQQCEAIAD--SVDILQIPALLC----------RQTD-----LLTAAAQTGRVINVKK-GQFLSPWEMHN  176 (301)
Q Consensus       122 V-------~~~~~~e~~~~--~vDilQIgA~~~----------rqtd-----Ll~a~a~t~kpV~iKk-gq~~s~~e~~~  176 (301)
                      +       ..++++..+-+  -+|-|||-- |.          |++.     +-.-...++.||.+|- |..+|+++.  
T Consensus       119 iga~~l~~~~~~~~~~ai~~l~AdaL~iHl-N~~QE~~~peGDr~f~~~~~~I~~l~~~~~vPVIvKeVG~Gis~eda--  195 (326)
T cd02811         119 LGAVQLNGYGVEEARRAVEMIEADALAIHL-NPLQEAVQPEGDRDFRGWLERIEELVKALSVPVIVKEVGFGISRETA--  195 (326)
T ss_pred             CCCHHHCCCCHHHHHHHHHHCCCCEEEEEC-CHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHH--
T ss_conf             580330456899999999855788578644-60654007898987778999999999847998588524789999999--


Q ss_pred             HHHHHHHCCCCCEEEEECC-CCCC
Q ss_conf             9999972587808995146-5444
Q gi|254780669|r  177 ILQKLHAHGAKDVLFCERG-TSFG  199 (301)
Q Consensus       177 a~eki~~~Gn~~i~lcERG-~~fg  199 (301)
                        .++.+.|.+-|.+--+| |+|.
T Consensus       196 --~~l~~~Gv~~IdVSghGGTnf~  217 (326)
T cd02811         196 --KRLADAGVKAIDVAGAGGTSWA  217 (326)
T ss_pred             --HHHHHCCCCEEEECCCCCCCHH
T ss_conf             --9999679999997899997536


No 167
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to alanine-glyoxylate aminotransferase (AGAT), serine-glyoxylate aminotransferase (SGAT), and 3-hydroxykynurenine transaminase (HKT). AGAT is a homodimeric protein, which catalyses the transamination of glyoxylate to glycine, and SGAT converts serine and glyoxylate to hydroxypyruvate and glycine. HKT catalyzes the PLP-dependent transamination of 3-hydroxykynurenine, a potentially toxic metabolite of the kynurenine pathway.
Probab=68.04  E-value=11  Score=18.91  Aligned_cols=89  Identities=22%  Similarity=0.193  Sum_probs=59.7

Q ss_pred             HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH
Q ss_conf             21578822576289999999850597799836777899999999999972587808995146544401000000010688
Q gi|254780669|r  134 SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM  213 (301)
Q Consensus       134 ~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l  213 (301)
                      -+-++--|+|--|-.++.+..+..-..+-...|...++++...+.   ....-+-|.+++--|+.|--   .|+..+-.+
T Consensus        76 kvlv~~~G~fg~r~~~~a~~~g~~~~~i~~~~~~~~~~~~v~~~l---~~~~~~~v~~~h~etstG~~---~~l~~i~~~  149 (356)
T cd06451          76 KVLVGVNGVFGDRWADMAERYGADVDVVEKPWGEAVSPEEIAEAL---EQHDIKAVTLTHNETSTGVL---NPLEGIGAL  149 (356)
T ss_pred             CEEEEEEEECCCCHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHH---HCCCCCEEEEECCCCCCCCC---CCHHHHHHH
T ss_conf             147885304054167644115972399868999978989999886---33896589996653651014---775889998


Q ss_pred             -HHHCCCEEECHHHHH
Q ss_conf             -851871687117774
Q gi|254780669|r  214 -TSMGVPVIFDASHSV  228 (301)
Q Consensus       214 -k~~~~PVi~D~SHs~  228 (301)
                       |+.+..+++|+++|.
T Consensus       150 ~~~~~~~~~vDavss~  165 (356)
T cd06451         150 AKKHDALLIVDAVSSL  165 (356)
T ss_pred             HHHCCEEEEEECCHHH
T ss_conf             7415727997253110


No 168
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA). HBPHA catalyzes HBP to salicyaldehyde and pyruvate. This reaction is part of the degradative pathways for naphthalene and naphthalenesulfonates by bacteria. CBPHA is homologous to HBPHA and catalyzes the cleavage of CBP to 2-carboxylbenzaldehyde and pyruvate during the degradation of phenanthrene. They are member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=67.50  E-value=11  Score=18.84  Aligned_cols=90  Identities=12%  Similarity=0.171  Sum_probs=58.2

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEEEEECC
Q ss_conf             6999548634999999999999999655339970660155768866632224567124888999886652-876885228
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPILTDVH  123 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv~TeV~  123 (301)
                      ..+|+|- +-.|-....+.++..+++|++..  .+.-|.|          + .+..+.-...++++.+.. ++|++    
T Consensus        78 ~pvi~G~-~~~~t~~ai~~a~~a~~~Gad~~--lv~~P~y----------~-~~~~~~l~~~~~~ia~a~~~lPii----  139 (309)
T cd00952          78 VPVFVGA-TTLNTRDTIARTRALLDLGADGT--MLGRPMW----------L-PLDVDTAVQFYRDVAEAVPEMAIA----  139 (309)
T ss_pred             CEEEECC-CCCHHHHHHHHHHHHHHCCCCEE--EECCCCC----------C-CCCHHHHHHHHHHHHHHCCCCCEE----
T ss_conf             5099605-75059999999999984698999--9888858----------8-999999999999999867899889----


Q ss_pred             CHHHHHHHHHHCCEEEECHHHCCC--HHHHHHHHHCCCEEEEEC
Q ss_conf             899998765021578822576289--999999850597799836
Q gi|254780669|r  124 TEQQCEAIADSVDILQIPALLCRQ--TDLLTAAAQTGRVINVKK  165 (301)
Q Consensus       124 ~~~~~e~~~~~vDilQIgA~~~rq--tdLl~a~a~t~kpV~iKk  165 (301)
                                   ++++|.+.-.+  .+++.++++....|-+|-
T Consensus       140 -------------lYn~P~~tg~~l~~~~~~~La~~pnivgvK~  170 (309)
T cd00952         140 -------------IYANPEAFKFDFPRAAWAELAQIPQVVAAKY  170 (309)
T ss_pred             -------------EEECCCCCCCCCCHHHHHHHHCCCCEEEEEE
T ss_conf             -------------9968640015789999999955999899993


No 169
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional
Probab=67.26  E-value=11  Score=18.81  Aligned_cols=19  Identities=26%  Similarity=0.202  Sum_probs=9.3

Q ss_pred             CHHHHHHHHHHHHHHCCCE
Q ss_conf             3889999999999718988
Q gi|254780669|r  241 ERQYIVPLAKAAVAIGIAG  259 (301)
Q Consensus       241 ~r~~v~~la~aa~a~G~dG  259 (301)
                      ++-+...-+.+|+.+|++.
T Consensus       212 D~GlAvANal~Av~aGA~~  230 (530)
T PRK12344        212 DSGLAVANSLAAVRAGARQ  230 (530)
T ss_pred             CCCHHHHHHHHHHHHCCCC
T ss_conf             9688999999999838060


No 170
>PRK13132 consensus
Probab=67.18  E-value=11  Score=18.80  Aligned_cols=190  Identities=16%  Similarity=0.233  Sum_probs=103.4

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCC-----CCCCCC-CCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-9706601557688-----666322-245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKAN-----RSSLAG-KRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKan-----RtS~~s-frG~Gle~gL~il~e~k~~~glpv  118 (301)
                      .+.||   -=+.|..+++++.+.+.|.++. +|.=|.  -+.|-     |++..+ -.|..+++.+++++++|.+..+-+
T Consensus        16 yitaG---~P~~e~s~~~~~~l~~~GaDiiEiGiPfS--DP~aDGPvIq~A~~~AL~~G~~~~~~~~~~~~ir~~~pivl   90 (246)
T PRK13132         16 YIVAG---YPNLETTKEFLQRLDESPLDILELGIPYS--DPLADGKLIADASFIALQQGVNTDTVFELLARVKTKKALVF   90 (246)
T ss_pred             EEECC---CCCHHHHHHHHHHHHHCCCCEEEECCCCC--CCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCEEE
T ss_conf             88285---89989999999999974999899789888--87655899999999998779989999999997536999799


Q ss_pred             EE---ECCC---HHHHHHHHHH-CCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             85---2288---9999876502-1578822576289-999999850597-799836777899999999999972587808
Q gi|254780669|r  119 LT---DVHT---EQQCEAIADS-VDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAKDV  189 (301)
Q Consensus       119 ~T---eV~~---~~~~e~~~~~-vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~~i  189 (301)
                      +|   .+..   ..-++.+++. +|-+=||---... .++..++.+.+. +|.+=-+  .|++.+    +++.+....=|
T Consensus        91 M~Y~N~i~~~G~e~F~~~~~~~GvdGlIipDLP~ee~~~~~~~~~~~~i~~I~lvaP--Ts~~R~----~~i~~~s~gfi  164 (246)
T PRK13132         91 LVYYNLIFAYGLEKFVKKAKELGISGLIVPDLPFEESEELIKECEKYNIALIPLISV--TSPKRA----KKILKHAKGFI  164 (246)
T ss_pred             EEECHHHHHCCHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEEECC--CCHHHH----HHHHHCCCCCE
T ss_conf             960108877299999999987699857757999789899999999859970144257--978999----99995489827


Q ss_pred             E-EEECCCCCCCHH-HCCCCC-CCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             9-951465444010-000000-10688851-8716871177742122345321263889999999999718988999836
Q gi|254780669|r  190 L-FCERGTSFGYNT-LVTDMR-SIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH  265 (301)
Q Consensus       190 ~-lcERG~~fgy~~-lvvD~~-~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~H  265 (301)
                      . +.-.|+| |-++ +..+.. .+..+|+. ..||++---=+             .++-+.     .+..++||..+=++
T Consensus       165 Y~vs~~GvT-G~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGI~-------------~~e~v~-----~~~~~aDGvIVGSa  225 (246)
T PRK13132        165 YALGSIGVT-GTKSVEEARLKDKVKEIKSFTDLPVAVGFGIK-------------NNQDVK-----RMRKYADGVIVGTS  225 (246)
T ss_pred             EEEECCCCC-CCCCCCHHHHHHHHHHHHHCCCCCEEEECCCC-------------CHHHHH-----HHHHCCCEEEECHH
T ss_conf             997535677-77666368899999999962899869977989-------------999999-----99822999997099


No 171
>PRK06857 consensus
Probab=66.47  E-value=11  Score=18.71  Aligned_cols=113  Identities=19%  Similarity=0.207  Sum_probs=82.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEEEE-ECCCHHHHHH
Q ss_conf             34999999999999999655339970660155768866632224567124888999886652-876885-2288999987
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPILT-DVHTEQQCEA  130 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv~T-eV~~~~~~e~  130 (301)
                      ..++.+++..+++.+.+-|.+.         +.       -.+|.+   .+++.+++++++| ++-|-- -|.+.+|++.
T Consensus        19 r~~~~~~a~~~~~al~~gGi~~---------iE-------iTlrt~---~a~~~I~~l~~~~p~~~vGaGTV~~~e~~~~   79 (209)
T PRK06857         19 AIDDAEDILPLAKVLAENGLPV---------AE-------ITFRSA---AAAEAIRLLREAYPDMLIGAGTVLTPEQVDA   79 (209)
T ss_pred             ECCCHHHHHHHHHHHHHCCCCE---------EE-------EECCCC---CHHHHHHHHHHHCCCCEEEEEECCCHHHHHH
T ss_conf             7599999999999999879988---------99-------958993---2999999999758994899993767999999


Q ss_pred             HHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             650-2157882257628999999985059779983677789999999999997258780899514
Q gi|254780669|r  131 IAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       131 ~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      +.+ .++.+=-|-   -+.++++.+.+.+.|+.   +=.+||.|...|.+    .|.+-+-+---
T Consensus        80 a~~aGA~FiVSP~---~~~~v~~~a~~~~i~~i---PGv~TpsEi~~A~~----~G~~~vKlFPA  134 (209)
T PRK06857         80 AKEAGADFIVSPG---FNPNTVKYCQQLNIPIV---PGVNNPSLVEQALE----MGLTTLKFFPA  134 (209)
T ss_pred             HHHCCCCEEECCC---CCHHHHHHHHHCCCCEE---CCCCCHHHHHHHHH----CCCCEEEECCC
T ss_conf             9983999999089---99999999997499654---78799999999998----79998997866


No 172
>COG5564 Predicted TIM-barrel enzyme, possibly a dioxygenase [General function prediction only]
Probab=66.05  E-value=12  Score=18.66  Aligned_cols=134  Identities=19%  Similarity=0.202  Sum_probs=79.0

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCH
Q ss_conf             99954863499999999999999965533997066015576886663222456712488899988665287688522889
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTE  125 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~  125 (301)
                      .+.||-|...-.-......++|+.++-.-..++---.-+|---|-|+ -..|.|..--+++++++..+ ++-.+-=|-.+
T Consensus        89 pv~aGv~~~DPf~~~~~~L~~L~~~gf~gV~NFPTv~~iDG~~R~~l-EetGmG~~~Evemlr~A~~k-~l~t~~yV~s~  166 (276)
T COG5564          89 PVLAGVNGTDPFCRMVDFLKELKTAGFSGVQNFPTVGLIDGRMRASL-EETGMGYGLEVEMLREAHAK-DLLTTPYVFSF  166 (276)
T ss_pred             CCEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCEEEEECCHHHHHH-HHHCCCHHHHHHHHHHHHHC-CCCCCCEECCH
T ss_conf             42000137894031899999998558864015772577653565148-87385268899999999863-64334243688


Q ss_pred             HHHHHHHH-HCCEEE----------ECHHHCCCH----HHHHHHHHC----CC--EEEEECCCCCCHHHHHHHHHHH
Q ss_conf             99987650-215788----------225762899----999998505----97--7998367778999999999999
Q gi|254780669|r  126 QQCEAIAD-SVDILQ----------IPALLCRQT----DLLTAAAQT----GR--VINVKKGQFLSPWEMHNILQKL  181 (301)
Q Consensus       126 ~~~e~~~~-~vDilQ----------IgA~~~rqt----dLl~a~a~t----~k--pV~iKkgq~~s~~e~~~a~eki  181 (301)
                      .++..+.+ .+||+-          ||||...--    +|.+.++++    .|  .++.--|.-.+|+|-....+++
T Consensus       167 ~eAqa~~~aGadiiv~hmg~ttgG~Igar~~~Sl~~~vel~~~~~~aar~v~kd~i~l~~GGPi~~p~da~yi~d~c  243 (276)
T COG5564         167 EEAQAMTKAGADIIVAHMGLTTGGLIGARSALSLADCVELIELAAEAARGVRKDVIPLCHGGPISMPEDARYILDRC  243 (276)
T ss_pred             HHHHHHHHCCCCEEEECCCCCCCCEECCCCCCCHHHHHHHHHHHHHHHHHHHHCEEEECCCCCCCCCHHHHHHHHHC
T ss_conf             89999987073046503443125501255656788899999999999754301304531478868813557787517


No 173
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional
Probab=65.97  E-value=12  Score=18.65  Aligned_cols=126  Identities=21%  Similarity=0.225  Sum_probs=67.8

Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEEEEECC-------CHHHHH
Q ss_conf             999999999999655339970660155768866632224567124888999886652-876885228-------899998
Q gi|254780669|r   58 DHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPILTDVH-------TEQQCE  129 (301)
Q Consensus        58 e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv~TeV~-------~~~~~e  129 (301)
                      +...++-+.|.+++.+..++..--+ .    |...   +.+   +..+-|+.+|+.. +.+++.-+-       .++++.
T Consensus        73 ~~~~~IN~~LA~~A~~~gi~m~vGS-q----r~al---~~~---~~~~sf~vvR~~~p~~~l~aNiGa~~~~~~~~~~~~  141 (351)
T PRK05437         73 EKAKEINRKLAEAAEELGIAMGVGS-Q----RAAL---KDP---ELADSFSVVRKVAPDGLLFANIGAVQLYGYGVEEAQ  141 (351)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEECC-H----HHHH---CCH---HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHH
T ss_conf             5462899999999998398777331-7----8885---391---456569999986888738861272101435899999


Q ss_pred             HHHH--HCCEEEECHHHC----------CCH----H-HHHHHHHCCCEEEEEC-CCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             7650--215788225762----------899----9-9999850597799836-77789999999999997258780899
Q gi|254780669|r  130 AIAD--SVDILQIPALLC----------RQT----D-LLTAAAQTGRVINVKK-GQFLSPWEMHNILQKLHAHGAKDVLF  191 (301)
Q Consensus       130 ~~~~--~vDilQIgA~~~----------rqt----d-Ll~a~a~t~kpV~iKk-gq~~s~~e~~~a~eki~~~Gn~~i~l  191 (301)
                      .+-+  -+|-|||-- |.          |+|    + +-.-+..++.||.+|- |..+|+++    +.++.+.|.+-|.+
T Consensus       142 ~av~~i~AdAl~iHl-N~~QEl~qpEGDr~f~~~l~~I~~i~~~~~vPVIvKeVG~Gis~e~----a~~l~~~Gv~~IdV  216 (351)
T PRK05437        142 RAVEMIEADALQIHL-NPLQELVQPEGDRDFRGWLDRIAEIVSALPVPVIVKEVGFGISKET----AKRLADAGVKAIDV  216 (351)
T ss_pred             HHHHHHCCCCEEEEC-CCHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH----HHHHHHCCCCEEEE
T ss_conf             999971678157524-6245402888897788999999999986799889852157889999----99999679999995


Q ss_pred             EECC-CCCC
Q ss_conf             5146-5444
Q gi|254780669|r  192 CERG-TSFG  199 (301)
Q Consensus       192 cERG-~~fg  199 (301)
                      --+| |+|.
T Consensus       217 sg~GGTnf~  225 (351)
T PRK05437        217 AGAGGTSWA  225 (351)
T ss_pred             CCCCCCCHH
T ss_conf             799885579


No 174
>PRK13120 consensus
Probab=65.26  E-value=12  Score=18.56  Aligned_cols=217  Identities=15%  Similarity=0.190  Sum_probs=108.1

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEE------CCCCCCCCCCCCCC-CCCCCHHHHHHHHHHHHHH-CC
Q ss_conf             999548634999999999999999655339-970660------15576886663222-4567124888999886652-87
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYK------SSFDKANRSSLAGK-RGVGLKKGREIFRDLKKKY-GF  116 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK------~sfdKanRtS~~sf-rG~Gle~gL~il~e~k~~~-gl  116 (301)
                      .+.||==   +.+...++++.+.+.|++.. +|.=|-      |..-.|+   ..+. .|..+++.|++++++|.+. ..
T Consensus        26 yitaG~P---~~~~t~~~l~~l~~~GaDiiElGiPFSDPvADGPvIQ~A~---~rAL~~G~~l~~vl~~v~~~r~~~~~~   99 (285)
T PRK13120         26 YIAAGDP---SPQATVPLMHALVRAGADLVELGVPFSDPMADGPVVQRAA---ERAIAQGVGLRRVLELVADFRRDDSVT   99 (285)
T ss_pred             EECCCCC---CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHH---HHHHHCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             8578589---9899999999999769999997898787456689999999---999976998446999999987348988


Q ss_pred             EEEE--ECC------CHHHHHHHHHH-CCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCC
Q ss_conf             6885--228------89999876502-1578822576289-999999850597-79983677789999999999997258
Q gi|254780669|r  117 PILT--DVH------TEQQCEAIADS-VDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHG  185 (301)
Q Consensus       117 pv~T--eV~------~~~~~e~~~~~-vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~G  185 (301)
                      |++-  =.-      ...-++.+++. +|-+=||----.. .++..++.+.|. +|.+=-+ ..+.+.+    ++|.+..
T Consensus       100 PivlM~Y~Npi~~yG~e~F~~~~~~aGvdGlIIpDLP~EE~~~~~~~~~~~gi~~I~LiaP-tT~~eRi----~~I~~~s  174 (285)
T PRK13120        100 PVVLMGYANPIERMGQRAFAQAAQAAGVDGVLVVDYPPEEVDEFAAMLAEAGVAPIFLLAP-TSTEARI----EAIGRVA  174 (285)
T ss_pred             CEEEEEHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEEECC-CCCHHHH----HHHHHHC
T ss_conf             8898610549999879999999998398779647999799999999999669965899579-9989999----9999508


Q ss_pred             CCC-EEEEECCCCCCCHHH-CCCC-CCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEE
Q ss_conf             780-899514654440100-0000-01068885-1871687117774212234532126388999999999971898899
Q gi|254780669|r  186 AKD-VLFCERGTSFGYNTL-VTDM-RSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF  261 (301)
Q Consensus       186 n~~-i~lcERG~~fgy~~l-vvD~-~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlf  261 (301)
                      .-= ..+.-.|+| |-.+. ..++ ..+..+|+ +.+||++---=|             .++-+..+     ...+||+.
T Consensus       175 ~GFvY~VS~~GVT-G~~~~~~~~l~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~v~~~-----~~~ADGvI  235 (285)
T PRK13120        175 RGYVYYVSLKGVT-GAGSLDTDDVARKLALIRRHVHIPVGVGFGIR-------------DAASAQRI-----AAHADAVV  235 (285)
T ss_pred             CCCEEEEECCCCC-CCCCCCHHHHHHHHHHHHHCCCCCEEEEECCC-------------CHHHHHHH-----HCCCCEEE
T ss_conf             9818998656546-88755668899999999972699759996259-------------89999999-----70299999


Q ss_pred             EE--------ECCCHHHCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             98--------3698334797820186889999999999999
Q gi|254780669|r  262 LE--------THQDPDNAPSDGPNMINIKDLPKLLSQLLAI  294 (301)
Q Consensus       262 iE--------~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~i  294 (301)
                      +=        -|.++..+..|  ---....+.+++.++++=
T Consensus       236 VGSAiVk~Iee~~~~~~~~~~--~~~~~~~~~~~~~~~~~a  274 (285)
T PRK13120        236 IGSKLIETMEQAGAQAGADQK--NEAAIAAAQQWLHTIRLA  274 (285)
T ss_pred             ECHHHHHHHHHCCCCCCCCCC--HHHHHHHHHHHHHHHHHH
T ss_conf             878999999970754565556--889999999999999999


No 175
>PRK08904 consensus
Probab=64.69  E-value=12  Score=18.49  Aligned_cols=110  Identities=18%  Similarity=0.197  Sum_probs=81.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCEEEE-ECCCHHHHHH
Q ss_conf             34999999999999999655339970660155768866632224567124888999886652-876885-2288999987
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFPILT-DVHTEQQCEA  130 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glpv~T-eV~~~~~~e~  130 (301)
                      .+++.+++..+++.+.+.|.+.         +.       -.+|.+   .+++.+++++++| ++-|-. -|.+.+|++.
T Consensus        17 r~~~~~~a~~~a~al~~~Gi~~---------iE-------iTlrtp---~a~~~i~~l~~~~p~~~vGaGTVl~~e~~~~   77 (207)
T PRK08904         17 AIDDLSTAVDLSRALVEGGIPT---------LE-------ITLRTP---VGLDAIRLIAKEVPNAIVGAGTVTNPEQLKA   77 (207)
T ss_pred             ECCCHHHHHHHHHHHHHCCCCE---------EE-------EECCCC---HHHHHHHHHHHHCCCCEEEEEECCCHHHHHH
T ss_conf             7699999999999999879988---------99-------957991---3999999999868987685531368999999


Q ss_pred             HHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             650-2157882257628999999985059779983677789999999999997258780899
Q gi|254780669|r  131 IAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLF  191 (301)
Q Consensus       131 ~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~l  191 (301)
                      +.+ .++.+=-|.   -+.++++.+.+.+.|+.   +=-+||.|...|.+    .|.+-+-+
T Consensus        78 a~~aGA~FiVSP~---~~~~v~~~a~~~~i~~i---PGv~TpsEi~~A~~----~G~~~vK~  129 (207)
T PRK08904         78 VEDAGAVFAISPG---LHESLAKAGHNSGIPLI---PGVATPGEIQLALE----HGIDTLKL  129 (207)
T ss_pred             HHHCCCCEEECCC---CCHHHHHHHHHCCCCEE---CCCCCHHHHHHHHH----CCCCEEEE
T ss_conf             9984999998489---98999999998399765---78699999999998----79998997


No 176
>KOG0069 consensus
Probab=64.69  E-value=12  Score=18.49  Aligned_cols=85  Identities=20%  Similarity=0.378  Sum_probs=57.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHH-------------HHHHHHHHCCEEEECHHH------CCCHHHHHHH
Q ss_conf             224567124888999886652876885228899-------------998765021578822576------2899999998
Q gi|254780669|r   94 GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQ-------------QCEAIADSVDILQIPALL------CRQTDLLTAA  154 (301)
Q Consensus        94 sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~-------------~~e~~~~~vDilQIgA~~------~rqtdLl~a~  154 (301)
                      +.=|+| .-|-.+.++++. ||..+...-....             +++.++...|+|=|--.+      .-|-+++.+.
T Consensus       166 gilG~G-~IG~~ia~rL~~-Fg~~i~y~~r~~~~~~~~~~~~~~~~d~~~~~~~sD~ivv~~pLt~~T~~liNk~~~~~m  243 (336)
T KOG0069         166 GILGLG-RIGKAIAKRLKP-FGCVILYHSRTQLPPEEAYEYYAEFVDIEELLANSDVIVVNCPLTKETRHLINKKFIEKM  243 (336)
T ss_pred             EEECCC-HHHHHHHHHHHH-CCCEEEEECCCCCCHHHHHHHCCCCCCHHHHHHHCCEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             996274-788999996353-266255411357763668874354367888873288799926897788877609999864


Q ss_pred             HHCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             50597799836777899999999999
Q gi|254780669|r  155 AQTGRVINVKKGQFLSPWEMHNILQK  180 (301)
Q Consensus       155 a~t~kpV~iKkgq~~s~~e~~~a~ek  180 (301)
                      .+....||+.||--+.-+++.-|++.
T Consensus       244 k~g~vlVN~aRG~iide~~l~eaL~s  269 (336)
T KOG0069         244 KDGAVLVNTARGAIIDEEALVEALKS  269 (336)
T ss_pred             CCCEEEEECCCCCCCCHHHHHHHHHC
T ss_conf             79769996464240259999978753


No 177
>pfam00701 DHDPS Dihydrodipicolinate synthetase family. This family has a TIM barrel structure.
Probab=64.63  E-value=12  Score=18.48  Aligned_cols=90  Identities=17%  Similarity=0.216  Sum_probs=39.6

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCC
Q ss_conf             69995486349999999999999996553399706601557688666322245671248889998866528768852288
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHT  124 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~  124 (301)
                      ..+|+|--+ .|-+...+.|+..++.|.+..  .+.=|.|          |+ +..++-.+.++++.+..++|++-    
T Consensus        71 ~pvi~gv~~-~st~~~i~~a~~A~~~Gad~i--~v~pP~y----------~~-~~~~~i~~~~~~va~a~~lPi~i----  132 (289)
T pfam00701        71 IPVIAGTGS-NSTREAIHLAQLAEAAGADGV--LAVTPYY----------NK-PSQEGLYQHFKAIAAATDLPVIL----  132 (289)
T ss_pred             CEEEECCCC-CCHHHHHHHHHHHHHCCCCEE--EECCCCC----------CC-CCHHHHHHHHHHHHHCCCCCEEE----
T ss_conf             628637888-789999999999997499978--8779988----------89-99999999999998315997799----


Q ss_pred             HHHHHHHHHHCCEEEECHHH--CCCHHHHHHHHHCCCEEEEEC
Q ss_conf             99998765021578822576--289999999850597799836
Q gi|254780669|r  125 EQQCEAIADSVDILQIPALL--CRQTDLLTAAAQTGRVINVKK  165 (301)
Q Consensus       125 ~~~~e~~~~~vDilQIgA~~--~rqtdLl~a~a~t~kpV~iKk  165 (301)
                                   .++|.+.  --..+++.++++....+-+|-
T Consensus       133 -------------Yn~P~~tg~~l~~~~l~~L~~~~~i~giK~  162 (289)
T pfam00701       133 -------------YNVPSRTGQDLTPETIERLAECPNVVGVKD  162 (289)
T ss_pred             -------------EECCCCCCCCCCHHHHHHHHCCCCEEEEEE
T ss_conf             -------------715654033679999999826899899996


No 178
>PRK13135 consensus
Probab=64.59  E-value=12  Score=18.48  Aligned_cols=217  Identities=16%  Similarity=0.149  Sum_probs=114.3

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCC-----CCCCCC-CCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-9706601557688-----666322-245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKAN-----RSSLAG-KRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKan-----RtS~~s-frG~Gle~gL~il~e~k~~~glpv  118 (301)
                      .+.||=   -+.+...++.+.+.+.|+++. +|.=|.  -+.|-     +++..+ -.|..+++-++++++++++.+.|+
T Consensus        22 yitaG~---P~~~~s~~~l~~l~~~GaDiiElGiPfS--DP~ADGPvIq~A~~rAL~~G~~~~~~~~~~~~~r~~~~~Pi   96 (267)
T PRK13135         22 FITAGD---PDLATTEALIPLLAESGADIIELGVPFS--DPMADGPTIQLSSERALAAGTTLPRILAMVRSVRRRCQVPI   96 (267)
T ss_pred             EECCCC---CCHHHHHHHHHHHHHCCCCEEEECCCCC--CCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             871718---9989999999999975999999789989--86665899999999999769849999999998633589988


Q ss_pred             EEE--CC------CHHHHHHHHHH-CCEEEECHHHCCCH-HHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             852--28------89999876502-15788225762899-99999850597-7998367778999999999999725878
Q gi|254780669|r  119 LTD--VH------TEQQCEAIADS-VDILQIPALLCRQT-DLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       119 ~Te--V~------~~~~~e~~~~~-vDilQIgA~~~rqt-dLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      +-=  .-      ..+-++.+++. +|-+=||-..-... ++..++.+.+. +|.+=-+  .|.++.+   +++.+...-
T Consensus        97 vlM~Y~N~i~~yG~e~F~~~~~~~GvdGlIipDLP~ee~~~~~~~~~~~~l~~I~lvsP--tt~~~Ri---~~i~~~s~G  171 (267)
T PRK13135         97 VLMGYYNPIFAYGLERFAADAAAAGVDGVLLVDLPPEEAEEFKACADRHGLDVIFLLTP--TSDESRI---RTVARLGRG  171 (267)
T ss_pred             EEEECCHHHHHHHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEEECC--CCCHHHH---HHHHHCCCC
T ss_conf             99842309988468999999997499747637899788899999998729618998089--8957999---999961898


Q ss_pred             CE-EEEECCCCCCCHHHCCCC-CCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             08-995146544401000000-01068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  188 DV-LFCERGTSFGYNTLVTDM-RSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       188 ~i-~lcERG~~fgy~~lvvD~-~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      =| .+.-+|+|=....+..++ ..+..+|+ +..||++---=+             .+|-+.     .+..++||+.+=+
T Consensus       172 FiY~Vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGI~-------------~~e~v~-----~i~~~ADGvIVGS  233 (267)
T PRK13135        172 FVYYVSVTGVTGARSGVEATVGGNVAKIREKITVPVVVGFGIS-------------TPQQAA-----DVAAMADGVVVGS  233 (267)
T ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-------------CHHHHH-----HHHCCCCEEEECH
T ss_conf             1899854566677644448899999999860689848981679-------------999999-----9980599999878


Q ss_pred             CCCHHHCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             6983347978201868899999999999
Q gi|254780669|r  265 HQDPDNAPSDGPNMINIKDLPKLLSQLL  292 (301)
Q Consensus       265 Hp~P~~AlsD~~q~l~l~~l~~ll~~l~  292 (301)
                      +-----.-+.+..  .++++.+++++|+
T Consensus       234 aiVk~ie~~~~~~--~~~~i~~fv~~lk  259 (267)
T PRK13135        234 ALVKLFELHRGEE--LRQEVATFVASLR  259 (267)
T ss_pred             HHHHHHHHCCCHH--HHHHHHHHHHHHH
T ss_conf             9999998608187--8999999999999


No 179
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain. LMO is a FMN-containing enzyme that catalyzes the conversion of L-lactate and oxygen to acetate, carbon dioxide, and water. LMO is a member of the family of alpha-hydroxy acid oxidases.  It is thought to be a homooctamer with two- and four- fold axes in the center of the octamer.
Probab=64.47  E-value=12  Score=18.47  Aligned_cols=43  Identities=12%  Similarity=0.125  Sum_probs=19.7

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHH
Q ss_conf             3222456712488899988665287688522889999876502
Q gi|254780669|r   92 LAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADS  134 (301)
Q Consensus        92 ~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~  134 (301)
                      |-+++++...+|-..+.++..++|+|.+---+...-+|.+++.
T Consensus        92 P~g~~~l~hp~gE~~~AraA~~~g~~~~lSt~ss~slEeva~~  134 (383)
T cd03332          92 PIGVQELFHPDAELATARAAAELGVPYILSTASSSSIEDVAAA  134 (383)
T ss_pred             HHHHHHCCCCCHHHHHHHHHHHHCCCEECCCCCCCCHHHHHHH
T ss_conf             7877441489778999999998358622057767889999986


No 180
>PRK03170 dihydrodipicolinate synthase; Provisional
Probab=64.45  E-value=12  Score=18.46  Aligned_cols=91  Identities=14%  Similarity=0.173  Sum_probs=53.0

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCC
Q ss_conf             69995486349999999999999996553399706601557688666322245671248889998866528768852288
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHT  124 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~  124 (301)
                      ..+|+|-.+. |-+...+.|+..++.|++..  .+.-|          +.|+ +.-+.-.++++++.+..++|++     
T Consensus        71 ~pvi~gv~~~-~t~~~i~~a~~A~~~Gadav--~v~~P----------~y~~-~s~~~l~~~f~~ia~~~~~Pi~-----  131 (292)
T PRK03170         71 VPVIAGTGSN-STAEAIELTKFAEKAGADGA--LVVTP----------YYNK-PTQEGLYQHFKAIAEATDLPII-----  131 (292)
T ss_pred             CEEEECCCCC-CHHHHHHHHHHHHHCCCCEE--EECCC----------CCCC-CCHHHHHHHHHHHHHCCCCCEE-----
T ss_conf             1288437876-79999999998987599989--96177----------6889-9999999999999863599769-----


Q ss_pred             HHHHHHHHHHCCEEEECHHHCC--CHHHHHHHHHCCCEEEEECC
Q ss_conf             9999876502157882257628--99999998505977998367
Q gi|254780669|r  125 EQQCEAIADSVDILQIPALLCR--QTDLLTAAAQTGRVINVKKG  166 (301)
Q Consensus       125 ~~~~e~~~~~vDilQIgA~~~r--qtdLl~a~a~t~kpV~iKkg  166 (301)
                                  +..+|.+.-.  ..+++.++++....+-||-.
T Consensus       132 ------------lYn~P~~tg~~l~~~~l~~L~~~~nv~giKds  163 (292)
T PRK03170        132 ------------LYNVPGRTGVDILPETVARLAEHPNIVGIKEA  163 (292)
T ss_pred             ------------EEECCCCCCCCCCHHHHHHHHCCCCEEEEEEC
T ss_conf             ------------87378632767699999998178998999969


No 181
>pfam00682 HMGL-like HMGL-like. This family contains a diverse set of enzymes. These include various aldolases and a region of pyruvate carboxylase.
Probab=64.42  E-value=12  Score=18.46  Aligned_cols=118  Identities=14%  Similarity=0.139  Sum_probs=65.9

Q ss_pred             HHHHHHHHCCCEEEEEC--CCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCC-CCCHHHHH-HC-CCEEEC
Q ss_conf             99999850597799836--777899999999999972587808995146544401000000-01068885-18-716871
Q gi|254780669|r  149 DLLTAAAQTGRVINVKK--GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM-RSIPIMTS-MG-VPVIFD  223 (301)
Q Consensus       149 dLl~a~a~t~kpV~iKk--gq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~-~~i~~lk~-~~-~PVi~D  223 (301)
                      +.+..+.+.+..|.+--  .--.+++.+...++.+.+.|.+.|.||.--   |+-+= .+. .-+..+++ +. .|+-+ 
T Consensus       112 ~~i~~a~~~g~~v~f~~~~~~~~~~~~~~~~~~~~~~~G~~~i~l~DT~---G~~~P-~~v~~lv~~l~~~~~~~~i~~-  186 (237)
T pfam00682       112 AAVEAARSAGIDVELGCEDAGRTDLAFLIEVVEVAQEAGATRINIADTV---GVLTP-NEAADLISALKDRVPPVIIEV-  186 (237)
T ss_pred             HHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEECCCC---CCCCH-HHHHHHHHHHHHCCCCCCEEE-
T ss_conf             9999999869905884051232478899999999986198579736864---55798-999999999997089871588-


Q ss_pred             HHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             177742122345321263889999999999718988999836983347978201868899999999
Q gi|254780669|r  224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLS  289 (301)
Q Consensus       224 ~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~  289 (301)
                      =.|             -.+-+...-+.+|+.+|++.+  ++--..   +.-+.-..+++++-.+|+
T Consensus       187 H~H-------------n~~Gla~aN~l~A~~aG~~~i--d~si~G---lG~~~Gn~~te~lv~~L~  234 (237)
T pfam00682       187 HCH-------------NDLGMAVANSLAAVEAGADRV--DGTVNG---LGERAGNAALEELVAALE  234 (237)
T ss_pred             EEC-------------CCCCHHHHHHHHHHHHCCCEE--EECCCC---CCCCCCCHHHHHHHHHHH
T ss_conf             744-------------886729999999999689999--877503---155426764999999998


No 182
>PRK12331 oxaloacetate decarboxylase; Provisional
Probab=64.26  E-value=13  Score=18.44  Aligned_cols=185  Identities=16%  Similarity=0.135  Sum_probs=95.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH------------HCCEEEE-E
Q ss_conf             99999999999999965533997066015576886663222456712488899988665------------2876885-2
Q gi|254780669|r   55 ESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKK------------YGFPILT-D  121 (301)
Q Consensus        55 ES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~------------~glpv~T-e  121 (301)
                      =+.++.+.+|+.+.++|.... -.-.-++||-+.|     |-+..--+.|+.+++.-..            .|..-.- +
T Consensus        23 ~~~~d~l~IA~~ld~~Gv~si-E~~GgAtfd~~~r-----~l~Edpwerlr~i~~~~~nt~lq~LlRg~n~vGy~~~pdd   96 (463)
T PRK12331         23 MTTEEMLPILEKLDNAGYHSL-EMWGGATFDACLR-----FLNEDPWERLRAIRKAVKNTKLQMLLRGQNLLGYRNYADD   96 (463)
T ss_pred             CCHHHHHHHHHHHHHCCCCEE-ECCCCCCHHHHHH-----HHCCCHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCH
T ss_conf             789999999999986398489-8477711999999-----8588989999999986788456898700332431137808


Q ss_pred             CCCHHHHHHHHH-HCCEEEECHHH--CCCH-HHHHHHHHCCCE----EEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             288999987650-21578822576--2899-999998505977----998367778999999999999725878089951
Q gi|254780669|r  122 VHTEQQCEAIAD-SVDILQIPALL--CRQT-DLLTAAAQTGRV----INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCE  193 (301)
Q Consensus       122 V~~~~~~e~~~~-~vDilQIgA~~--~rqt-dLl~a~a~t~kp----V~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcE  193 (301)
                      |.+ ..++..++ .+|+++|=-.+  .||. .-++++.+.|+-    |-.-.....+++-+...++.+.+.|.+.|-++.
T Consensus        97 vv~-~~v~~a~~~Gidv~rifd~lndi~nl~~ai~~~k~~G~~~~~~i~yt~sp~~t~~yyv~~a~~l~~~Gad~I~ikD  175 (463)
T PRK12331         97 VVE-SFVQKSIENGIDIIRIFDALNDVRNLQTAVKATKKAGGHAQVAISYTTSPVHTIDYFVKLAKEMQEIGADSICIKD  175 (463)
T ss_pred             HHH-HHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             999-9999999859997887405664677899999999707869999997258867699999999999964998899867


Q ss_pred             CC-CCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             46-54440100000001068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  194 RG-TSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       194 RG-~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      -. ....+..    ..-|..+|+ .++||-+- ||.+             .-+...-..||+-+|+|.+=.-.
T Consensus       176 ~aGll~P~~~----~eLV~aLk~~~~lpI~~H-tH~t-------------~Gla~an~laAieAGaDivD~a~  230 (463)
T PRK12331        176 MAGILTPYVA----YELVKCIKENVTVPLEVH-THAT-------------SGIAEMTYLKAIEAGADIIDTAI  230 (463)
T ss_pred             CCCCCCHHHH----HHHHHHHHHHCCCCEEEE-ECCC-------------CCHHHHHHHHHHHCCCCEEEECC
T ss_conf             8677688999----999999997449856998-3688-------------75799999999984999996235


No 183
>TIGR02153 gatD_arch glutamyl-tRNA(Gln) amidotransferase, subunit D; InterPro: IPR011878    This peptide is found only in the Archaea. It is part of a heterodimer, with GatD (IPR004414 from INTERPRO), that acts as an amidotransferase on misacylated Glu-tRNA(Gln) to produce Gln-tRNA(Gln). The analogous amidotransferase found in bacteria is the GatABC system, although GatABC homologs in the Archaea appear to act instead on Asp-tRNA(Asn) .; GO: 0006450 regulation of translational fidelity.
Probab=64.11  E-value=13  Score=18.42  Aligned_cols=88  Identities=23%  Similarity=0.380  Sum_probs=50.7

Q ss_pred             CCCCHHHHHHHHHHHH---HCCCCCEEEEECCC-CCCCHHHCCCCCCCHHHHHH--CCCEEECHHH-HHHHCCCCCCCCC
Q ss_conf             7789999999999997---25878089951465-44401000000010688851--8716871177-7421223453212
Q gi|254780669|r  167 QFLSPWEMHNILQKLH---AHGAKDVLFCERGT-SFGYNTLVTDMRSIPIMTSM--GVPVIFDASH-SVQQPGIHGNCSG  239 (301)
Q Consensus       167 q~~s~~e~~~a~eki~---~~Gn~~i~lcERG~-~fgy~~lvvD~~~i~~lk~~--~~PVi~D~SH-s~q~p~~~~~~~g  239 (301)
                      =-|.|+.|..+|+.+.   +.|+..|++.| || |..|.     -.++..|=+.  .-||||==+- |-=||      |.
T Consensus       121 ENMkP~~W~~IA~~V~~al~~G~~GVVvaH-GTDTM~YT-----AaALSFm~~~Gl~~PvVlVGAQRSSDRP------SS  188 (413)
T TIGR02153       121 ENMKPEYWIKIAEAVAKALEEGADGVVVAH-GTDTMAYT-----AAALSFMFKTGLPVPVVLVGAQRSSDRP------SS  188 (413)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCEEEEEE-CCCHHHHH-----HHHHHHHHHCCCCCCEEEECCCCCCCCC------CC
T ss_conf             788858999999999998408995389941-58746899-----9999999971699988998574358887------31


Q ss_pred             CCHHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             638899999999997189889998369
Q gi|254780669|r  240 GERQYIVPLAKAAVAIGIAGIFLETHQ  266 (301)
Q Consensus       240 G~r~~v~~la~aa~a~G~dGlfiE~Hp  266 (301)
                      .-+.-...-+++|..+-+..+.+=.|=
T Consensus       189 DAa~NL~~A~~~A~~a~~aEV~VvMHG  215 (413)
T TIGR02153       189 DAALNLIAAVRAATSAPIAEVVVVMHG  215 (413)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEEC
T ss_conf             379999999998336971003888401


No 184
>pfam02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II.
Probab=63.97  E-value=13  Score=18.40  Aligned_cols=75  Identities=21%  Similarity=0.355  Sum_probs=37.4

Q ss_pred             CHHHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCC-CCCCCC
Q ss_conf             0100000001068885187168711777421223453212638899999999997189889998369833479-782018
Q gi|254780669|r  200 YNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP-SDGPNM  278 (301)
Q Consensus       200 y~~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~Al-sD~~q~  278 (301)
                      |-..+...-....+++..+.|++|+-|.+            -..+++.+.+.   +|++-  ++.|..|+--. .-.|..
T Consensus         3 Y~~~l~~~i~~~~i~~~~lkv~vD~~~G~------------~~~~~~~ll~~---lg~~~--~~~~~~~d~~f~~~~p~P   65 (103)
T pfam02879         3 YIDRLASAFDLEALKKRGLKVVYDPLHGV------------GGEILPELLKR---LGAEV--VEENCEPDGDFPTKAPNP   65 (103)
T ss_pred             HHHHHHHHCCHHHHHCCCCEEEEECCCCC------------HHHHHHHHHHH---CCCEE--EEECCCCCCCCCCCCCCC
T ss_conf             89999986799997168988999778863------------58999999998---69989--994365699879929399


Q ss_pred             CCHHHHHHHHHHH
Q ss_conf             6889999999999
Q gi|254780669|r  279 INIKDLPKLLSQL  291 (301)
Q Consensus       279 l~l~~l~~ll~~l  291 (301)
                      ..++.+..+.+.+
T Consensus        66 ~~~~~l~~~~~~v   78 (103)
T pfam02879        66 EEPEALELLIELV   78 (103)
T ss_pred             CCHHHHHHHHHHH
T ss_conf             8454799999987


No 185
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.
Probab=63.28  E-value=13  Score=18.32  Aligned_cols=76  Identities=20%  Similarity=0.196  Sum_probs=28.9

Q ss_pred             HHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             99999972587808995146544401000000010688851871687117774212234532126388999999999971
Q gi|254780669|r  176 NILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAI  255 (301)
Q Consensus       176 ~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~  255 (301)
                      ..++++...|.++|.+......||..-  .+. -...+++.+..|+..-++..           |..+|-+.+.+ ..+.
T Consensus       127 ~~a~~~~~~g~kkvail~~~~~yG~~~--~~~-~~~~~~~~G~~vv~~~~~~~-----------~~~Dfs~~l~k-i~~~  191 (312)
T cd06346         127 ALAQLAAERGYKSVATTYINNDYGVGL--ADA-FTKAFEALGGTVTNVVAHEE-----------GKSSYSSEVAA-AAAG  191 (312)
T ss_pred             HHHHHHHHHCCCEEEEEEECCHHHHHH--HHH-HHHHHHHCCCEEEEEEECCC-----------CCCCHHHHHHH-HHHC
T ss_conf             999999982996489999577266999--999-99999987998999996699-----------98455999999-9866


Q ss_pred             CCCEEEEEECC
Q ss_conf             89889998369
Q gi|254780669|r  256 GIAGIFLETHQ  266 (301)
Q Consensus       256 G~dGlfiE~Hp  266 (301)
                      +.|.+|+=.++
T Consensus       192 ~pD~v~~~~~~  202 (312)
T cd06346         192 GPDALVVIGYP  202 (312)
T ss_pred             CCCEEEEECCC
T ss_conf             99999994673


No 186
>PRK07084 fructose-bisphosphate aldolase; Provisional
Probab=62.76  E-value=13  Score=18.26  Aligned_cols=115  Identities=16%  Similarity=0.246  Sum_probs=56.3

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC-CH----HH--CCCCCCCHHHHH-H-CCCEEECHHHH-----HHHC
Q ss_conf             7778999999999999725878089951465444-01----00--000001068885-1-87168711777-----4212
Q gi|254780669|r  166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFG-YN----TL--VTDMRSIPIMTS-M-GVPVIFDASHS-----VQQP  231 (301)
Q Consensus       166 gq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg-y~----~l--vvD~~~i~~lk~-~-~~PVi~D~SHs-----~q~p  231 (301)
                      ..+.+|+|   |.+.+..+|. +.+..-=|+..| |.    ..  ..|+.-+..+++ . +.|.++.-+-+     +++-
T Consensus       161 ~~yT~Pee---a~~Fv~~Tgv-D~LAvaiGt~HG~Yk~~~~~~~p~L~~d~L~~I~~~v~~vPLVLHGgS~~p~~~v~~~  236 (321)
T PRK07084        161 HTYTQPEE---VEDFVTKTGV-DSLAISIGTSHGAFKFKPGECPPPLRFDILAEIEKRIPGFPIVLHGASSVPQELVETI  236 (321)
T ss_pred             HHCCCHHH---HHHHHHHHCC-CEEEEECCHHCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHH
T ss_conf             20599999---9999998699-8586420100367667888887443699999999857799868528998827887778


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCH------HHCCCCCCCCCCHHHH
Q ss_conf             2345321263889999999999718988999836983------3479782018688999
Q gi|254780669|r  232 GIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP------DNAPSDGPNMINIKDL  284 (301)
Q Consensus       232 ~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P------~~AlsD~~q~l~l~~l  284 (301)
                      ...|+...+..-.-...-+.|+..|+.=+=|-|.-.=      .+.+.+.+..++|-.+
T Consensus       237 ~~~Gg~~~~~~G~~de~i~~Ai~~GI~KvNi~Tdl~~a~~~~ir~~l~~~p~~~Dpr~~  295 (321)
T PRK07084        237 NQHGGKLKDAIGIPEEQLRKAAKSAVCKINIDSDGRLAMTAAIRKVLDEKPEEFDPRKY  295 (321)
T ss_pred             HHCCCCCCCCCCCCHHHHHHHHHCCCEEEEECHHHHHHHHHHHHHHHHHCCCCCCHHHH
T ss_conf             75288555678999999999998697699818078999999999999869776896999


No 187
>PRK13137 consensus
Probab=62.42  E-value=14  Score=18.22  Aligned_cols=192  Identities=19%  Similarity=0.216  Sum_probs=98.7

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCC-----CCCCCC-CCCCCCHHHHHHHHHHHHHHCCEEE
Q ss_conf             9995486349999999999999996553399706601557688-----666322-2456712488899988665287688
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKAN-----RSSLAG-KRGVGLKKGREIFRDLKKKYGFPIL  119 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKan-----RtS~~s-frG~Gle~gL~il~e~k~~~glpv~  119 (301)
                      ++.||==   +.+..+++++.+.+-++-+.+|.-|-  -+-|-     ++|..+ -.|..+++.++++++++++...|++
T Consensus        30 yitaG~P---~~~~s~~~~~~l~~gaDiiElGiPFS--DP~ADGPvIQ~A~~~AL~~G~~l~~~l~~~~~~r~~~~~Piv  104 (266)
T PRK13137         30 FLTAGYP---SAAGFLQVAEELLAYADLLEVGIPYS--DPLGDGPTIQRASEQALAGGTSTRRTLELVRELRALTDTPLV  104 (266)
T ss_pred             EECCCCC---CHHHHHHHHHHHHCCCCEEEECCCCC--CCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCEE
T ss_conf             8668188---87899999999973899899789988--856657999999999997798677899999975556898789


Q ss_pred             EE-CCC-------HHHHHHHHHH-CCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             52-288-------9999876502-1578822576289-999999850597-79983677789999999999997258780
Q gi|254780669|r  120 TD-VHT-------EQQCEAIADS-VDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAKD  188 (301)
Q Consensus       120 Te-V~~-------~~~~e~~~~~-vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~~  188 (301)
                      -= -.+       ..-++.+++. +|-+=||----.. .++..++.+.+. +|.+=-+ ..+.+.+..    +.+....=
T Consensus       105 lM~Y~N~i~~yG~e~F~~~a~~aGvdGlIipDLP~eE~~~~~~~~~~~gi~~I~lvaP-tT~~eRi~~----i~~~a~GF  179 (266)
T PRK13137        105 IMTYLNPIYAVGPEEFMRLFQEAGVDGLILPDLPPDQDPEIADLAAEIGLAVTFLIAP-TSTPERVKL----VARACTGF  179 (266)
T ss_pred             EEECHHHHHHHCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEECC-CCCHHHHHH----HHHHCCCC
T ss_conf             9934589987589999999997696099947999788899999998759978999379-999999999----99608882


Q ss_pred             EE-EEECCCCCCCHHHCC-CCC-CCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             89-951465444010000-000-1068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  189 VL-FCERGTSFGYNTLVT-DMR-SIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       189 i~-lcERG~~fgy~~lvv-D~~-~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      |. +.-.|+|-..+.+.. ++. .+..+|+ +..||++---=|             .++-+..+     .-.+||+.+=+
T Consensus       180 iY~Vs~~GvTG~r~~~~~~~l~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~~~~~-----~~~aDGvIVGS  241 (266)
T PRK13137        180 LYAVSVTGVTGMREGLALGEVPDMLRLARQYAALPVAVGFGVK-------------DKATAAQV-----AQVADGVVVGS  241 (266)
T ss_pred             EEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCC-------------CHHHHHHH-----HHHCCEEEEHH
T ss_conf             8997446766777667879999999999863899879982669-------------88999999-----83199999809


Q ss_pred             C
Q ss_conf             6
Q gi|254780669|r  265 H  265 (301)
Q Consensus       265 H  265 (301)
                      +
T Consensus       242 a  242 (266)
T PRK13137        242 A  242 (266)
T ss_pred             H
T ss_conf             9


No 188
>PRK13112 consensus
Probab=62.21  E-value=14  Score=18.20  Aligned_cols=220  Identities=16%  Similarity=0.180  Sum_probs=113.6

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEE------CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCE
Q ss_conf             999548634999999999999999655339-970660------155768866632224567124888999886652-876
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYK------SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFP  117 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK------~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glp  117 (301)
                      ++.||=   -+.+...++++.+.+.|++.. +|.-|-      |..-+|+.-+.  -.|..+++.+++++++++++ .+|
T Consensus        23 yitaG~---P~~~~s~~~l~~l~~~GaDiiElGiPFSDPvADGPvIQ~A~~rAL--~~G~~~~~~~~~~~~ir~~~~~~P   97 (279)
T PRK13112         23 YFMGGD---PDLETSLKIMKALPKAGADIIELGMPFSDPMADGPAIQAAGLRAL--KAGQTLAKTLYLAREFRKDDDTTP   97 (279)
T ss_pred             EEECCC---CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             860738---997899999999987799989978998986665799999999999--769968899999998513489988


Q ss_pred             EE--EECC-----C-HHHHHHHHHH-CCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             88--5228-----8-9999876502-1578822576289-999999850597-799836777899999999999972587
Q gi|254780669|r  118 IL--TDVH-----T-EQQCEAIADS-VDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       118 v~--TeV~-----~-~~~~e~~~~~-vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn  186 (301)
                      ++  |=.-     - ..-++.+++. +|-+=||-.-... .++..++.+.+. +|.+--+ ..+.+.+    +++.+...
T Consensus        98 ivlM~Y~N~i~~~G~e~F~~~~~~aGvdGvIipDLP~eE~~~~~~~~~~~~i~~I~lvaP-tt~~eRi----~~i~~~s~  172 (279)
T PRK13112         98 IVLMGYYNPIYIYGVERFLTDAKAAGVDGLIVVDLPPEMDAELCIPAMKAGINFIRLATP-TTDDKRL----PKVLANTS  172 (279)
T ss_pred             EEEEEECHHHHHHCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEECC-CCCHHHH----HHHHHCCC
T ss_conf             799851249988479999999997399879846999788899999998578346998258-9989999----99985278


Q ss_pred             CCE-EEEECCCCCCCHHHCCCCC-CCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             808-9951465444010000000-1068885-187168711777421223453212638899999999997189889998
Q gi|254780669|r  187 KDV-LFCERGTSFGYNTLVTDMR-SIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       187 ~~i-~lcERG~~fgy~~lvvD~~-~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      .=| .+.-+|+|=....+..++. .+..+|+ +..||++---=|             .++.+    + .+..++||+.+=
T Consensus       173 GFiY~Vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~~----~-~~~~~aDGvIVG  234 (279)
T PRK13112        173 GFVYYVSMTGITGSALADTSAVGEAVARIKRHTDLPVCVGFGVK-------------TPEQA----R-AIAAHADGVVVG  234 (279)
T ss_pred             CCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEECCC-------------CHHHH----H-HHHCCCCEEEEC
T ss_conf             80899835666676645648899999999971789876783569-------------99999----9-997259999987


Q ss_pred             ECCCH--HHCCCCCCC--CCCHHHHHHHHHHHHH
Q ss_conf             36983--347978201--8688999999999999
Q gi|254780669|r  264 THQDP--DNAPSDGPN--MINIKDLPKLLSQLLA  293 (301)
Q Consensus       264 ~Hp~P--~~AlsD~~q--~l~l~~l~~ll~~l~~  293 (301)
                      .+---  ++++.|...  +=....+.+|.++|++
T Consensus       235 SAiVk~Ie~~~~~~~~~~~~~~~~v~~~~~~l~~  268 (279)
T PRK13112        235 TAIVNALAGSLDEDGKATADTVAAVADLVAALAE  268 (279)
T ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             7999999854674110045799999999999999


No 189
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed
Probab=62.19  E-value=14  Score=18.20  Aligned_cols=135  Identities=18%  Similarity=0.147  Sum_probs=91.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC--EE-EEECCCHHHHHH
Q ss_conf             499999999999999965533997066015576886663222456712488899988665287--68-852288999987
Q gi|254780669|r   54 IESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGF--PI-LTDVHTEQQCEA  130 (301)
Q Consensus        54 iES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~gl--pv-~TeV~~~~~~e~  130 (301)
                      ..+.|+...+++.|.+.|.+.     .-           =.++-+   .+++.+++++++|+-  -| .--|.+++|++.
T Consensus        18 ~~~~~~a~~~~~al~~~Gi~~-----iE-----------VTl~tp---~a~~~I~~l~~~~~~~~~iGAGTVlt~e~~~~   78 (206)
T PRK09140         18 GITPDEALAHVGALIEAGFRA-----IE-----------IPLNSP---DPFDSIAALVKALGDDALIGAGTVLSPEQVDR   78 (206)
T ss_pred             CCCHHHHHHHHHHHHHCCCCE-----EE-----------EECCCC---CHHHHHHHHHHHCCCCEEEEEEECCCHHHHHH
T ss_conf             899999999999999869988-----99-----------917997---69999999999679865998620467999999


Q ss_pred             HHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCC
Q ss_conf             650-2157882257628999999985059779983677789999999999997258780899514654440100000001
Q gi|254780669|r  131 IAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRS  209 (301)
Q Consensus       131 ~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~  209 (301)
                      +.+ .++.+=-|.   -+.++++++.+.+.|+.   +=-+||.|...|.+    .|.+-+-+      |.-+.     -+
T Consensus        79 ai~aGA~FiVSP~---~~~~vi~~a~~~~i~~i---PG~~TPsEi~~A~~----~Ga~~vKl------FPA~~-----~G  137 (206)
T PRK09140         79 LADAGGRLIVTPN---IDPEVIRRAVAYGMTVM---PGVATPTEAFAALR----AGADALKL------FPASQ-----LG  137 (206)
T ss_pred             HHHCCCCEEECCC---CCHHHHHHHHHCCCCCC---CCCCCHHHHHHHHH----CCCCEEEE------CCHHC-----CC
T ss_conf             9985999999999---98999999998299652---78599999999998----59871565------75110-----59


Q ss_pred             CHHHHHH--CCC--EEECHHHHH
Q ss_conf             0688851--871--687117774
Q gi|254780669|r  210 IPIMTSM--GVP--VIFDASHSV  228 (301)
Q Consensus       210 i~~lk~~--~~P--Vi~D~SHs~  228 (301)
                      ...+|..  -+|  +-+=||-.+
T Consensus       138 p~~ikal~~p~P~~~~~~ptGGV  160 (206)
T PRK09140        138 PAGIKALRAVLPPDVPVFAVGGV  160 (206)
T ss_pred             HHHHHHHHCCCCCCCEEEECCCC
T ss_conf             99999986438999989953798


No 190
>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.
Probab=61.34  E-value=14  Score=18.10  Aligned_cols=11  Identities=18%  Similarity=0.175  Sum_probs=4.5

Q ss_pred             ECCCCCCCHHH
Q ss_conf             54863499999
Q gi|254780669|r   49 AGPCQIESHDH   59 (301)
Q Consensus        49 AGPCsiES~e~   59 (301)
                      .||.+.-...+
T Consensus        16 TG~~a~~G~~~   26 (362)
T cd06343          16 SGPASAYGVIG   26 (362)
T ss_pred             CCCHHHHCHHH
T ss_conf             78145407889


No 191
>PRK13753 dihydropteroate synthase; Provisional
Probab=60.40  E-value=15  Score=17.99  Aligned_cols=202  Identities=18%  Similarity=0.232  Sum_probs=121.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHC-CCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHH
Q ss_conf             99999999999999965533-99706601557688666322245671248889998866528768852288999987650
Q gi|254780669|r   55 ESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIAD  133 (301)
Q Consensus        55 ES~e~~~~~A~~lk~~~~~~-~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~  133 (301)
                      -+.+.++.-|+.+.+-|+.+ .+|+-  ++-+.|.+-|+   .. -++--+..++.+++++. ++--|-..++-++.+.+
T Consensus        22 ~~~~~a~~~a~~mi~~GAdIIDIGge--STRPga~~vs~---ee-E~~Rv~pvi~~l~~~~~-~iSIDT~~~~Va~~Al~   94 (279)
T PRK13753         22 LDPAGAVTAAIEMLRVGSDVVDVGPA--ASHPDARPVSP---AD-EIRRIAPLLDALSDQMH-RVSIDSFQPETQRYALK   94 (279)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCC--CCCCCCCCCCH---HH-HHHHHHHHHHHHHHHCC-CEEEECCCHHHHHHHHH
T ss_conf             89999999999999879969997987--78999980899---99-99999999999986089-67997885999999998


Q ss_pred             -HCCEEE-ECHHHCCCHHHHHHHHHCCCEEEEECCC----------CCCH----HH----HHHHHHHHHHCCCC-CEEEE
Q ss_conf             -215788-2257628999999985059779983677----------7899----99----99999999725878-08995
Q gi|254780669|r  134 -SVDILQ-IPALLCRQTDLLTAAAQTGRVINVKKGQ----------FLSP----WE----MHNILQKLHAHGAK-DVLFC  192 (301)
Q Consensus       134 -~vDilQ-IgA~~~rqtdLl~a~a~t~kpV~iKkgq----------~~s~----~e----~~~a~eki~~~Gn~-~i~lc  192 (301)
                       .+||+- |-++  +...++..+++.+.|+.+-..+          ...+    .|    +..-++.+.+.|.+ +=|+.
T Consensus        95 ~Ga~iINDIsG~--~d~~m~~~va~~~~~~vlMH~~~~~~~~~~~~~~~~~dvv~ev~~~~~~~i~~~~~~Gi~~~~Iil  172 (279)
T PRK13753         95 RGVGYLNDIQGF--PDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLIL  172 (279)
T ss_pred             CCCCEEECCCCC--CCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHEEE
T ss_conf             397788450103--383689999971998899826899988777778887557999999999999999987998677898


Q ss_pred             ECCCCC--CCH--HHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHH--HHHHCCCEEEEEEC
Q ss_conf             146544--401--00000001068885-187168711777421223453212638899999999--99718988999836
Q gi|254780669|r  193 ERGTSF--GYN--TLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKA--AVAIGIAGIFLETH  265 (301)
Q Consensus       193 ERG~~f--gy~--~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~a--a~a~G~dGlfiE~H  265 (301)
                      .=|+-|  |-+  ...--++++..++. +++|+.+-+|-=-..-.-.+... ..|. -.++|-+  |+..|++  ++-||
T Consensus       173 DPGiGF~~gK~~~~nl~il~~l~~l~~~lg~PiLvG~SRKsfIg~~~g~~~-~dr~-~~Tla~~~~a~~~Ga~--IiRVH  248 (279)
T PRK13753        173 DPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPV-KDLG-PASLAAELHAIGNGAD--YVRTH  248 (279)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHHHHHHCCCCH-HHCC-HHHHHHHHHHHHCCCC--EEEEC
T ss_conf             379894999877889999987999972079938999356689988639996-8710-8999999999987998--99848


Q ss_pred             CCHH
Q ss_conf             9833
Q gi|254780669|r  266 QDPD  269 (301)
Q Consensus       266 p~P~  269 (301)
                      .--+
T Consensus       249 DV~e  252 (279)
T PRK13753        249 APGD  252 (279)
T ss_pred             CHHH
T ss_conf             8599


No 192
>PRK13129 consensus
Probab=60.38  E-value=15  Score=17.99  Aligned_cols=219  Identities=20%  Similarity=0.236  Sum_probs=116.4

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEE------CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-970660------1557688666322245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYK------SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK------~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv  118 (301)
                      .+.||=   =+.|...++++.+.+.|+++. +|.=|.      |..-+|+..+.  -.|..+++.+++++++|+++.+|+
T Consensus        24 yitaG~---P~~e~s~~~~~~l~~~GaDiiEiGiPfSDP~ADGpvIq~A~~~AL--~~G~~~~~~~~~~~~~r~~~~~Pi   98 (267)
T PRK13129         24 FLMAGD---PDLETTAEALLILQENGADLIELGIPYSDPLADGPVIQAAATRAL--QSGTTLEKVLEMLESLKGKLTIPI   98 (267)
T ss_pred             EEECCC---CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             870718---998999999999997799999979988887765899999999999--769878999999998543478888


Q ss_pred             E--EECCC------HHHHHHHHHH-CCEEEECHHHCCCH-HHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             8--52288------9999876502-15788225762899-99999850597-7998367778999999999999725878
Q gi|254780669|r  119 L--TDVHT------EQQCEAIADS-VDILQIPALLCRQT-DLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       119 ~--TeV~~------~~~~e~~~~~-vDilQIgA~~~rqt-dLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      +  |=.-.      ..-++.+++. +|-+=||---.... ++..++.+.+. +|.+=-+  .|+++.+   .++.+.+.-
T Consensus        99 vlM~Y~N~i~~~G~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~gl~~I~lvaP--tt~~~Ri---~~i~~~~~g  173 (267)
T PRK13129         99 ILFTYYNPLLNRGMERFCEQAAAAGVAGLVVPDLPLEEAEKLSPIAAERGIDLILLVAP--TTPAERM---KRIAQQSRG  173 (267)
T ss_pred             EEEEEHHHHHHHHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCEEEEEECC--CCCHHHH---HHHHHCCCC
T ss_conf             99861078988559999999986698757678999899999999998539816899489--9968999---999816898


Q ss_pred             CEEE-EECCCCCCCHHHCCCC-CCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             0899-5146544401000000-01068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  188 DVLF-CERGTSFGYNTLVTDM-RSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       188 ~i~l-cERG~~fgy~~lvvD~-~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      =|.+ .-.|+|-..+.+-.++ ..+..+|+ +..||++---=|             .++-    ++....+|+||+.+=+
T Consensus       174 FiY~vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~----v~~~~~~~ADGvIVGS  236 (267)
T PRK13129        174 FTYLVSVTGVTGERSQMENRVESLLQQLRQVTSKPIAVGFGIS-------------GPEQ----ARQVREWGADGAIVGS  236 (267)
T ss_pred             EEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCC-------------CHHH----HHHHHHCCCCEEEECH
T ss_conf             0898734665676544508899999999983489817884479-------------9999----9999854999999878


Q ss_pred             CCCHHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             69833479782018688999999999999
Q gi|254780669|r  265 HQDPDNAPSDGPNMINIKDLPKLLSQLLA  293 (301)
Q Consensus       265 Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~  293 (301)
                      +---.-.-++...  .++.+.+++++|+.
T Consensus       237 aiV~~i~e~~~~~--~~~~v~~fvk~lk~  263 (267)
T PRK13129        237 AFVKRLAEASPGE--GLQEAGEFCRELRA  263 (267)
T ss_pred             HHHHHHHHCCCHH--HHHHHHHHHHHHHH
T ss_conf             9999998659175--79999999999999


No 193
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein; InterPro: IPR008205   This family contains prokaryotic proteins that are related to pcrB. Staphylococcus aureus chromosomal gene pcrA encodes a protein with significant similarity (40 0dentity) to two Escherichia coli helicases: the helicase II encoded by the uvrD gene and the Rep helicase. PcrB gene seems to belong to an operon containing at least one other gene, pcrBA, downstream from pcrB . The PcrB proteins often contain an FMN binding site although the function of these proteins is still unknown..
Probab=60.28  E-value=11  Score=18.94  Aligned_cols=165  Identities=22%  Similarity=0.365  Sum_probs=104.3

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHH-CCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHH
Q ss_conf             86349999999999999996553-39970660155768866632224567124888999886652876885228899998
Q gi|254780669|r   51 PCQIESHDHAFMIAEKLYAICQS-LNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCE  129 (301)
Q Consensus        51 PCsiES~e~~~~~A~~lk~~~~~-~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e  129 (301)
                      |.-..+ +..-++++.+.+.|-+ .+++                +=+|.-+|+....++.++++|++|++-+.-+.+   
T Consensus         8 P~k~~p-~e~~eI~~a~~~~GTDail~G----------------Gs~gVt~~~~~~~~~~~~e~~~~P~ilfPsn~~---   67 (242)
T TIGR01768         8 PDKITP-EEADEIAKAAAESGTDAILVG----------------GSQGVTLDKLDQLIEALRERYGVPIILFPSNLT---   67 (242)
T ss_pred             CCCCCC-CCHHHHHHHHHHCCCCEEEEC----------------CCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCC---
T ss_conf             777788-636899999983589889822----------------778703688999999997405983798418874---


Q ss_pred             HHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCC------EEEEECCCCC-----
Q ss_conf             76502157882257628999999985059779983677789999999999997258780------8995146544-----
Q gi|254780669|r  130 AIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKD------VLFCERGTSF-----  198 (301)
Q Consensus       130 ~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~------i~lcERG~~f-----  198 (301)
                      .+.+.+|-+=+++-+  |       +.-.+.|.=|..||....  .-++..+..-+|-.      -++-+-|.+-     
T Consensus        68 ~~s~~~Da~f~~svl--N-------S~~~~wI~GkhaqWvr~q--~~~~~~~~~~~~~~E~~~~gY~iv~pgg~aa~v~~  136 (242)
T TIGR01768        68 NVSRKADALFFPSVL--N-------SDDPYWIIGKHAQWVRAQ--ILAAPKFKKLGESLEIIPEGYIIVNPGGAAATVTK  136 (242)
T ss_pred             CHHHCCCEEEEEEEE--E-------CCCCCEEECCHHHHHHHH--HHHHHHHHHHHHHHEEHHEEEEEECCCCCEEEEEC
T ss_conf             211106768771143--1-------699764534259999999--98789887653134001211278758995588502


Q ss_pred             ----CCHHHCCCCCCCHHHHH--HCCCEEE-CHHHHHHHCCCCCCCCCCC---HHHHHHHHHHHHHHCCCE
Q ss_conf             ----40100000001068885--1871687-1177742122345321263---889999999999718988
Q gi|254780669|r  199 ----GYNTLVTDMRSIPIMTS--MGVPVIF-DASHSVQQPGIHGNCSGGE---RQYIVPLAKAAVAIGIAG  259 (301)
Q Consensus       199 ----gy~~lvvD~~~i~~lk~--~~~PVi~-D~SHs~q~p~~~~~~~gG~---r~~v~~la~aa~a~G~dG  259 (301)
                          .|++-  |+.+...|-+  +++|+|+ -.|=           +.|+   .|+|....|-.-.+|+-|
T Consensus       137 A~~~P~~k~--~~Aa~~~~a~~~~g~~~~YLEags-----------gap~pvpPE~va~vk~v~~~aGyGG  194 (242)
T TIGR01768       137 AKPIPYDKE--DLAAYAALAEEMLGMPIIYLEAGS-----------GAPEPVPPELVAEVKKVLDKAGYGG  194 (242)
T ss_pred             CCCCCCCCH--HHHHHHHHHHHHHCCCEEEEECCC-----------CCCCCCCHHHHHHHHHHHHCCCCCC
T ss_conf             357887768--799999999998099689996378-----------7547974589999998741047886


No 194
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed
Probab=59.92  E-value=15  Score=17.94  Aligned_cols=159  Identities=16%  Similarity=0.191  Sum_probs=66.4

Q ss_pred             CCHHHHHHHHHHHHHH-CCEEEEECCCHHHHHHHHHHCC-----EEEECH----------H--HCCCH-HHHHHHHHCCC
Q ss_conf             7124888999886652-8768852288999987650215-----788225----------7--62899-99999850597
Q gi|254780669|r   99 GLKKGREIFRDLKKKY-GFPILTDVHTEQQCEAIADSVD-----ILQIPA----------L--LCRQT-DLLTAAAQTGR  159 (301)
Q Consensus        99 Gle~gL~il~e~k~~~-glpv~TeV~~~~~~e~~~~~vD-----ilQIgA----------~--~~rqt-dLl~a~a~t~k  159 (301)
                      |..-...+...+.+++ ++||+--.-+....+.+.+.+|     |.-=++          |  |.+.| +.++.+-..|.
T Consensus        58 g~~~l~~~~~~a~~~~~~VPValHLDHg~~~e~i~~ai~~GFtSVMiDgS~lp~~~~~~sfeeNi~~Tkevve~Ah~~gv  137 (347)
T PRK09196         58 GEPFLRHLILAAVEEYPHIPVVMHQDHGNSPATCQRAIQLGFTSVMMDGSLKADGKTPASYEYNVDVTRKVVEMAHACGV  137 (347)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             87999999999998568998899747889999999998648983897365565556777889999999999999987398


Q ss_pred             EEEEECC--------------------------CCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC-CH-HHC--CCCCC
Q ss_conf             7998367--------------------------778999999999999725878089951465444-01-000--00001
Q gi|254780669|r  160 VINVKKG--------------------------QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFG-YN-TLV--TDMRS  209 (301)
Q Consensus       160 pV~iKkg--------------------------q~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg-y~-~lv--vD~~~  209 (301)
                      .|=--=|                          .+.+|+   .|.+.+..+|.+ .+.+==|+..| |. ..-  -+.-.
T Consensus       138 ~VEaElG~vGg~e~g~~g~edg~~~e~~~~~~~~yTdPe---eA~~Fv~~TgvD-~LAvaiGt~HG~YK~~~~P~~~~L~  213 (347)
T PRK09196        138 SVEGELGCLGSLETGMGGEEDGHGAEGKLSHDQLLTDPE---EAADFVKKTQVD-ALAIAIGTSHGAYKFTRKPTGDVLA  213 (347)
T ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCHH---HHHHHHHHHCCC-CCHHHHCCCCCCCCCCCCCCCCCCC
T ss_conf             499960210475667777666755555554443168999---999999974877-0300110134666577899722036


Q ss_pred             CHHHHH----H-CCCEEECHHHH-----HHH---CCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             068885----1-87168711777-----421---2234532126388999999999971898899983
Q gi|254780669|r  210 IPIMTS----M-GVPVIFDASHS-----VQQ---PGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       210 i~~lk~----~-~~PVi~D~SHs-----~q~---p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      +..+++    . +.|.++--+.+     ++.   .|+.-..+.|-.   ...-+.|+..|+.=+=|-|
T Consensus       214 ~~rL~eI~~~vp~~pLVLHGgS~vp~~~~~~~~~~gg~~~~~~G~~---~e~i~~ai~~Gv~KiNi~T  278 (347)
T PRK09196        214 IDRIKEIHARIPNTHLVMHGSSSVPQELLDIINEYGGDMPETYGVP---VEEIQEGIKHGVRKVNIDT  278 (347)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCCCC---HHHHHHHHHHCCEEEECCH
T ss_conf             9999999984567867877896886789999987367665446989---9999999980964663374


No 195
>PRK12999 pyruvate carboxylase; Reviewed
Probab=59.58  E-value=15  Score=17.90  Aligned_cols=22  Identities=14%  Similarity=-0.195  Sum_probs=8.0

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             8634999999999999999655
Q gi|254780669|r   51 PCQIESHDHAFMIAEKLYAICQ   72 (301)
Q Consensus        51 PCsiES~e~~~~~A~~lk~~~~   72 (301)
                      +-.++||=.+-.+.+..++.+.
T Consensus        58 ~~p~~sYL~~~~ii~~A~~~~~   79 (1147)
T PRK12999         58 KGPIEAYLDIDEIIRVAKQAGV   79 (1147)
T ss_pred             CCHHHHHCCHHHHHHHHHHHCC
T ss_conf             9713111299999999999498


No 196
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism]
Probab=58.97  E-value=16  Score=17.84  Aligned_cols=179  Identities=21%  Similarity=0.261  Sum_probs=94.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCC--CCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHH
Q ss_conf             999999999999999655339970660155768866632224--567124888999886652876885--2288999987
Q gi|254780669|r   55 ESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR--GVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEA  130 (301)
Q Consensus        55 ES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfr--G~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~  130 (301)
                      -+.|.+++.|+..++.|+.   .+.           ...|+|  |-.+++-.++.+.+|++.|+++.-  -..+.+|++.
T Consensus        84 ~~~eeIle~Ak~ak~~Ga~---r~c-----------~~aagr~~~~~~~~i~~~v~~Vk~~~~le~c~slG~l~~eq~~~  149 (335)
T COG0502          84 MEVEEILEAAKKAKAAGAT---RFC-----------MGAAGRGPGRDMEEVVEAIKAVKEELGLEVCASLGMLTEEQAEK  149 (335)
T ss_pred             CCHHHHHHHHHHHHHCCCC---EEE-----------EEEECCCCCCCHHHHHHHHHHHHHHCCCHHHHCCCCCCHHHHHH
T ss_conf             8999999999999974995---079-----------98731677744899999999999846928640258799999999


Q ss_pred             HHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCH----HHCC
Q ss_conf             6502-1578822576289999999850597799836777899999999999972587808995146544401----0000
Q gi|254780669|r  131 IADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN----TLVT  205 (301)
Q Consensus       131 ~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~----~lvv  205 (301)
                      +++. +|-+---=-..++  +-..         |.  ..-|.+|-++..+++...|-+   +|-=|+ +|-+    +++-
T Consensus       150 L~~aGvd~ynhNLeTs~~--~y~~---------I~--tt~t~edR~~tl~~vk~~Gi~---vcsGgI-~GlGEs~eDri~  212 (335)
T COG0502         150 LADAGVDRYNHNLETSPE--FYEN---------II--TTRTYEDRLNTLENVREAGIE---VCSGGI-VGLGETVEDRAE  212 (335)
T ss_pred             HHHCCHHHEECCCCCCHH--HHCC---------CC--CCCCHHHHHHHHHHHHHCCCC---CCCCEE-ECCCCCHHHHHH
T ss_conf             997181133035556978--8756---------57--898888999999999980985---045127-618998889999


Q ss_pred             --------C-CCCCHHHH---HHCCCEE----ECHHHHHH--------HCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEE
Q ss_conf             --------0-00106888---5187168----71177742--------12234532126388999999999971898899
Q gi|254780669|r  206 --------D-MRSIPIMT---SMGVPVI----FDASHSVQ--------QPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF  261 (301)
Q Consensus       206 --------D-~~~i~~lk---~~~~PVi----~D~SHs~q--------~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlf  261 (301)
                              + .-+||++-   .-+-|.=    +|+.-.+.        +|...=..+||+-...+.+..-+..+|++.+|
T Consensus       213 ~l~~L~~l~~pdsVPIn~l~P~~GTPle~~~~~~~~e~lk~IA~~Ri~~P~~~Ir~s~gr~~~~~~~q~~~~~aGansi~  292 (335)
T COG0502         213 LLLELANLPTPDSVPINFLNPIPGTPLENAKPLDPFEFLKTIAVARIIMPKSMIRLSAGRETMLPELQALAFMAGANSIF  292 (335)
T ss_pred             HHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHHCCCEEE
T ss_conf             99999718998854232103799986665899998999999999999778645672588352258889999984566356


Q ss_pred             EEE
Q ss_conf             983
Q gi|254780669|r  262 LET  264 (301)
Q Consensus       262 iE~  264 (301)
                      .=.
T Consensus       293 ~g~  295 (335)
T COG0502         293 VGD  295 (335)
T ss_pred             ECC
T ss_conf             524


No 197
>KOG1357 consensus
Probab=58.18  E-value=6.5  Score=20.31  Aligned_cols=108  Identities=14%  Similarity=0.221  Sum_probs=64.1

Q ss_pred             CCEEEEECCCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCC-----CCCCHHHHHHHHHHHHHHCCCEE
Q ss_conf             80899514654440100000001068885-1871687117774212234532-----12638899999999997189889
Q gi|254780669|r  187 KDVLFCERGTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNC-----SGGERQYIVPLAKAAVAIGIAGI  260 (301)
Q Consensus       187 ~~i~lcERG~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~-----~gG~r~~v~~la~aa~a~G~dGl  260 (301)
                      +++++|++|+.- ...-++|+..+..+|+ +..-++.|--||+---|..|..     --+..+-..-|.--...+|+.|=
T Consensus       276 kki~iivegiys-mEg~iv~Lp~vvalkkkykayl~lDEAHSiGA~g~tGrgvce~~g~d~~dvDImMGtftKSfga~GG  354 (519)
T KOG1357         276 KKILICVEGIYS-MEGTIVDLPEVVALKKKYKAYLYLDEAHSIGAMGATGRGVCEYFGVDPEDVDIMMGTFTKSFGAAGG  354 (519)
T ss_pred             HHEEEEECCCCC-CCCEECCCHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCEEECCCCCCHHHEEECCEEHHHCCCCCC
T ss_conf             220342011010-5672116199887520433799840100025537888742234688824620220100210456666


Q ss_pred             EEEECC------CHHHCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             998369------83347978201868899999999999999
Q gi|254780669|r  261 FLETHQ------DPDNAPSDGPNMINIKDLPKLLSQLLAID  295 (301)
Q Consensus       261 fiE~Hp------~P~~AlsD~~q~l~l~~l~~ll~~l~~i~  295 (301)
                      .|+.--      .-...-.=..+++++--....+..++-|.
T Consensus       355 yiagsk~lid~lrt~s~~~~yat~~sppvaqq~~ssl~~i~  395 (519)
T KOG1357         355 YIAGSKELIDYLRTPSPSALYATSLSPPVAQQILTSVKHIM  395 (519)
T ss_pred             EECCCHHHHHHCCCCCCCEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             00283887741004788424203678288999998787524


No 198
>PRK10329 glutaredoxin-like protein; Provisional
Probab=57.91  E-value=6.9  Score=20.15  Aligned_cols=58  Identities=21%  Similarity=0.212  Sum_probs=41.6

Q ss_pred             EEECCCCCCCHHHCCCCCCCHHHHHHC---CCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             951465444010000000106888518---7168711777421223453212638899999999997189
Q gi|254780669|r  191 FCERGTSFGYNTLVTDMRSIPIMTSMG---VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGI  257 (301)
Q Consensus       191 lcERG~~fgy~~lvvD~~~i~~lk~~~---~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~  257 (301)
                      |...|+.|..-|+--|..++..+|+.|   .|||+-..         ..-+|=|.+.+..|+.|+.++.+
T Consensus        21 L~~~gI~y~~vdi~~dpea~~~vk~~G~~q~PVV~~~~---------~~wsGFRPD~i~~L~~a~~~~~~   81 (81)
T PRK10329         21 MESRGFDFEMINVDRVPEAADTLRAQGFRQLPVVIAGD---------LSWSGFRPDMINRLHPAPHAASA   81 (81)
T ss_pred             HHHCCCCEEEEECCCCHHHHHHHHHCCCCCCCEEEECC---------CEECCCCHHHHHHHHHHHHHHCC
T ss_conf             99879942998589999999999976985599899699---------54436098999988887876439


No 199
>cd05800 PGM_like2 This PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily and is found in both archaea and bacteria. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four structural domains (subdomains) with a centrally located active site formed by four loops, one from each subdomain. All four subdomains are included in this alignment model.
Probab=57.85  E-value=16  Score=17.71  Aligned_cols=23  Identities=30%  Similarity=0.450  Sum_probs=11.1

Q ss_pred             EEEECCCCCCHHHHHH-HHHHHHH
Q ss_conf             9983677789999999-9999972
Q gi|254780669|r  161 INVKKGQFLSPWEMHN-ILQKLHA  183 (301)
Q Consensus       161 V~iKkgq~~s~~e~~~-a~eki~~  183 (301)
                      +.-.+|++++.++++. .+.++..
T Consensus       250 ~vd~~G~~i~gd~l~alla~~l~~  273 (461)
T cd05800         250 AVDEKGNFLDPNQILALLLDYLLE  273 (461)
T ss_pred             EECCCCCEECHHHHHHHHHHHHHH
T ss_conf             995899579898999999999997


No 200
>PRK13124 consensus
Probab=57.15  E-value=17  Score=17.64  Aligned_cols=217  Identities=18%  Similarity=0.219  Sum_probs=115.1

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCC-----CCCCCC-CCCCCCHHHHHHHHHHHHHHCCEEE
Q ss_conf             99548634999999999999999655339-9706601557688-----666322-2456712488899988665287688
Q gi|254780669|r   47 LIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKAN-----RSSLAG-KRGVGLKKGREIFRDLKKKYGFPIL  119 (301)
Q Consensus        47 iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKan-----RtS~~s-frG~Gle~gL~il~e~k~~~glpv~  119 (301)
                      +.||   --+.|...++++.+.+.|+++. +|.=|.-  +.|-     |++-.+ -.|..+++.++++++++++.++|++
T Consensus        15 itaG---~P~~e~s~~~~~~l~~~GaDiiElGiPfSD--P~ADGpvIq~A~~~AL~~G~~~~~~~~~~~~~r~~~~~piv   89 (257)
T PRK13124         15 ITAG---DPDPETTIDLVLALEEAGADILELGIPYSD--PLADGPVIQRASKRALNGGMNIVKAMELVGKMRKKVTIPIV   89 (257)
T ss_pred             ECCC---CCCHHHHHHHHHHHHHCCCCEEEECCCCCC--CCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCEE
T ss_conf             6370---899899999999999769999997898888--77657999999999997699689999999985244788889


Q ss_pred             E-----ECCC---HHHHHHHHHH-CCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             5-----2288---9999876502-1578822576289-999999850597-79983677789999999999997258780
Q gi|254780669|r  120 T-----DVHT---EQQCEAIADS-VDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAKD  188 (301)
Q Consensus       120 T-----eV~~---~~~~e~~~~~-vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~~  188 (301)
                      .     .|+.   .+-++.+++. +|-+=||---... .++..++.+.+. +|.+--+  .|.+.    .+++.+....=
T Consensus        90 lM~Y~N~i~~~G~e~F~~~~~~~Gv~GvIipDLP~eE~~~~~~~~~~~gl~~I~lvaP--Ts~~R----i~~i~~~s~gF  163 (257)
T PRK13124         90 YFTYYNPVLQYGLEKFFALARENGIDGLLIPDLPLEESGELQEICDKYGIYLIPLVAP--TSKER----IKKIAEQAEGF  163 (257)
T ss_pred             EEEHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEEECC--CCHHH----HHHHHHCCCCC
T ss_conf             9750078987579999999997599847778999799999999998668735788479--96799----99998548983


Q ss_pred             EE-EEECCCCCCCHHHCCCC-CCCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             89-95146544401000000-010688851-8716871177742122345321263889999999999718988999836
Q gi|254780669|r  189 VL-FCERGTSFGYNTLVTDM-RSIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH  265 (301)
Q Consensus       189 i~-lcERG~~fgy~~lvvD~-~~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~H  265 (301)
                      |. +--.|+|=..+.+-.++ ..+..+|+. ..||++---=+             .++-+.     .+..++||+.+=++
T Consensus       164 iY~vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGI~-------------~~e~v~-----~~~~~ADGvIVGSa  225 (257)
T PRK13124        164 VYCVSSLGVTGVREEIETDLEEFIRTVKQYSNVPVAVGFGIS-------------TPEQVQ-----KMKEIADGVVVGSA  225 (257)
T ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCC-------------CHHHHH-----HHHHHCCEEEECHH
T ss_conf             899624666787655608899999999861799838984469-------------999999-----99801999998289


Q ss_pred             CCHHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9833479782018688999999999999
Q gi|254780669|r  266 QDPDNAPSDGPNMINIKDLPKLLSQLLA  293 (301)
Q Consensus       266 p~P~~AlsD~~q~l~l~~l~~ll~~l~~  293 (301)
                      -----.-+...+. .++.+.+++++|+.
T Consensus       226 ivk~i~~~~~~~~-~~~~v~~fv~~lk~  252 (257)
T PRK13124        226 LVEKIEEPEEREE-ALAEVEEFASSLRE  252 (257)
T ss_pred             HHHHHHHCCCHHH-HHHHHHHHHHHHHH
T ss_conf             9999985687578-99999999999999


No 201
>PRK00915 2-isopropylmalate synthase; Validated
Probab=56.90  E-value=17  Score=17.61  Aligned_cols=23  Identities=17%  Similarity=0.199  Sum_probs=11.7

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             86349999999999999996553
Q gi|254780669|r   51 PCQIESHDHAFMIAEKLYAICQS   73 (301)
Q Consensus        51 PCsiES~e~~~~~A~~lk~~~~~   73 (301)
                      |-+-=|.++-+++|+.|.++|.+
T Consensus        19 ~gv~fs~e~K~~Ia~~L~~~GV~   41 (511)
T PRK00915         19 PGASLTVEEKLQIAKQLERLGVD   41 (511)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             99998999999999999976989


No 202
>PRK13133 consensus
Probab=56.07  E-value=17  Score=17.52  Aligned_cols=189  Identities=17%  Similarity=0.205  Sum_probs=95.2

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEE------CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH-----H
Q ss_conf             999548634999999999999999655339-970660------1557688666322245671248889998866-----5
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYK------SSFDKANRSSLAGKRGVGLKKGREIFRDLKK-----K  113 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK------~sfdKanRtS~~sfrG~Gle~gL~il~e~k~-----~  113 (301)
                      .+.||=   -+.+..+++++.+.+.|+++. +|.=|-      |..-+|+.-+.  -.|..+++.+++++++|.     +
T Consensus        20 yitaG~---P~~~~t~~~i~~l~~~GaDiiElGiPFSDP~ADGpvIQ~A~~rAL--~~G~~~~~~~~~~~~~r~~~~~~~   94 (267)
T PRK13133         20 YYMPEF---PVAGATLPVLEALQESGADIIELGIPYSDPIGDGPVIQNAAHTAI--RNGVSVRSLLELVRKARNGEGCRK   94 (267)
T ss_pred             EECCCC---CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             856869---998999999999997599989978998886666899999999999--869989999999999973024346


Q ss_pred             HCCEEEEECCCH----------HHHHHHHH-HCCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHH
Q ss_conf             287688522889----------99987650-21578822576289-999999850597-799836777899999999999
Q gi|254780669|r  114 YGFPILTDVHTE----------QQCEAIAD-SVDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQK  180 (301)
Q Consensus       114 ~glpv~TeV~~~----------~~~e~~~~-~vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~ek  180 (301)
                      +.+|++-  |..          .-++.+++ .+|-+=||---... .++..++.+.+. +|.+=-+  .|+++   -.++
T Consensus        95 ~~~Pivl--MtY~N~i~~yG~e~F~~~~~~aGvdGlIipDLP~eE~~~~~~~~~~~gl~~I~lvaP--tt~~e---Ri~~  167 (267)
T PRK13133         95 ITVPILL--MGYCNPLIAYGGDCFLADAVKAGVDGLLIPDLPPEEAIDFLERAKNFGLTVVFLISP--VTPPE---RIEF  167 (267)
T ss_pred             CCCCEEE--HHHHHHHHHHCHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEEECC--CCCHH---HHHH
T ss_conf             6877871--564579998477999999998698788778999688899999998469860244289--99999---9999


Q ss_pred             HHHCCCCCEE-EEECCCCCCCHHHC-----CCCC-CCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             9725878089-95146544401000-----0000-10688851-871687117774212234532126388999999999
Q gi|254780669|r  181 LHAHGAKDVL-FCERGTSFGYNTLV-----TDMR-SIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAA  252 (301)
Q Consensus       181 i~~~Gn~~i~-lcERG~~fgy~~lv-----vD~~-~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa  252 (301)
                      +.+...-=|. +.-+|+| |-.++-     ..+. -+..+|++ ..||++---=             -.++-+..+++  
T Consensus       168 i~~~s~GFiY~vs~~GvT-G~~~~~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGI-------------~~~e~~~~i~~--  231 (267)
T PRK13133        168 IDSLSTDFSYCLAVNATT-GTAKLSDAGTEAAVDEYLKRVRQHTKKKFVVGFGI-------------KDRERVEHMWE--  231 (267)
T ss_pred             HHHCCCCCEEEEEEECCC-CCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEECCC-------------CCHHHHHHHHH--
T ss_conf             984278957999800134-67755554267899999999997189987996687-------------99999999982--


Q ss_pred             HHHCCCEEEEEEC
Q ss_conf             9718988999836
Q gi|254780669|r  253 VAIGIAGIFLETH  265 (301)
Q Consensus       253 ~a~G~dGlfiE~H  265 (301)
                         -+||+.+=++
T Consensus       232 ---~ADGvIVGSa  241 (267)
T PRK13133        232 ---LADGAVVGTA  241 (267)
T ss_pred             ---HCCEEEECHH
T ss_conf             ---2999998789


No 203
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed
Probab=55.89  E-value=17  Score=17.50  Aligned_cols=100  Identities=16%  Similarity=0.101  Sum_probs=64.2

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCEEEEECC------------CHH-HHHHHHHHCCEEEEC--------HHHCCCHH--
Q ss_conf             2224567124888999886652876885228------------899-998765021578822--------57628999--
Q gi|254780669|r   93 AGKRGVGLKKGREIFRDLKKKYGFPILTDVH------------TEQ-QCEAIADSVDILQIP--------ALLCRQTD--  149 (301)
Q Consensus        93 ~sfrG~Gle~gL~il~e~k~~~glpv~TeV~------------~~~-~~e~~~~~vDilQIg--------A~~~rqtd--  149 (301)
                      .+|--.|.+..++-|++.+.. ..|+---|.            |.. -++.+++++|.+-|=        =|..|+.+  
T Consensus       113 ~GfnN~G~~~~~~~L~~~~~~-~~~lGvnIg~nk~t~~e~~~~Dy~~~~~~l~~~aDy~~INiSsPNT~glr~lq~~~~L  191 (336)
T PRK05286        113 MGFNNEGADALAERLKKAKPY-KGPLGINIGKNKDTPLEDAVDDYLICLRKLYPYADYFTVNISSPNTPGLRDLQAGEAL  191 (336)
T ss_pred             CCCCCHHHHHHHHHHHHHCCC-CCCEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHH
T ss_conf             577986899999999850567-8865899762378841668999999999982637789997568998652000466999


Q ss_pred             --HHHHHHH------CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             --9999850------5977998367778999999999999725878089951
Q gi|254780669|r  150 --LLTAAAQ------TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCE  193 (301)
Q Consensus       150 --Ll~a~a~------t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcE  193 (301)
                        |+.++-.      ..+||++|=..-++-++...+++-+.+.|...++++-
T Consensus       192 ~~ll~~v~~~~~~~~~~~PI~vKisPDl~~~~l~~i~~~~~~~~idGii~tN  243 (336)
T PRK05286        192 DELLAALKEAQAELGKYVPLLLKIAPDLSDEELDDIADLALEHGIDGIIATN  243 (336)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             9999999999984378886488328888878999999999981986899958


No 204
>PRK07050 cystathionine beta-lyase; Provisional
Probab=55.88  E-value=17  Score=17.50  Aligned_cols=37  Identities=14%  Similarity=0.209  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHCCEEEE-ECCCHHHHHHH-HHHCCEEEE
Q ss_conf             88999886652876885-22889999876-502157882
Q gi|254780669|r  104 REIFRDLKKKYGFPILT-DVHTEQQCEAI-ADSVDILQI  140 (301)
Q Consensus       104 L~il~e~k~~~glpv~T-eV~~~~~~e~~-~~~vDilQI  140 (301)
                      ..++++.-.+||+.+.. |..+++.++.+ .+...++++
T Consensus       118 ~~~~~~~l~~~Gi~v~f~d~~d~~~~~~~i~~~Tkli~~  156 (394)
T PRK07050        118 RDFGEWLAKDFGITVRFYDPMIGAGIADLIQPNTRLIWL  156 (394)
T ss_pred             HHHHHHHHHCCCEEEEEECCCCHHHHHHHCCCCCEEEEE
T ss_conf             999998753188799997999989998436866449998


No 205
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional
Probab=55.72  E-value=18  Score=17.49  Aligned_cols=178  Identities=16%  Similarity=0.190  Sum_probs=79.1

Q ss_pred             CCHHHHHHHHHHHHHH-CCEEEEECCCHHHHHHHHHHCC-----EEEECH------------HHCCCH-HHHHHHHHCCC
Q ss_conf             7124888999886652-8768852288999987650215-----788225------------762899-99999850597
Q gi|254780669|r   99 GLKKGREIFRDLKKKY-GFPILTDVHTEQQCEAIADSVD-----ILQIPA------------LLCRQT-DLLTAAAQTGR  159 (301)
Q Consensus        99 Gle~gL~il~e~k~~~-glpv~TeV~~~~~~e~~~~~vD-----ilQIgA------------~~~rqt-dLl~a~a~t~k  159 (301)
                      |.+.-..+.+.+.+.+ ++||+--.-+....+.+.+.+|     +.-=++            -|.+.| +.++.+...|.
T Consensus        58 g~~~l~~~v~~~a~~~~~VPValHLDHg~~~e~~~~ai~~GFtSVMiDgS~lP~~e~~~sfeeNI~~Tk~vve~Ah~~gv  137 (347)
T PRK13399         58 GDAMLRHMVLAAAEMYPDIPICLHQDHGNSPATCQSAIRSGFTSVMMDGSLLADGKTPASYDYNVDVTRRVTEMAHAVGV  137 (347)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             98999999999998678996898558889999999998719974763465565667765589999999999999998198


Q ss_pred             EEEEECCC--------------------------CCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC-CH---HHCCCCCC
Q ss_conf             79983677--------------------------78999999999999725878089951465444-01---00000001
Q gi|254780669|r  160 VINVKKGQ--------------------------FLSPWEMHNILQKLHAHGAKDVLFCERGTSFG-YN---TLVTDMRS  209 (301)
Q Consensus       160 pV~iKkgq--------------------------~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg-y~---~lvvD~~~  209 (301)
                      +|=-.=|.                          +-+|++   |.+.+..+|.+ .+..==|+..| |.   .---|+-.
T Consensus       138 ~VEaElG~iG~~e~g~~g~eDg~~~~~~~~~~~~yT~Pee---a~~Fv~~TgvD-~LAvaiGt~HG~YK~~~~p~~~~l~  213 (347)
T PRK13399        138 SVEGELGCLGSLETGEAGEEDGVGAEGKLSHDQMLTDPDQ---AVDFVQRTGVD-ALAIAIGTSHGAYKFTRKPDGDILA  213 (347)
T ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCHHH---HHHHHHHHCCC-EEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             8998315556655677776666565554542332489999---99999986898-5864405344787788899855237


Q ss_pred             CHHHHH----H-CCCEEECHHHHHH--------HCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC------HHH
Q ss_conf             068885----1-8716871177742--------12234532126388999999999971898899983698------334
Q gi|254780669|r  210 IPIMTS----M-GVPVIFDASHSVQ--------QPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD------PDN  270 (301)
Q Consensus       210 i~~lk~----~-~~PVi~D~SHs~q--------~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~------P~~  270 (301)
                      ++.+++    . +.|.++--+-++-        ..|+....+-|..   ..--+.|+..|+.=+=+-|.-.      -.+
T Consensus       214 ~~~L~~i~~~~~~~pLVLHGgS~vp~~~~~~~~~~GG~~~~~~G~~---~e~i~~AI~~GV~KiNi~Tdl~~A~~~~vr~  290 (347)
T PRK13399        214 IDRIEEIHARLPNTHLVMHGSSSVPQELQEIINAYGGDMKETYGVP---VEEIQRGIKHGVRKVNIDTDIRLAMTGAIRK  290 (347)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCCCC---HHHHHHHHHCCCEEEEECCHHHHHHHHHHHH
T ss_conf             9999999973789876874797884788899997077666788999---9999999981977998583778999999999


Q ss_pred             CCCCCCCCCCHHH
Q ss_conf             7978201868899
Q gi|254780669|r  271 APSDGPNMINIKD  283 (301)
Q Consensus       271 AlsD~~q~l~l~~  283 (301)
                      .+.+.+..++|-.
T Consensus       291 ~l~~~p~~~Dpr~  303 (347)
T PRK13399        291 VLAEHPSEFDPRK  303 (347)
T ss_pred             HHHHCCCCCCCHH
T ss_conf             9985977689089


No 206
>PRK13131 consensus
Probab=55.71  E-value=18  Score=17.49  Aligned_cols=193  Identities=16%  Similarity=0.221  Sum_probs=97.6

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCC-----CCCCCCCCCCCCHHHHHHHHHHHH-HHCCEE
Q ss_conf             999548634999999999999999655339-9706601557688-----666322245671248889998866-528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKAN-----RSSLAGKRGVGLKKGREIFRDLKK-KYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKan-----RtS~~sfrG~Gle~gL~il~e~k~-~~glpv  118 (301)
                      .+.||=   -+.+..+++++.+.+.|+++. +|.=|-  -+-|-     +++..+.++-.+.+.+++++++|+ ...+|+
T Consensus        16 yitaG~---P~~e~s~~~~~~l~~~GadiiEiGiPFS--DP~ADGpvIQ~a~~rAL~~g~~~~~~~~~~~~r~~~~~~pi   90 (257)
T PRK13131         16 FVTLGD---PNYELSFEIIKTLIISGVSALELGFAFS--DPVADGITIQASHLRALKHASMAKNFQLLKKIRDYNHHIPI   90 (257)
T ss_pred             EECCCC---CCHHHHHHHHHHHHHCCCCEEEECCCCC--CCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCE
T ss_conf             861868---9988999999999977999999789988--85545599999999999789889999999998704999888


Q ss_pred             E--EECC-----C-HHHHHHHHHH-CCEEEECHHHCCCHH-HHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             8--5228-----8-9999876502-157882257628999-9999850597-7998367778999999999999725878
Q gi|254780669|r  119 L--TDVH-----T-EQQCEAIADS-VDILQIPALLCRQTD-LLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       119 ~--TeV~-----~-~~~~e~~~~~-vDilQIgA~~~rqtd-Ll~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      +  |=.-     - ..-++..++. +|-+=||---....+ +..++.+.+. .|.+=-+ ..+.+.+..+++    ....
T Consensus        91 vlM~Y~N~i~~yG~e~F~~~~~~~GvdGvIipDLP~eE~~~~~~~~~~~~l~~I~lvaP-tt~~~Ri~~i~~----~s~G  165 (257)
T PRK13131         91 GLLAYANLIFSYGVDGFYAQAKECGVDSVLIADMPLIEKELVIKSAQKHQIKQIFIASP-NASVKDLEQVAT----HSQG  165 (257)
T ss_pred             EEECCHHHHHHHCHHHHHHHHHHCCCCCEECCCCCHHHHHHHHHHHHHCCCCEEEEECC-CCCHHHHHHHHH----CCCC
T ss_conf             99927689998579999999986599856558999678899999999779847997289-998899999983----5897


Q ss_pred             C-EEEEECCCCCCCHHHCCCCC-CCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             0-89951465444010000000-10688851-871687117774212234532126388999999999971898899983
Q gi|254780669|r  188 D-VLFCERGTSFGYNTLVTDMR-SIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       188 ~-i~lcERG~~fgy~~lvvD~~-~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      = -.+.-.|+|=..+.+-.+.. -+..+|+. ..||++---=|             .++-+    +.....|+||..+=+
T Consensus       166 FiY~vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~v----~~~~~~gaDGvIVGS  228 (257)
T PRK13131        166 YIYTLARSGVTGASHTLENDASAIIKTLKTFSPTPALLGFGIS-------------KKEHI----TNAKGMGADGVICGS  228 (257)
T ss_pred             EEEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCC-------------CHHHH----HHHHHCCCCEEEECH
T ss_conf             4999845767798643407699999999966899879980579-------------88999----999855999999878


Q ss_pred             C
Q ss_conf             6
Q gi|254780669|r  265 H  265 (301)
Q Consensus       265 H  265 (301)
                      +
T Consensus       229 a  229 (257)
T PRK13131        229 A  229 (257)
T ss_pred             H
T ss_conf             9


No 207
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]
Probab=55.52  E-value=18  Score=17.47  Aligned_cols=166  Identities=19%  Similarity=0.305  Sum_probs=109.3

Q ss_pred             HHHHHHHHHHHHHHCC----CCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH
Q ss_conf             9999999999655339----970660155768866632224567124888999886652876885--2288999987650
Q gi|254780669|r   60 AFMIAEKLYAICQSLN----IGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD  133 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~----~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~  133 (301)
                      -.+.|+...+.|+++.    ..++|-+               -  ..-+++++++.++..+||-.  -|.+.++++...+
T Consensus        33 P~~~a~~~~~~Ga~~lHlVDLdgA~~g---------------~--~~n~~~i~~i~~~~~~~vQvGGGIRs~~~v~~ll~   95 (241)
T COG0106          33 PLEVAKKWSDQGAEWLHLVDLDGAKAG---------------G--PRNLEAIKEILEATDVPVQVGGGIRSLEDVEALLD   95 (241)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCCC---------------C--CCCHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHH
T ss_conf             899999999809958988626632158---------------7--55499999999857997784087678999999998


Q ss_pred             -HCCEEEECHHHCCCHHHHHHHHHC--CCEEE---EECCCC-------CCHHHHHHHHHHHHHCCCCCEEEEEC---CCC
Q ss_conf             -215788225762899999998505--97799---836777-------89999999999997258780899514---654
Q gi|254780669|r  134 -SVDILQIPALLCRQTDLLTAAAQT--GRVIN---VKKGQF-------LSPWEMHNILQKLHAHGAKDVLFCER---GTS  197 (301)
Q Consensus       134 -~vDilQIgA~~~rqtdLl~a~a~t--~kpV~---iKkgq~-------~s~~e~~~a~eki~~~Gn~~i~lcER---G~~  197 (301)
                       .++..=+|..-.+|.++++++.+.  ++++.   .|.|.-       .|--+..-.++++.+.|...++.|.=   |+.
T Consensus        96 ~G~~rViiGt~av~~p~~v~~~~~~~g~rivv~lD~r~g~vav~GW~e~s~~~~~~l~~~~~~~g~~~ii~TdI~~DGtl  175 (241)
T COG0106          96 AGVARVIIGTAAVKNPDLVKELCEEYGDRIVVALDARDGKVAVSGWQEDSGVELEELAKRLEEVGLAHILYTDISRDGTL  175 (241)
T ss_pred             CCCCEEEEECCEECCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCC
T ss_conf             79988998031216999999999985982899997148853204610125678999999998578776999851446645


Q ss_pred             CCCHHHCCCCCCCHHH-HHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             4401000000010688-85187168711777421223453212638899999999997189889998
Q gi|254780669|r  198 FGYNTLVTDMRSIPIM-TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       198 fgy~~lvvD~~~i~~l-k~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      -|.|     +..+..+ +.+..|||.               +||-++.----+..... |+.|+.+=
T Consensus       176 ~G~n-----~~l~~~l~~~~~ipvia---------------SGGv~s~~Di~~l~~~~-G~~GvIvG  221 (241)
T COG0106         176 SGPN-----VDLVKELAEAVDIPVIA---------------SGGVSSLDDIKALKELS-GVEGVIVG  221 (241)
T ss_pred             CCCC-----HHHHHHHHHHHCCCEEE---------------ECCCCCHHHHHHHHHCC-CCCEEEEE
T ss_conf             7778-----79999999982767898---------------66868799999998557-97289986


No 208
>PRK06460 hypothetical protein; Provisional
Probab=55.18  E-value=18  Score=17.43  Aligned_cols=63  Identities=21%  Similarity=0.336  Sum_probs=29.8

Q ss_pred             HHHHHHHHHHHHCCEEEE-ECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHH-CCCEEEEEC
Q ss_conf             888999886652876885-22889999876-502157882-----2576289999999850-597799836
Q gi|254780669|r  103 GREIFRDLKKKYGFPILT-DVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQ-TGRVINVKK  165 (301)
Q Consensus       103 gL~il~e~k~~~glpv~T-eV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~-t~kpV~iKk  165 (301)
                      ...++++.-.++|+.+.- |..+...++.+ .+..+++++     |..-+.+-+-+.++++ .+.++.+-+
T Consensus        97 t~~l~~~~l~~~Gv~v~~~d~~~~~~~~~~~~~~Tklv~~EspsNP~l~v~Di~~i~~ia~~~gi~~vVDN  167 (375)
T PRK06460         97 SYRFFTDFLRNWGVKVEVARPGEENILEKIKNKRYDVVFVETISNPLLRVIDIPELSKACKENGALLIVDS  167 (375)
T ss_pred             HHHHHHHHHHHCCEEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHCCCEEEEEC
T ss_conf             79999999873786779738999999997347676089998899987640585899999987499389756


No 209
>TIGR00292 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR002922 This family includes P32318 from SWISSPROT a putative thiamine biosynthetic enzyme . This enzyme is involved in the biosynthesis of the thiamine precursor thiazole, and is repressed by thiamine.; GO: 0009228 thiamin biosynthetic process.
Probab=55.16  E-value=18  Score=17.43  Aligned_cols=82  Identities=23%  Similarity=0.431  Sum_probs=63.5

Q ss_pred             HHHHHHHHHCCCC-CEEEEECCCCCC---------CHHHCCCCCCCHHHHHHCCCEE-----ECHHHHHHHCCCCCCCCC
Q ss_conf             9999999725878-089951465444---------0100000001068885187168-----711777421223453212
Q gi|254780669|r  175 HNILQKLHAHGAK-DVLFCERGTSFG---------YNTLVTDMRSIPIMTSMGVPVI-----FDASHSVQQPGIHGNCSG  239 (301)
Q Consensus       175 ~~a~eki~~~Gn~-~i~lcERG~~fg---------y~~lvvD~~~i~~lk~~~~PVi-----~D~SHs~q~p~~~~~~~g  239 (301)
                      +.|+.|+...|.+ +|.+.||=.+||         ++..||.--+-.+|++++.|..     |=.-||            
T Consensus        34 LtAAyylA~~gPDLKv~vlEr~la~GGG~WgGGmlF~~~Vv~~pA~~~L~e~gI~~~d~~dg~~Vads------------  101 (283)
T TIGR00292        34 LTAAYYLAKEGPDLKVVVLERKLAFGGGSWGGGMLFSKIVVEKPAKEILDEFGIRYEDEGDGYVVADS------------  101 (283)
T ss_pred             HHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCCEEEECHHHHHHHHCCCCEEECCCCEEEEHH------------
T ss_conf             68999998429980699985110268986642224561365140468888659813356885487236------------


Q ss_pred             CCHHHHHHHHHHHHHHC----CCEEEEE---ECCCHHH
Q ss_conf             63889999999999718----9889998---3698334
Q gi|254780669|r  240 GERQYIVPLAKAAVAIG----IAGIFLE---THQDPDN  270 (301)
Q Consensus       240 G~r~~v~~la~aa~a~G----~dGlfiE---~Hp~P~~  270 (301)
                        -+++-.++-+|+.+|    .+|.-+|   +-|+|++
T Consensus       102 --~e~~s~l~s~a~~aGn~Ki~~~~~vEDl~~R~~~ek  137 (283)
T TIGR00292       102 --AEFISTLASKALQAGNAKIFNGVSVEDLILRDDTEK  137 (283)
T ss_pred             --HHHHHHHHHHHHCCCCCEEEEEEEEEEEEECCCCCC
T ss_conf             --768999999986588731433368887787688986


No 210
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH. The sequences represented by this model are members of the radical SAM superfamily of enzymes (pfam04055). These enzymes utilize an iron-sulfur redox cluster and S-adenosylmethionine to carry out diverse radical mediated reactions. The members of this clade are frequently found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. The linkage between SHC and this radical SAM enzyme is strong; one is nearly always observed in the same genome where the other is found. A hopanoid biosynthesis locus was described in Zymomonas mobilis consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and this radical SAM enzyme (ZMO0874) which we name here HpnH. Granted, in Z. mobilis, HpnH is in a convergent orientation with respect to HpnA-G, but one gene beyond HpnH
Probab=55.10  E-value=18  Score=17.42  Aligned_cols=161  Identities=11%  Similarity=0.187  Sum_probs=97.1

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCC--HHHHHHHHHCCCEEEE-ECCCCCCHH
Q ss_conf             4567124888999886652876885228899998765021578822576289--9999998505977998-367778999
Q gi|254780669|r   96 RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ--TDLLTAAAQTGRVINV-KKGQFLSPW  172 (301)
Q Consensus        96 rG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rq--tdLl~a~a~t~kpV~i-Kkgq~~s~~  172 (301)
                      +.+..++.+   +.+ ++.|.|+++                 +-=|-=|+|.  ++|++.+-+-++.|.| -+|..+  +
T Consensus        57 ~~Ls~ee~~---~~~-~e~Gap~V~-----------------itGGEPLLr~dl~eIv~~a~~~g~~v~l~TNG~Ll--~  113 (318)
T TIGR03470        57 QRLSVEECL---RAV-DECGAPVVS-----------------IPGGEPLLHPEIDEIVRGLVARKKFVYLCTNALLL--E  113 (318)
T ss_pred             CCCCHHHHH---HHH-HHCCCCEEE-----------------ECCCCCCCCCCHHHHHHHHHHCCCEEEEECCHHHH--H
T ss_conf             438999999---999-984997899-----------------51887455647999999999759979997755200--9


Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCC--------CCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHH
Q ss_conf             999999999725878089951465444010000--------000106888518716871177742122345321263889
Q gi|254780669|r  173 EMHNILQKLHAHGAKDVLFCERGTSFGYNTLVT--------DMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQY  244 (301)
Q Consensus       173 e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvv--------D~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~  244 (301)
                         ..++++...|...+-+---|.. ..++..+        -+++|-..|+.+++|.+..|=-          .+-+.+-
T Consensus       114 ---k~i~~~~~~~~~~~~VsLDG~~-e~HD~~r~~~G~Fd~av~aIr~ak~~G~~V~iN~Tvf----------~~~n~~~  179 (318)
T TIGR03470       114 ---KKLDKFEPSPYLTFSVHLDGLR-EHHDASVCREGVFDRAVEAIREAKARGFRVTTNTTLF----------NDTDPEE  179 (318)
T ss_pred             ---HHHHHHHHCCCCEEEEECCCCH-HHHHHHHCCCCHHHHHHHHHHHHHHCCCCEEEEEEEE----------CCCCHHH
T ss_conf             ---9999985188836999801787-8866887179779999999999998699467998970----------6899999


Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             99999999971898899983698334797820186889999999999999
Q gi|254780669|r  245 IVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAI  294 (301)
Q Consensus       245 v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~i  294 (301)
                      |..+---+...|+||+++..+-+=+.| .|..--+.-.+.++++..+.+.
T Consensus       180 i~~~~d~~~~lgVdgi~isp~y~Ye~a-p~q~~fl~r~~~~~lfr~il~~  228 (318)
T TIGR03470       180 VAEFFDYLTDLGVDGMTISPGYAYEKA-PDQDHFLGRRQTKKLFREVLSN  228 (318)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCC-CCCCCCCCHHHHHHHHHHHHHH
T ss_conf             999999998769973897665310237-6311115899999999999986


No 211
>COG3964 Predicted amidohydrolase [General function prediction only]
Probab=55.06  E-value=18  Score=17.42  Aligned_cols=139  Identities=25%  Similarity=0.300  Sum_probs=84.1

Q ss_pred             HHHHHHCCEEE----------ECHHHCCCHHHHHHHHHC-CCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             87650215788----------225762899999998505-9779983677789999999999997258780899514654
Q gi|254780669|r  129 EAIADSVDILQ----------IPALLCRQTDLLTAAAQT-GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTS  197 (301)
Q Consensus       129 e~~~~~vDilQ----------IgA~~~rqtdLl~a~a~t-~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~  197 (301)
                      +.+.++-|++|          +|..-..--+|-+++++- +.|+++--|-  -|.-|.-.+|++.. | +=|--|-+|. 
T Consensus       145 aa~reh~d~ivGlKvR~s~~~~g~~GitPl~la~~ia~~~klPlmvHige--Pp~~~dEvlerL~~-G-DIitHcfngk-  219 (386)
T COG3964         145 AAFREHRDVIVGLKVRVSTEDIGEYGITPLTLALRIANDLKLPLMVHIGE--PPVLMDEVLERLRR-G-DIITHCFNGK-  219 (386)
T ss_pred             HHHHHCCCCEEEEEEEEEECCCCCCCCCHHHHHHHHHHHCCCCEEEECCC--CCCCHHHHHHHCCC-C-CEEEEECCCC-
T ss_conf             99985857078778875400133468765789999986159966996599--99628889976357-7-6565403699-


Q ss_pred             CCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCCC
Q ss_conf             440100000001068885-1871687117774212234532126388999999999971898899983698334797820
Q gi|254780669|r  198 FGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP  276 (301)
Q Consensus       198 fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~  276 (301)
                       +-.-+.-|---.+.+++ ..--|++|.-|             |...|-...|++|+|.|.--..|-         ||=.
T Consensus       220 -pn~~l~~dg~vr~~vrra~erGV~fD~gh-------------G~asfsf~vAr~aia~GllP~~IS---------SDlh  276 (386)
T COG3964         220 -PNTILTDDGVVRAEVRRARERGVIFDAGH-------------GRASFSFNVARRAIANGLLPDIIS---------SDLH  276 (386)
T ss_pred             -CCCCCCCCHHHHHHHHHHHHCCEEEECCC-------------CCCEEEHHHHHHHHHCCCCCCEEE---------CCCE
T ss_conf             -99722662557899999875664897248-------------732024799999986577864232---------2310


Q ss_pred             ----CCCCHHHHHHHHHHHHHHH
Q ss_conf             ----1868899999999999999
Q gi|254780669|r  277 ----NMINIKDLPKLLSQLLAID  295 (301)
Q Consensus       277 ----q~l~l~~l~~ll~~l~~i~  295 (301)
                          -..|--.|...|+++.++.
T Consensus       277 ~~~~~n~Pv~dla~~mSKllalg  299 (386)
T COG3964         277 TITKLNGPVYDLAWIMSKLLALG  299 (386)
T ss_pred             EEEECCCHHHHHHHHHHHHHHCC
T ss_conf             35305761878999999998728


No 212
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase family protein; InterPro: IPR005720   Dihydroorotate dehydrogenase (1.3.3.1 from EC) (DHOdehase) catalyzes the fourth step in the de novo biosynthesis of pyrimidine, the conversion of dihydroorotate into orotate. DHOdehase is a ubiquitous FAD flavoprotein. In bacteria (gene pyrD), DHOdease is located on the inner side of the cytosolic membrane. In some yeasts, such as in Saccharomyces cerevisiae (gene URA1, subfamily 2), it is a cytosolic protein while in other eukaryotes it is found in the mitochondria .    This describes dihydroorotate dehydrogenases subfamily 1 that includes a number of uncharacterised proteins and a domain of dihydropyrimidine dehydrogenase.; GO: 0004158 dihydroorotate oxidase activity, 0006207 'de novo' pyrimidine base biosynthetic process, 0005737 cytoplasm.
Probab=53.97  E-value=17  Score=17.64  Aligned_cols=152  Identities=18%  Similarity=0.217  Sum_probs=90.9

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCE---EEEECCC---------HHHHHHHHHHCCEE---------------EECHHHCCC
Q ss_conf             24567124888999886652876---8852288---------99998765021578---------------822576289
Q gi|254780669|r   95 KRGVGLKKGREIFRDLKKKYGFP---ILTDVHT---------EQQCEAIADSVDIL---------------QIPALLCRQ  147 (301)
Q Consensus        95 frG~Gle~gL~il~e~k~~~glp---v~TeV~~---------~~~~e~~~~~vDil---------------QIgA~~~rq  147 (301)
                      .+-||+|+=|+=+...++++.-+   ++.-|--         .+++|.+.+|+|++               .||.=.---
T Consensus        70 L~NPG~e~fl~E~~~~~~e~~t~dvr~I~svyG~~~EEfa~va~~~e~A~~y~~~~ELN~SCPhvK~G~G~~iG~dP~l~  149 (308)
T TIGR01037        70 LQNPGVEAFLEELKDVREEVPTHDVRLIASVYGESEEEFAEVAEKLEDADPYVDAYELNVSCPHVKGGGGIEIGQDPELS  149 (308)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHEEEECCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             89821799998632566438987528999831888225899999872113440000104777443423465547787799


Q ss_pred             HHHHHHHHH-CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE--EEC-CCCCCCHHHCCCCC-CCHHH---------
Q ss_conf             999999850-59779983677789999999999997258780899--514-65444010000000-10688---------
Q gi|254780669|r  148 TDLLTAAAQ-TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLF--CER-GTSFGYNTLVTDMR-SIPIM---------  213 (301)
Q Consensus       148 tdLl~a~a~-t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~l--cER-G~~fgy~~lvvD~~-~i~~l---------  213 (301)
                      +++.+|+.+ +++||..|=-  ....|..-.|.-+...|.+-+.+  |-| |..       .|++ .=|+|         
T Consensus       150 ~~vv~avK~~~d~Pv~aKLs--PNV~Di~eiA~a~eeaGaDGlt~INTl~PGMk-------IDI~~~kPiLaNk~GGlSG  220 (308)
T TIGR01037       150 ADVVKAVKDKVDVPVFAKLS--PNVTDITEIAKAAEEAGADGLTLINTLRPGMK-------IDIKAKKPILANKTGGLSG  220 (308)
T ss_pred             HHHHHHHHCCCCCCEEEECC--CCHHHHHHHHHHHHHCCCCEEEEEHHHHHHHH-------HHHHCCCCCCEECCCCCCC
T ss_conf             99999983000786578648--65668999988875327761640012034677-------7342078700004588507


Q ss_pred             ---HHHCCCEEECHHHHHH--HCC-CCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             ---8518716871177742--122-345321263889999999999718
Q gi|254780669|r  214 ---TSMGVPVIFDASHSVQ--QPG-IHGNCSGGERQYIVPLAKAAVAIG  256 (301)
Q Consensus       214 ---k~~~~PVi~D~SHs~q--~p~-~~~~~~gG~r~~v~~la~aa~a~G  256 (301)
                         |-..+.+|+|.+..+-  -|= |.||.+ -.+|-++.|---|-|..
T Consensus       221 PAIKPiA~r~VYdly~~~ddriPIiGvGGi~-~~eDA~Efl~AGAsAVQ  268 (308)
T TIGR01037       221 PAIKPIAVRMVYDLYKEVDDRIPIIGVGGIT-SFEDALEFLMAGASAVQ  268 (308)
T ss_pred             CCCCCEEEEEHHHHHHHHCCCCCEEEECCCC-CHHHHHHHHHHCCCEEE
T ss_conf             5014221210000477737823468632745-58999999985220220


No 213
>pfam04441 Pox_VERT_large Poxvirus early transcription factor (VETF), large subunit. The poxvirus early transcription factor (VETF), in addition to the viral RNA polymerase, is required for efficient transcription of early genes in vitro. VETF is a heterodimeric protein that binds specifically to early gene promoters. The heterodimer is comprised of an 82 kDa (this family) subunit and a 70 kDa subunit.
Probab=53.92  E-value=13  Score=18.29  Aligned_cols=75  Identities=20%  Similarity=0.374  Sum_probs=55.8

Q ss_pred             CHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC-------CHHHCCCC-CCCHH
Q ss_conf             25762899999998505977998367778999999999999725878089951465444-------01000000-01068
Q gi|254780669|r  141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFG-------YNTLVTDM-RSIPI  212 (301)
Q Consensus       141 gA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg-------y~~lvvD~-~~i~~  212 (301)
                      +.|-||||-     -+..|||.+-   .+..+ |..+.+.+....-++|.+-.-|.+|.       |++.  -| ..+..
T Consensus       363 wSRiCQNtK-----~k~RkPViv~---slD~d-m~KiSdnFyks~~~eVfin~NgvmfsC~dp~gkYnn~--GFL~ify~  431 (700)
T pfam04441       363 WSRICQNTK-----DKNRKPVIIS---SLDED-MIKISDNFYKSKEDEVFINSNGVMFSCSDPYGKYNNM--GFLNIFYK  431 (700)
T ss_pred             HHHHHCCCC-----CCCCCCEEEE---CCCHH-HHHHHHCCCCCCCCEEEECCCCEEEEECCCCCCCCCC--HHHHHHHH
T ss_conf             246641456-----4577867973---13544-7876541223888569984896599935741243442--09999999


Q ss_pred             HHHHCCCEEE--CHHH
Q ss_conf             8851871687--1177
Q gi|254780669|r  213 MTSMGVPVIF--DASH  226 (301)
Q Consensus       213 lk~~~~PVi~--D~SH  226 (301)
                      +++..+|-||  |-+|
T Consensus       432 lq~iCiPCCflk~q~h  447 (700)
T pfam04441       432 LQGICIPCCFLKDQSH  447 (700)
T ss_pred             HHCCEEEEEECCCCCC
T ss_conf             7586832031136443


No 214
>PRK13523 NADPH dehydrogenase NamA; Provisional
Probab=53.83  E-value=19  Score=17.29  Aligned_cols=96  Identities=7%  Similarity=0.101  Sum_probs=47.9

Q ss_pred             HHHHHHHHC-CCEEEEECC------CCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCH-----HHCCCCCCCHHHHH-
Q ss_conf             999998505-977998367------77899999999999972587808995146544401-----00000001068885-
Q gi|254780669|r  149 DLLTAAAQT-GRVINVKKG------QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN-----TLVTDMRSIPIMTS-  215 (301)
Q Consensus       149 dLl~a~a~t-~kpV~iKkg------q~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~-----~lvvD~~~i~~lk~-  215 (301)
                      +.++++-+. +.||.++=.      -.++++|+...+.++...|. +.+=+-.|..+.-.     ...+++  ...+|+ 
T Consensus       197 Eii~aVr~~~~~~v~vRis~~d~~~gG~~~~d~~~~~~~l~~~Gv-D~i~vs~G~~~~~~~~~~~g~~~~~--a~~ik~~  273 (337)
T PRK13523        197 EIIDAVKEVWDGPLFVRISASDYHPDGLTVQDYVQYAKWMKEQGV-DLIDVSSGAVVPARIDVYPGYQVPF--AEHIKEH  273 (337)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEEECCCCCCCCCCCCCCCCCHHH--HHHHHHH
T ss_conf             999999986588639993365557899898999999999997499-9899578855477677787533489--9999987


Q ss_pred             HCCCEEE-----CHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             1871687-----11777421223453212638899999999997
Q gi|254780669|r  216 MGVPVIF-----DASHSVQQPGIHGNCSGGERQYIVPLAKAAVA  254 (301)
Q Consensus       216 ~~~PVi~-----D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a  254 (301)
                      ...||+.     ||..+-+.-      ..|.-++| .++|+-+|
T Consensus       274 ~~ipvi~vG~i~~~~~ae~~l------~~G~aD~V-~~gR~~ia  310 (337)
T PRK13523        274 ANIATGAVGLITTGAQAEEIL------NNNRADLI-FIGRELLR  310 (337)
T ss_pred             CCCCEEEECCCCCHHHHHHHH------HCCCCCHH-HHHHHHHH
T ss_conf             697099983869999999999------87994799-98999998


No 215
>PRK05586 biotin carboxylase; Validated
Probab=53.76  E-value=19  Score=17.28  Aligned_cols=128  Identities=21%  Similarity=0.223  Sum_probs=73.1

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCC-CEEEEC---CCCCCCCCCCCCCCCCCCHHHHHH------HHHHHHHH
Q ss_conf             69995486349999999999999996553399-706601---557688666322245671248889------99886652
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNI-GLVYKS---SFDKANRSSLAGKRGVGLKKGREI------FRDLKKKY  114 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~-~~ifK~---sfdKanRtS~~sfrG~Gle~gL~i------l~e~k~~~  114 (301)
                      .+.|.++-..|||--+-.+.+..++.+.+..- ||-|=+   .|-++...+--.|=||.. +.++.      .+++..+.
T Consensus        48 ~~~lg~~~~~~sYln~~~ii~~A~~~g~dAihPGYGFLSEna~Fa~~~~~~Gi~fIGP~~-~~i~~~GdK~~ar~~a~~~  126 (447)
T PRK05586         48 AVCIGPASSKDSYLNIYNILSATVLTGAQAIHPGFGFLSENSKFAKMCKECNIVFIGPDS-ETIELMGNKSNAREIMKKA  126 (447)
T ss_pred             EEECCCCCHHHHHCCHHHHHHHHHHHCCCEEECCCCHHHCCHHHHHHHHHCCCEEECCCH-HHHHHHCCHHHHHHHHHHC
T ss_conf             987399995651148999999999849989971855322389999999987987989599-9999853849999999984


Q ss_pred             CCEEEEE----CCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEEC-------CC--CCCHHHHHHHHHHH
Q ss_conf             8768852----28899998765021578822576289999999850597799836-------77--78999999999999
Q gi|254780669|r  115 GFPILTD----VHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK-------GQ--FLSPWEMHNILQKL  181 (301)
Q Consensus       115 glpv~Te----V~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKk-------gq--~~s~~e~~~a~eki  181 (301)
                      |+|++.-    +.+.                      .+++..+.+.|-||++|-       |+  --+.+|+..+.+..
T Consensus       127 gvPv~pg~~~~v~~~----------------------~ea~~~a~~iGyPv~lKAa~GGGGrGmriv~~~~el~~~~~~a  184 (447)
T PRK05586        127 GVPVVPGSEGEIENE----------------------EEALKIAEEIGYPVMVKASAGGGGRGIRIVRSEEELIKAFNTA  184 (447)
T ss_pred             CCCCCCCCCCCCCCH----------------------HHHHHHHHHCCCCEEEECCCCCCCCEEEEECCHHHHHHHHHHH
T ss_conf             997656868888999----------------------9999999862982376305699977369989999999999999


Q ss_pred             -----HHCCCCCEEEEECCC
Q ss_conf             -----725878089951465
Q gi|254780669|r  182 -----HAHGAKDVLFCERGT  196 (301)
Q Consensus       182 -----~~~Gn~~i~lcERG~  196 (301)
                           .++|+..+ +.||=.
T Consensus       185 ~~ea~~aFg~~~v-~vEk~i  203 (447)
T PRK05586        185 KSEAKAAFGDDSM-YIEKFI  203 (447)
T ss_pred             HHHHHHHCCCCCE-EEEEEC
T ss_conf             9999982799846-887724


No 216
>cd00615 Orn_deC_like Ornithine decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD corresponds to ornithine decarboxylase (ODC), arginine decarboxylase (ADC) and lysine decarboxylase (LDC). ODC is a dodecamer composed of six homodimers and catalyzes the decarboxylation of tryptophan. ADC catalyzes the decarboxylation of arginine and LDC catalyzes the decarboxylation of lysine. Members of this family are widely found in all three forms of life.
Probab=53.56  E-value=4.1  Score=21.61  Aligned_cols=80  Identities=21%  Similarity=0.316  Sum_probs=51.7

Q ss_pred             CCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH-HHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHH
Q ss_conf             899999999999972587808995146544401000000010688-8518716871177742122345321263889999
Q gi|254780669|r  169 LSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM-TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVP  247 (301)
Q Consensus       169 ~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l-k~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~  247 (301)
                      .++++...+.+.-  .+.+-++++.    -.|.-.+.|++.+..+ ++.+.|+++|--|.            +.-.|.|.
T Consensus       140 i~~~~~~~al~~~--p~~kav~lt~----PtY~G~~~Dl~~i~~~~h~~~~~llVDEAhG------------ah~~F~~~  201 (294)
T cd00615         140 IPPETFKKALIEH--PDAKAAVITN----PTYYGICYNLRKIVEEAHHRGLPVLVDEAHG------------AHFRFHPI  201 (294)
T ss_pred             CCHHHHHHHHHHC--CCCCEEEEEC----CCCCEEEECHHHHHHHHHHCCCEEEEECCCH------------HHHHCCCC
T ss_conf             9999999999858--9965899977----9988776689999999840499799977540------------34431877


Q ss_pred             HHHHHHHHCCCEEEEEECC
Q ss_conf             9999997189889998369
Q gi|254780669|r  248 LAKAAVAIGIAGIFLETHQ  266 (301)
Q Consensus       248 la~aa~a~G~dGlfiE~Hp  266 (301)
                      +-..|+..|+|-..--+|-
T Consensus       202 lp~~a~~~GAD~vv~S~HK  220 (294)
T cd00615         202 LPSSAAMAGADIVVQSTHK  220 (294)
T ss_pred             CCCCHHHCCCEEEEECHHH
T ss_conf             8755666696399962321


No 217
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed
Probab=53.56  E-value=19  Score=17.26  Aligned_cols=175  Identities=13%  Similarity=0.279  Sum_probs=89.0

Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCC-----E
Q ss_conf             99999996553399706601557688666322245671248889998866528768852288999987650215-----7
Q gi|254780669|r   63 IAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD-----I  137 (301)
Q Consensus        63 ~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vD-----i  137 (301)
                      +++.+.+...+...+.|--        .|+..++-.|++.-..+.+.+.+++.+||.--.-+....|.+.+.+|     +
T Consensus        30 ~~~Avi~AAee~~sPvIlq--------~s~~~~~~~~~~~~~~~~~~~a~~~~VPV~lHLDH~~~~e~i~~ai~~GftSV  101 (286)
T PRK12738         30 TIQAILEVCSEMRSPVILA--------GTPGTFKHIALEEIYALCSAYSTTYNMPLALHLDHHESLDDIRRKVHAGVRSA  101 (286)
T ss_pred             HHHHHHHHHHHHCCCEEEE--------CCHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEE
T ss_conf             9999999999978998999--------37537766699999999999999879999998999999999999997799879


Q ss_pred             EEECHH-----HCCCH-HHHHHHHHCCCEEE----------------EECCCCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             882257-----62899-99999850597799----------------836777899999999999972587808995146
Q gi|254780669|r  138 LQIPAL-----LCRQT-DLLTAAAQTGRVIN----------------VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERG  195 (301)
Q Consensus       138 lQIgA~-----~~rqt-dLl~a~a~t~kpV~----------------iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG  195 (301)
                      .-=++.     |.+.| +.++.+...|.+|=                .....+.+|+|.   .+.+..+|.+ .+..-=|
T Consensus       102 M~DgS~lp~eeNi~~Tk~vv~~Ah~~gv~VEaElG~igg~ed~~~~~~~~~~~T~peea---~~Fv~~TgvD-~LAvaiG  177 (286)
T PRK12738        102 MIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGGVEDDMSVDAESAFLTDPQEA---KRFVELTGVD-SLAVAIG  177 (286)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHHH---HHHHHHHCCC-EEHHHHC
T ss_conf             87389999999999999999998473997888641346657776666522357999999---9999987978-1223323


Q ss_pred             CCCC-CHHH-CCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             5444-0100-000001068885-18716871177742122345321263889999999999718988999836
Q gi|254780669|r  196 TSFG-YNTL-VTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH  265 (301)
Q Consensus       196 ~~fg-y~~l-vvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~H  265 (301)
                      +..| |..- -.|+.-+..+++ .+.|.++   |     |+    ||=..    ..-+.|+..|+.=+=+-|.
T Consensus       178 n~HG~y~~~p~l~~~~L~~I~~~~~iPLVL---H-----Gg----SG~~~----e~i~~ai~~Gi~KvNi~T~  234 (286)
T PRK12738        178 TAHGLYSKTPKIDFQRLAEIREVVDVPLVL---H-----GA----SDVPD----EFVRRTIELGVTKVNVATE  234 (286)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHCCCCCEEE---E-----CC----CCCCH----HHHHHHHHCCEEEEEECHH
T ss_conf             546777999947899999997307999897---6-----99----99999----9999999769069984858


No 218
>PRK06801 hypothetical protein; Provisional
Probab=53.40  E-value=19  Score=17.25  Aligned_cols=173  Identities=17%  Similarity=0.236  Sum_probs=90.1

Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCC-----EE
Q ss_conf             9999996553399706601557688666322245671248889998866528768852288999987650215-----78
Q gi|254780669|r   64 AEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD-----IL  138 (301)
Q Consensus        64 A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vD-----il  138 (301)
                      ++.+.+.......+.|---        |+...+..|++.-..+++.+.++..+||.--.-+....+.+.+.+|     |.
T Consensus        31 ~~avi~AAee~~sPvIlq~--------s~~~~~~~~~~~~~~~~~~~a~~~~VPV~lHLDHg~~~e~i~~ai~~Gf~SVM  102 (286)
T PRK06801         31 LRALFAAAKQERSPFIINI--------AEVHFKYISLESLVEAVKFEAAHHDIPVVLNLDHGLHFEAVVRALRLGFSSVM  102 (286)
T ss_pred             HHHHHHHHHHHCCCEEEEC--------CHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEE
T ss_conf             9999999999787989980--------67577566999999999999987799899989999999999999982998799


Q ss_pred             EECHH-----HCCCH-HHHHHHHHCCCEEEEE-----------------CCCCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             82257-----62899-9999985059779983-----------------6777899999999999972587808995146
Q gi|254780669|r  139 QIPAL-----LCRQT-DLLTAAAQTGRVINVK-----------------KGQFLSPWEMHNILQKLHAHGAKDVLFCERG  195 (301)
Q Consensus       139 QIgA~-----~~rqt-dLl~a~a~t~kpV~iK-----------------kgq~~s~~e~~~a~eki~~~Gn~~i~lcERG  195 (301)
                      .=|+.     |.+.| ..++-+.+.|.+|---                 ...+-+|++   |.+.+..+|.+ .+..-=|
T Consensus       103 ~DgS~l~~eeNi~~Tk~vve~ah~~gv~VEaElG~vgg~ed~~~~~~~~~~~~T~pee---a~~Fv~~TgvD-~LAvaiG  178 (286)
T PRK06801        103 FDGSTLEYEENVRQTREVVKMCHAVGVSVEAELGAVGGDEGGALYGEADSNLFTDPAI---ARDFVDRTGID-ALAVAIG  178 (286)
T ss_pred             EECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCHHH---HHHHHHHHCCC-EEEEECC
T ss_conf             7499899999999999999999884985999963105766776557653002689999---99999986998-9975225


Q ss_pred             CCCC-CHHH-CCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             5444-0100-000001068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  196 TSFG-YNTL-VTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       196 ~~fg-y~~l-vvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      +..| |..- -.|+--+..+++ .+.|.++   |.     +    ||=.    ...-+.|+..|+.=+=+-|
T Consensus       179 n~HG~yk~~p~L~~~~L~~I~~~~~vPLVL---HG-----g----SGi~----~e~i~~ai~~Gv~KiNi~T  234 (286)
T PRK06801        179 NAHGKYKGEPKLDFARLAAIHQQTGLPLVL---HG-----G----SGIS----DTDFRRAISLGIHKINFYT  234 (286)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHCCCCEEE---EC-----C----CCCC----HHHHHHHHHCCCEEEEECH
T ss_conf             455676898867999999999852999897---79-----9----9999----9999999977976998286


No 219
>PRK07178 acetyl-CoA carboxylase; Validated
Probab=53.33  E-value=19  Score=17.24  Aligned_cols=124  Identities=15%  Similarity=0.077  Sum_probs=50.7

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCC-CEEEEC---CCCCCCCCCCCCCCCCCCHHHHHHH------HHHHHHHCCEEE
Q ss_conf             486349999999999999996553399-706601---5576886663222456712488899------988665287688
Q gi|254780669|r   50 GPCQIESHDHAFMIAEKLYAICQSLNI-GLVYKS---SFDKANRSSLAGKRGVGLKKGREIF------RDLKKKYGFPIL  119 (301)
Q Consensus        50 GPCsiES~e~~~~~A~~lk~~~~~~~~-~~ifK~---sfdKanRtS~~sfrG~Gle~gL~il------~e~k~~~glpv~  119 (301)
                      |+-..+||--+-.+.+..++.+.+..- ||=|=+   .|-++....---|=||.- +.++.+      +++-.+.|+|++
T Consensus        52 g~~~~~sYln~~~Ii~~A~~~g~dAiHPGYGFLSEn~~FA~~~~~~gi~FIGPs~-~~i~~~GdK~~ar~~a~~~gvPv~  130 (471)
T PRK07178         52 GADPLAGYLNPRKLVNLAVETGCDALHPGYGFLSENAELAEICAERGIKFIGPSA-DVIRRMGDKTEARRSMIKAGVPVT  130 (471)
T ss_pred             CCCHHHHHCCHHHHHHHHHHHCCCEEECCCCHHHCCHHHHHHHHHCCCEEECCCH-HHHHHHHCHHHHHHHHHHCCCCCC
T ss_conf             8872665449999999999969999977833311598999999978998999599-999987483989999998699826


Q ss_pred             EECCCHHHHHHHHHHCCEEEECHHHCCC-HHHHHHHHHCCCEEEEECCCC---------CCHHHHHHHHHH-----HHHC
Q ss_conf             5228899998765021578822576289-999999850597799836777---------899999999999-----9725
Q gi|254780669|r  120 TDVHTEQQCEAIADSVDILQIPALLCRQ-TDLLTAAAQTGRVINVKKGQF---------LSPWEMHNILQK-----LHAH  184 (301)
Q Consensus       120 TeV~~~~~~e~~~~~vDilQIgA~~~rq-tdLl~a~a~t~kpV~iKkgq~---------~s~~e~~~a~ek-----i~~~  184 (301)
                      .--..                   +..+ -+.++.+.+.|-||+||--..         -+.+++..+.+.     ..++
T Consensus       131 pgs~~-------------------~v~~~eea~~~A~~iGyPV~lKAa~GGGGrGmrvv~~~~el~~~~~~~~~EA~~aF  191 (471)
T PRK07178        131 PGSEG-------------------NLADIDEALAEAERIGYPVMLKATSGGGGRGIRRCNSREELEQNFPRVISEATKAF  191 (471)
T ss_pred             CCCCC-------------------CCCCHHHHHHHHHHCCCCEEEEECCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHC
T ss_conf             89688-------------------65669999999986698158632026876644997660568899999999999844


Q ss_pred             CCCCEEEEEC
Q ss_conf             8780899514
Q gi|254780669|r  185 GAKDVLFCER  194 (301)
Q Consensus       185 Gn~~i~lcER  194 (301)
                      |+..|+ .||
T Consensus       192 g~~~v~-lEk  200 (471)
T PRK07178        192 GSAEVF-LEK  200 (471)
T ss_pred             CCCCEE-EEE
T ss_conf             997368-766


No 220
>TIGR01404 FlhB_rel_III type III secretion protein, YscU/HrpY family; InterPro: IPR006307   This is one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems. This family is homologous to, but distinguished from, the flagellar biosynthetic protein FlhB (IPR006136 from INTERPRO). This model may not identify all type III secretion system FlhB homologs. ; GO: 0006810 transport, 0016021 integral to membrane.
Probab=53.04  E-value=14  Score=18.04  Aligned_cols=52  Identities=17%  Similarity=0.288  Sum_probs=39.5

Q ss_pred             HCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHH
Q ss_conf             339970660155768866632224567124888999886652876885228899998
Q gi|254780669|r   73 SLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCE  129 (301)
Q Consensus        73 ~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e  129 (301)
                      ++.++..|+|.=-+.=|=   +.+|-+ +.++.+.+++ ++.|+||+.||--.+++=
T Consensus       268 HiAi~iyY~p~etPlP~i---~~~g~d-~~A~~~~~~A-~~~giPvv~~~~LAR~Ly  319 (346)
T TIGR01404       268 HIAIGIYYKPGETPLPLI---IAKGTD-AQALAVIAYA-EEAGIPVVRDIPLARQLY  319 (346)
T ss_pred             CEEEEECCCCCCCCCCEE---EEECCC-HHHHHHHHHH-HHCCCCEECCCHHHHHHH
T ss_conf             101121025677898778---873564-8999999999-975898522747999998


No 221
>cd00453 FTBP_aldolase_II Fructose/tagarose-bisphosphate aldolase class II. This family includes fructose-1,6-bisphosphate (FBP) and tagarose 1,6-bisphosphate (TBP) aldolases. FBP-aldolase is homodimeric and used in gluconeogenesis and glycolysis; the enzyme controls the condensation of dihydroxyacetone phosphate with glyceraldehyde-3-phosphate to yield fructose-1,6-bisphosphate. TBP-aldolase is tetrameric and produces tagarose-1,6-bisphosphate. There is an absolute requirement for a divalent metal ion, usually zinc, and in addition the enzymes are activated by monovalent cations such as Na+. Although structurally similar, the class I aldolases use a different mechanism and are believed to have an independent evolutionary origin.
Probab=52.92  E-value=19  Score=17.20  Aligned_cols=152  Identities=16%  Similarity=0.285  Sum_probs=70.9

Q ss_pred             CCCHHHHHHHHHHHHHHCCEEEEECCC--H---HHHHHHHH-------------HCCEEEECH-----HHCCCH-HHHHH
Q ss_conf             671248889998866528768852288--9---99987650-------------215788225-----762899-99999
Q gi|254780669|r   98 VGLKKGREIFRDLKKKYGFPILTDVHT--E---QQCEAIAD-------------SVDILQIPA-----LLCRQT-DLLTA  153 (301)
Q Consensus        98 ~Gle~gL~il~e~k~~~glpv~TeV~~--~---~~~e~~~~-------------~vDilQIgA-----~~~rqt-dLl~a  153 (301)
                      .|++..-.+.+.+.+++++||+--.-+  .   +.+....+             +--+..=|+     .|.+.| ++++-
T Consensus        68 ~g~~~~~~~v~~~A~~~~VPVaLHlDH~~~~~l~~i~~~i~aG~~~~~~~~~~~FsSvMiDgS~~p~eENi~~Tkevve~  147 (340)
T cd00453          68 LGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLER  147 (340)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             42899999999999866998899767788755588999999718888644788984587538989999999999999999


Q ss_pred             HHHCCCEEEE------------------ECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC-CH--HHCCCCCCCHH
Q ss_conf             8505977998------------------367778999999999999725878089951465444-01--00000001068
Q gi|254780669|r  154 AAQTGRVINV------------------KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFG-YN--TLVTDMRSIPI  212 (301)
Q Consensus       154 ~a~t~kpV~i------------------Kkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg-y~--~lvvD~~~i~~  212 (301)
                      +...|..|=.                  ....+..|+|....++..-..+.-+.+.+-=|++.| |.  +-..|+--+..
T Consensus       148 Ah~~gvsVEaELG~iGG~Edgv~~~~~~~~~~yTdPeea~~fv~~tG~~~~vD~LAvaiGt~HG~Yk~g~~~L~~~~L~~  227 (340)
T cd00453         148 MSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKKGNVVLTPTILRD  227 (340)
T ss_pred             HHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCCCHHHHHH
T ss_conf             99849928996210257666766655543345589899999999866888861577640445556689998579899999


Q ss_pred             HHHH----------CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             8851----------8716871177742122345321263889999999999718988999836
Q gi|254780669|r  213 MTSM----------GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH  265 (301)
Q Consensus       213 lk~~----------~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~H  265 (301)
                      .++.          .+|.++   |     |+    ||--.|.+    +.|+..|+.=+=|-|.
T Consensus       228 i~~~v~~~~~~~~~~vpLVl---H-----Gg----SGvp~e~i----~~ai~~GV~KiNIdTd  274 (340)
T cd00453         228 SQEYVSKKHNLPHNSLNFVF---H-----GG----SGSTAQEI----KDSVSYGVVKMNIDTD  274 (340)
T ss_pred             HHHHHHHHHCCCCCCCCEEE---E-----CC----CCCCHHHH----HHHHHCCCEECCCCHH
T ss_conf             99999997388888874574---1-----78----89999999----9999829653235608


No 222
>pfam01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II.
Probab=52.88  E-value=19  Score=17.19  Aligned_cols=175  Identities=17%  Similarity=0.291  Sum_probs=87.5

Q ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCC-----
Q ss_conf             999999996553399706601557688666322245671248889998866528768852288999987650215-----
Q gi|254780669|r   62 MIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD-----  136 (301)
Q Consensus        62 ~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vD-----  136 (301)
                      ++++.+.+...+...+.|.--        |+...+-.|++.-..+++.+.+++++||.--.-+....|.+.+.+|     
T Consensus        27 e~~~avi~AAee~~sPvIlq~--------s~~~~~~~g~~~~~~~~~~~a~~~~VPV~lHLDH~~~~e~~~~ai~~GftS   98 (283)
T pfam01116        27 ETINAVLEAAEEANSPVIIQV--------SPGAAKYAGAEALAAMVRAAAEKYSVPVALHLDHGASFEGILEAIEAGFSS   98 (283)
T ss_pred             HHHHHHHHHHHHHCCCEEEEC--------CCCHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCE
T ss_conf             999999999999699999996--------844675589999999999999977998999667779999999999819986


Q ss_pred             EEEECH-----HHCCCH-HHHHHHHHCCCEEEEE----------------CCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             788225-----762899-9999985059779983----------------677789999999999997258780899514
Q gi|254780669|r  137 ILQIPA-----LLCRQT-DLLTAAAQTGRVINVK----------------KGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       137 ilQIgA-----~~~rqt-dLl~a~a~t~kpV~iK----------------kgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      |.-=++     -|.++| +.++-+-..|.+|=--                ...+-+|++   |.+.+..+|. +.+..-=
T Consensus        99 VM~DgS~l~~eeNi~~T~~vv~~Ah~~gv~VEaElG~vgg~Ed~~~~~~~~~~~T~pee---a~~Fv~~Tgv-D~LAvai  174 (283)
T pfam01116        99 VMIDGSHLPFEENIAITKEVVEYAHARGVSVEAELGRIGGEEDGVDNSEDEALYTDPEE---AKEFVERTGV-DSLAVAI  174 (283)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCCCCCHHH---HHHHHHHHCC-CEEEEEC
T ss_conf             98638979999999999999999987398489975003675667677763222589999---9999998698-8787643


Q ss_pred             CCCCC-CHHH--CCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             65444-0100--000001068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  195 GTSFG-YNTL--VTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       195 G~~fg-y~~l--vvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      |+..| |...  -.||--+..+++ ...|.++--+.             |..   ...-+.|+..|+.=+=+-|
T Consensus       175 G~~HG~yk~~~p~L~~~~L~~I~~~~~iPLVlHGgS-------------G~~---~e~~~~ai~~Gi~KiNi~T  232 (283)
T pfam01116       175 GNVHGVYKPLEPKLDFDRLKEIQAAVDVPLVLHGGS-------------GVP---DEEIRKAIKLGVAKINIDT  232 (283)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCC-------------CCC---HHHHHHHHHCCCEEEEECH
T ss_conf             653444689998669999999998739987865899-------------999---9999999983966998575


No 223
>PRK06256 biotin synthase; Validated
Probab=52.82  E-value=19  Score=17.19  Aligned_cols=179  Identities=18%  Similarity=0.221  Sum_probs=90.6

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHH
Q ss_conf             99999999999999655339970660155768866632224567124888999886652876885--2288999987650
Q gi|254780669|r   56 SHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIAD  133 (301)
Q Consensus        56 S~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~  133 (301)
                      |.|.+++.|+..++.|.+-   +..=.|.        .+..+..++.-+++++.+|+++++.+..  -..+.+++..+++
T Consensus        91 ~~eeI~~~a~~a~~~G~~~---~~lvtsg--------~~~~~~~~e~v~~~i~~Ik~~~~l~i~~slG~l~~e~~~~Lke  159 (325)
T PRK06256         91 DIEEIVEAAKEAIENGAGR---FCIVASG--------RGPSGREVDQVIEAVKAIKEETDLEICACLGLLTEEQAERLKE  159 (325)
T ss_pred             CHHHHHHHHHHHHHCCCCE---EEEEEEC--------CCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHH
T ss_conf             9999999999999869988---9998604--------5897678999999999986228936887348899999999998


Q ss_pred             H-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCH----HHCC---
Q ss_conf             2-1578822576289999999850597799836777899999999999972587808995146544401----0000---
Q gi|254780669|r  134 S-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN----TLVT---  205 (301)
Q Consensus       134 ~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~----~lvv---  205 (301)
                      . +|-+-     + |.+-    ++..-|- |+  ..-+.++++..++.....|-+   +|- |..||-+    +++-   
T Consensus       160 AGvd~y~-----~-nlET----s~~~f~~-i~--~tht~~~Rl~ti~~a~~aGi~---vcs-G~i~GlGEt~edrve~l~  222 (325)
T PRK06256        160 AGVDRYN-----H-NLET----SRSYFPN-VV--TTHTYEDRVDTCEMVKAAGIE---PCS-GGIIGMGETLEDRAEHAF  222 (325)
T ss_pred             CCCCEEC-----C-CCCC----CHHHCCC-CC--CCCCHHHHHHHHHHHHHCCCC---CCC-CEEECCCCCHHHHHHHHH
T ss_conf             6998886-----6-6440----6876388-68--998899999999999985996---466-437668999899999999


Q ss_pred             -----CCCCCHHH--H---HH---CCCEEECHHHHHH--------HCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             -----00010688--8---51---8716871177742--------12234532126388999999999971898899983
Q gi|254780669|r  206 -----DMRSIPIM--T---SM---GVPVIFDASHSVQ--------QPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       206 -----D~~~i~~l--k---~~---~~PVi~D~SHs~q--------~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                           +..+||+.  .   .+   +.|. .++--.++        .|...=..+|||......+ ++....|++|+|+--
T Consensus       223 ~Lr~l~~~sipin~l~P~~gTpl~~~~~-l~~~e~lr~iAi~Rl~~P~~~Ir~agGr~~~~~~~-~~~~~~gan~~~~G~  300 (325)
T PRK06256        223 FLKELDADSIPINFLNPIKGTPLEDLPE-LTPLECLKTIAIFRLINPDKEIRIAGGREIALRSL-QPLALKGANSIFVGN  300 (325)
T ss_pred             HHHCCCCCEEECCCCEECCCCCCCCCCC-CCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHH-HHHHHHHCHHHEECC
T ss_conf             9971999889546701069986688999-89999999999999978995489707855225567-999986173514666


No 224
>KOG2965 consensus
Probab=52.19  E-value=17  Score=17.58  Aligned_cols=27  Identities=15%  Similarity=0.023  Sum_probs=17.4

Q ss_pred             CCHHHHHHHHHHCCEEEECHHHCCCHH
Q ss_conf             889999876502157882257628999
Q gi|254780669|r  123 HTEQQCEAIADSVDILQIPALLCRQTD  149 (301)
Q Consensus       123 ~~~~~~e~~~~~vDilQIgA~~~rqtd  149 (301)
                      -..+-+..+..-+-+|||-|--=-||.
T Consensus       117 GTvsgva~~~~D~gvlWvDAHaDinTp  143 (318)
T KOG2965         117 GTVSGVARVYPDAGVLWVDAHADINTP  143 (318)
T ss_pred             EEEHHHHHHCCCCCEEEEECCCCCCCC
T ss_conf             420666864788618988534656898


No 225
>PRK07582 cystathionine gamma-lyase; Validated
Probab=52.02  E-value=20  Score=17.10  Aligned_cols=45  Identities=24%  Similarity=0.471  Sum_probs=24.2

Q ss_pred             CCCCEEEEECCCCCCCHHHCCCCCCCHHH-HHHCCCEEECHHHH---HHHC
Q ss_conf             87808995146544401000000010688-85187168711777---4212
Q gi|254780669|r  185 GAKDVLFCERGTSFGYNTLVTDMRSIPIM-TSMGVPVIFDASHS---VQQP  231 (301)
Q Consensus       185 Gn~~i~lcERG~~fgy~~lvvD~~~i~~l-k~~~~PVi~D~SHs---~q~p  231 (301)
                      .|.+++.+|-=++....  ++|+..+..+ |+.+.|+|+|-|-+   .|+|
T Consensus       134 ~~tklv~~EspsNP~l~--v~Di~~ia~~A~~~gi~~vVDNT~atP~~~~P  182 (370)
T PRK07582        134 GAADLVLAETPSNPGLD--VVDLARLARACHAAGALLVVDNTTATPLGQRP  182 (370)
T ss_pred             CCCCEEEEECCCCCCCE--EECCHHHHHHHHHCCCEEEEECCCCCHHHCCC
T ss_conf             57738999779998865--33538889999876996999889840642480


No 226
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]
Probab=51.95  E-value=20  Score=17.10  Aligned_cols=91  Identities=15%  Similarity=0.206  Sum_probs=52.0

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCC
Q ss_conf             69995486349999999999999996553399706601557688666322245671248889998866528768852288
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHT  124 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~  124 (301)
                      ..+|+|-.+.-++| ..+.|+..++.|.+..  .+.-|          +.++.. -+.-..+++.+.+..++|++     
T Consensus        74 vpviaG~g~~~t~e-ai~lak~a~~~Gad~i--l~v~P----------yY~k~~-~~gl~~hf~~ia~a~~lPvi-----  134 (299)
T COG0329          74 VPVIAGVGSNSTAE-AIELAKHAEKLGADGI--LVVPP----------YYNKPS-QEGLYAHFKAIAEAVDLPVI-----  134 (299)
T ss_pred             CCEEEECCCCCHHH-HHHHHHHHHHCCCCEE--EEECC----------CCCCCC-HHHHHHHHHHHHHHCCCCEE-----
T ss_conf             77898628777999-9999999997099999--98489----------788989-79999999999985189989-----


Q ss_pred             HHHHHHHHHHCCEEEECHHHCCC--HHHHHHHHHCCCEEEEECC
Q ss_conf             99998765021578822576289--9999998505977998367
Q gi|254780669|r  125 EQQCEAIADSVDILQIPALLCRQ--TDLLTAAAQTGRVINVKKG  166 (301)
Q Consensus       125 ~~~~e~~~~~vDilQIgA~~~rq--tdLl~a~a~t~kpV~iKkg  166 (301)
                                  ++.||.|.-.+  -+++..+++....|-+|-.
T Consensus       135 ------------lYN~P~~tg~~l~~e~i~~la~~~nivgiKd~  166 (299)
T COG0329         135 ------------LYNIPSRTGVDLSPETIARLAEHPNIVGVKDS  166 (299)
T ss_pred             ------------EEECCCCCCCCCCHHHHHHHHCCCCEEEEEEC
T ss_conf             ------------99787524899999999998278988999847


No 227
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional
Probab=51.46  E-value=20  Score=17.05  Aligned_cols=103  Identities=17%  Similarity=0.181  Sum_probs=47.6

Q ss_pred             CCEEEECHHHCCCHHHHHHHH---HCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECC---------C-CCCCH
Q ss_conf             157882257628999999985---0597799836777899999999999972587808995146---------5-44401
Q gi|254780669|r  135 VDILQIPALLCRQTDLLTAAA---QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERG---------T-SFGYN  201 (301)
Q Consensus       135 vDilQIgA~~~rqtdLl~a~a---~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG---------~-~fgy~  201 (301)
                      +|++-|-.-+-..-.+++.+.   +....+.|=-|--.|++    +++.+...|.+-| -+==|         . -+||.
T Consensus       123 ~~~i~iDvA~G~~~~~~~~i~~ik~~~~~~~iiaGNvaT~e----~~~~L~~~GaD~v-kVGIG~Gs~CtTR~~tGvG~P  197 (347)
T PRK05096        123 LNFICIDVANGYSEHFVQFVAKAREAWPDKTICAGNVVTGE----MVEELILSGADIV-KVGIGPGSVCTTRVKTGVGYP  197 (347)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEECCCHHHHH----HHHHHHHCCCCEE-EECCCCCCCCCCCCCCCCCCH
T ss_conf             89899977986208899999999987899808814312399----9999997378899-976778754304522356730


Q ss_pred             HHCCCCCCCHH----HHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             00000001068----885187168711777421223453212638899999999997189889998
Q gi|254780669|r  202 TLVTDMRSIPI----MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       202 ~lvvD~~~i~~----lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      .+    .++..    .+.++.|||-|---.                .--.++| |+++|+|-+|+-
T Consensus       198 q~----sai~~c~~~~~~~~~~iiaDGGi~----------------~~gDi~K-Ala~GAd~VM~G  242 (347)
T PRK05096        198 QL----SAVIECADAAHGLGGMIVSDGGCT----------------VPGDVAK-AFGGGADFVMLG  242 (347)
T ss_pred             HH----HHHHHHHHHHHCCCCCEEECCCCC----------------CHHHHHH-HHHCCCCEEEEC
T ss_conf             37----899999998605799489568847----------------5047999-987389889867


No 228
>pfam02056 Glyco_hydro_4 Family 4 glycosyl hydrolase.
Probab=51.14  E-value=20  Score=17.16  Aligned_cols=84  Identities=14%  Similarity=0.112  Sum_probs=31.6

Q ss_pred             HHHHHHHHCCEEEEECC-CHHHHHHHHHH-CCEEEECHHHCCCHHHHHH--------HHHCCCEEEEECCCCCCHHHHHH
Q ss_conf             99886652876885228-89999876502-1578822576289999999--------85059779983677789999999
Q gi|254780669|r  107 FRDLKKKYGFPILTDVH-TEQQCEAIADS-VDILQIPALLCRQTDLLTA--------AAQTGRVINVKKGQFLSPWEMHN  176 (301)
Q Consensus       107 l~e~k~~~glpv~TeV~-~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a--------~a~t~kpV~iKkgq~~s~~e~~~  176 (301)
                      .+++.++.|.++--+.. +.+++=.=+++ +--+|+|-.-+|..|--..        .++|.-|=-+=+++ =++-.|+.
T Consensus        48 ~~~~~~~~~~~~~v~~ttd~~eAl~gADfVi~~irvG~~~~r~~De~Iplk~Gv~~~~~eT~G~GG~~~al-Rtip~~l~  126 (183)
T pfam02056        48 CKKLVDEAGPDIKFEKTTDRKEALTDADFVINAIRVGLLPARELDEKIPLRHGVVGTIQETVGPGGIFRGL-RTIPVFFD  126 (183)
T ss_pred             HHHHHHHCCCCEEEEEECCHHHHHCCCCEEEEEEEECCCHHHHHHHHHHHHCCCCCEECCCCCCCHHHHHH-CCHHHHHH
T ss_conf             99999961998399997899999668999999864077148887776799839653233245722888776-01899999


Q ss_pred             HHHHHHHCCCCCEEEE
Q ss_conf             9999972587808995
Q gi|254780669|r  177 ILQKLHAHGAKDVLFC  192 (301)
Q Consensus       177 a~eki~~~Gn~~i~lc  192 (301)
                      .++.+..- +++-|+.
T Consensus       127 ia~~i~e~-~P~Awli  141 (183)
T pfam02056       127 IAKDIEEL-CPDAWVL  141 (183)
T ss_pred             HHHHHHHH-CCCCEEE
T ss_conf             99999997-9983899


No 229
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein; InterPro: IPR005675    This model represents largely uncharacterised proteins related to 2-isopropylmalate synthases and homocitrate synthases but phylogenetically distinct. ; GO: 0046912 transferase activity transferring acyl groups acyl groups converted into alkyl on transfer, 0019752 carboxylic acid metabolic process.
Probab=50.11  E-value=21  Score=16.91  Aligned_cols=164  Identities=18%  Similarity=0.246  Sum_probs=97.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCE
Q ss_conf             99999999999965533997066015576886663222456712488899988665287688522889999876502157
Q gi|254780669|r   58 DHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDI  137 (301)
Q Consensus        58 e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDi  137 (301)
                      +-=+.||+.|-..|.++.=|     .|+.||.-            -...|+++|+. +                   ..-
T Consensus        23 ~DK~~IA~~LD~lGi~yiEG-----GWPgaNPK------------D~~FF~~~~~~-~-------------------~~~   65 (543)
T TIGR00977        23 EDKIRIAEKLDDLGIHYIEG-----GWPGANPK------------DVAFFEKVKEM-N-------------------FKN   65 (543)
T ss_pred             HHHHHHHHHHHHCCCCEECC-----CCCCCCHH------------HHHHHHHHHHC-C-------------------CCC
T ss_conf             56899999886459851427-----88998725------------68999998527-7-------------------110


Q ss_pred             EEECHHHC--------CCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCC
Q ss_conf             88225762--------8999999985059779983677789999999999997258780899514654440100000001
Q gi|254780669|r  138 LQIPALLC--------RQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRS  209 (301)
Q Consensus       138 lQIgA~~~--------rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~  209 (301)
                      +.|-||-+        ..-..++++=+.+.||.-==|   --|| +++.+-+..+=.              -||-+=.-.
T Consensus        66 ~~~~AF~STRRP~~~v~~D~~~~~l~~A~T~~~TIFG---KSWD-LHV~~aL~T~L~--------------ENL~MI~dT  127 (543)
T TIGR00977        66 AKIVAFSSTRRPDKKVEEDKQVQALIKAETPVVTIFG---KSWD-LHVLEALKTTLE--------------ENLKMIYDT  127 (543)
T ss_pred             EEEEEEECCCCCCCCCCCCHHHHHHHHCCCEEEEEEC---CCHH-HHHHHHHHHHHH--------------HHHHHHHHH
T ss_conf             0466752367886332334567898726981699854---7357-888887764299--------------999999999


Q ss_pred             CHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             06888518716871177742122345321263889999999999718988999836983347978201868899999999
Q gi|254780669|r  210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLS  289 (301)
Q Consensus       210 i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~  289 (301)
                      |.+||++.--||||+-|=--  |     =--+|||.-....+|.-+|+|-|.+          ||-.-=--|.+..++.+
T Consensus       128 v~YLk~~~~~VIyDAEHfFD--G-----YkaN~eYAL~~L~~A~~aGAdwlVl----------cDTNGGTLP~~I~EI~~  190 (543)
T TIGR00977       128 VAYLKRYADEVIYDAEHFFD--G-----YKANPEYALKTLKVAEKAGADWLVL----------CDTNGGTLPHEIEEITK  190 (543)
T ss_pred             HHHHHHHCCEEEEECCCCCC--C-----CCCCHHHHHHHHHHHHHCCCCEEEE----------EECCCCCCCHHHHHHHH
T ss_conf             99998721225630200246--3-----4578689999999998469828999----------50787998504789999


Q ss_pred             HHHH
Q ss_conf             9999
Q gi|254780669|r  290 QLLA  293 (301)
Q Consensus       290 ~l~~  293 (301)
                      ++++
T Consensus       191 ~Vk~  194 (543)
T TIGR00977       191 KVKK  194 (543)
T ss_pred             HHHH
T ss_conf             9998


No 230
>PRK06806 fructose-bisphosphate aldolase; Provisional
Probab=49.98  E-value=22  Score=16.90  Aligned_cols=173  Identities=17%  Similarity=0.180  Sum_probs=85.7

Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCC-----EE
Q ss_conf             9999996553399706601557688666322245671248889998866528768852288999987650215-----78
Q gi|254780669|r   64 AEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD-----IL  138 (301)
Q Consensus        64 A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vD-----il  138 (301)
                      ++.+.+.......+.|.--        |+...+-.|++.-..++..+.++..+||.--.-+....|.+.+.+|     |.
T Consensus        31 ~~avi~AAee~~sPvIiq~--------s~~~~~~~~~~~~~~~~~~~a~~~~VPV~lHLDHg~~~e~i~~ai~~GfsSVM  102 (281)
T PRK06806         31 VMGAIKAAEELSSPLILQI--------AEVRLNHSPLHMIGPLMVAAAKKATVPVAVHFDHGMTFEKIKEALEIGFTSVM  102 (281)
T ss_pred             HHHHHHHHHHHCCCEEEEC--------CHHHHCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEE
T ss_conf             9999999999699989995--------64333246099999999999974799889973898999999999982998799


Q ss_pred             EECH-----HHCCCH-HHHHHHHHCCCEEEE--------------ECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             8225-----762899-999998505977998--------------36777899999999999972587808995146544
Q gi|254780669|r  139 QIPA-----LLCRQT-DLLTAAAQTGRVINV--------------KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSF  198 (301)
Q Consensus       139 QIgA-----~~~rqt-dLl~a~a~t~kpV~i--------------Kkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~f  198 (301)
                      .=|+     -|.+.| +.++-+.+.|.+|=-              ....+.+|+|   |.+.+..+|.+ .+..-=|+..
T Consensus       103 ~DgS~l~~eeNi~~Tkevve~Ah~~gv~VEaElG~igg~ed~~~~~~~~~T~pee---a~~Fv~~TgvD-~LAvaiGt~H  178 (281)
T PRK06806        103 FDGSHYPLEENIQKTKEIVELAKQYGATVEAEIGRVGGSEDGSEDIEMLLTSTEE---AKRFAEETDVD-ALAVAIGNAH  178 (281)
T ss_pred             EECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCHHH---HHHHHHHHCCC-EEEEECCCCC
T ss_conf             6099899999999999999999885986999733337746776666756689899---99999985998-9987437554


Q ss_pred             C-CHH-HCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             4-010-0000001068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  199 G-YNT-LVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       199 g-y~~-lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      | |.. -..||--+..+++ ...|.++   |     |+    ||=..    ..-+.|+..|+.=+=+-|
T Consensus       179 G~yk~~p~L~~d~L~~I~~~~~iPLVL---H-----Gg----SG~~~----e~i~~ai~~Gi~KiNi~T  231 (281)
T PRK06806        179 GMYNGDPNLRLDRLQEINDNVHIPLVL---H-----GG----SGISP----EDFKQCIQHGIRKINVAT  231 (281)
T ss_pred             CCCCCCCCCCHHHHHHHHHHCCCCEEE---E-----CC----CCCCH----HHHHHHHHCCCEEEEECH
T ss_conf             565899866999999999728999896---4-----99----99999----999999986983898675


No 231
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily. Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily. They are mostly present in archaea and eubacteria, and are primarily involved in scavenging solutes from the environment. ABC-type transporters couple ATP hydrolysis with the uptake and efflux of a wide range of substrates across bacterial membranes, including amino acids, peptides, lipids and sterols, and various drugs. These systems are comprised of transmembrane domains, nucleotide binding domains, and in most bacterial uptake systems, periplasmic binding proteins (PBPs) which transfer the ligand to the extracellular gate of the transmembrane domains. These PBPs bind their substrates selectively and with high affinity.  Members of this group include ABC
Probab=49.72  E-value=22  Score=16.87  Aligned_cols=138  Identities=14%  Similarity=0.064  Sum_probs=52.4

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHCCCC---EEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECC
Q ss_conf             9954863499999999999999965533997---0660155768866632224567124888999886652876885228
Q gi|254780669|r   47 LIAGPCQIESHDHAFMIAEKLYAICQSLNIG---LVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVH  123 (301)
Q Consensus        47 iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~---~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~  123 (301)
                      -..||.+....+...-+--.++++.++-.++   .-+.. +|-  ++       .. +.+....+++.++ ++.++.--.
T Consensus         7 ~~sG~~a~~g~~~~~g~~~a~~~iN~~GGi~G~~i~l~~-~D~--~~-------~~-~~~~~~~~~l~~~-~v~~iiG~~   74 (298)
T cd06268           7 PLSGPLAALGEPVRNGAELAVEEINAAGGILGRKIELVV-EDT--QG-------DP-EAAAAAARELVDD-GVDAVIGPL   74 (298)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEE-ECC--CC-------CH-HHHHHHHHHHHCC-CCEEEECCC
T ss_conf             787840765799999999999999861898986889999-679--99-------98-9999999986327-973997477


Q ss_pred             CHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCC-CCCEEEEECCCCCC
Q ss_conf             89999876502157882257628999999985059779983677789999999999997258-78089951465444
Q gi|254780669|r  124 TEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHG-AKDVLFCERGTSFG  199 (301)
Q Consensus       124 ~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~G-n~~i~lcERG~~fg  199 (301)
                      .......++++++-..||......++-..  .....| ++=+-......+....++++.+.+ .++|.++-....||
T Consensus        75 ~s~~~~~~~~~~~~~~ip~i~~~~~~~~~--~~~~~~-~~f~~~~~~~~~~~~~~~~~~~~~~~~~vaiv~~d~~~g  148 (298)
T cd06268          75 SSGVALAAAPVAEEAGVPLISPGATSPAL--TGKGNP-YVFRTAPSDAQQAAALADYLAEKGKVKKVAIIYDDYAYG  148 (298)
T ss_pred             CHHHHHHHHHHHHHCCCEEEECCCCCHHH--HCCCCC-CEEEECCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHH
T ss_conf             57888999999987192188057542554--067899-789924986999999999999834985899977873467


No 232
>PRK11197 lldD L-lactate dehydrogenase; Provisional
Probab=49.71  E-value=22  Score=16.87  Aligned_cols=68  Identities=19%  Similarity=0.233  Sum_probs=37.9

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCC---EEEECHHHCCC--HHHHHHHHHCC
Q ss_conf             6322245671248889998866528768852288999987650215---78822576289--99999985059
Q gi|254780669|r   91 SLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD---ILQIPALLCRQ--TDLLTAAAQTG  158 (301)
Q Consensus        91 S~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vD---ilQIgA~~~rq--tdLl~a~a~t~  158 (301)
                      +|-+++++-..+|-..+.++..+.|+|.+---+...-+|.+++..+   ++|+=-..-|.  .+|++.+.+.|
T Consensus        76 aP~g~~~l~hp~gE~a~ArAA~~~gi~~~lSt~ss~slEeva~a~~~~~WfQLY~~~Dr~~~~~ll~RA~~aG  148 (381)
T PRK11197         76 APVGLTGMYARRGEVQAARAADAKGIPFTLSTVSVCPIEEVAPAIKRPMWFQLYVLRDRGFMRNALERAKAAG  148 (381)
T ss_pred             CHHHHHCCCCCCHHHHHHHHHHHHCCCEEECCCCCCCHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             7577741678975799999999707717832776567999986358973899841388899999999999849


No 233
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase. This family includes a number of 2-aminoethylphosphonate aminotransferases, some of which are indicated to operate in the catabolism of 2-aminoethylphosphonate (AEP) and others which are involved in the biosynthesis of the same compound. The catabolic enzyme (PhnW, ) is known to use pyruvate:alanine as the transfer partner and is modeled by the equivalog-level HMM (TIGR02326). The PhnW family is apparently a branch of a larger tree including genes (AepZ) adjacent to others responsible for the biosynthesis of phosphonoacetaldehyde. The identity of the transfer partner is unknown for these enzymes and considering the reversed flux compared to PhnW, it may very well be different.
Probab=49.02  E-value=22  Score=16.80  Aligned_cols=89  Identities=18%  Similarity=0.092  Sum_probs=52.7

Q ss_pred             HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHH-CCCCCEEEEECCCCCCCHHHCCCCCCCHH
Q ss_conf             21578822576289999999850597799836777899999999999972-58780899514654440100000001068
Q gi|254780669|r  134 SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHA-HGAKDVLFCERGTSFGYNTLVTDMRSIPI  212 (301)
Q Consensus       134 ~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~-~Gn~~i~lcERG~~fgy~~lvvD~~~i~~  212 (301)
                      -+.++.-|+|--|-.++.+..+..-..+...-|...++++...+   +.+ ...+-|.+|+--||.|.-+   |+..+..
T Consensus        76 ~vlv~~~G~fg~r~~~~a~~~g~~~~~~~~~~g~~~~~~~v~~~---l~~~~~~~~v~~~h~ETstGv~~---~~~~i~~  149 (355)
T TIGR03301        76 KLLVLINGAYGERLAKICEYLGIPHTDLNFSEYEPPDLNRIEEA---LAADPDITHVATVHHETTTGILN---PLEAIAK  149 (355)
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHH---HHCCCCCCEEEEEEECCCCCCCC---CHHHHHH
T ss_conf             79999548899999999998299669973688778998999999---72577854899950126787417---5376656


Q ss_pred             H-HHHCCCEEECHHHHH
Q ss_conf             8-851871687117774
Q gi|254780669|r  213 M-TSMGVPVIFDASHSV  228 (301)
Q Consensus       213 l-k~~~~PVi~D~SHs~  228 (301)
                      + |+.+.++++|++.|.
T Consensus       150 ~~~~~~~llvVDavSs~  166 (355)
T TIGR03301       150 VARSHGAVLIVDAMSSF  166 (355)
T ss_pred             HHCCCCCEEEEECCCCC
T ss_conf             65047964999745643


No 234
>PRK08247 cystathionine gamma-synthase; Reviewed
Probab=48.84  E-value=22  Score=16.78  Aligned_cols=37  Identities=16%  Similarity=0.281  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHCCEEEE-ECCCHHHHHHH-HHHCCEEEE
Q ss_conf             88999886652876885-22889999876-502157882
Q gi|254780669|r  104 REIFRDLKKKYGFPILT-DVHTEQQCEAI-ADSVDILQI  140 (301)
Q Consensus       104 L~il~e~k~~~glpv~T-eV~~~~~~e~~-~~~vDilQI  140 (301)
                      ..++.+.-.++|+.+.- |..+++.++.. .+..+++++
T Consensus       104 ~~~~~~~l~~~Gi~~~~~d~~d~~~~~~~i~~~Tkli~~  142 (366)
T PRK08247        104 YRLFEEHWKKWGVRFVYVNTASIKAIEQAITPNTKAIFI  142 (366)
T ss_pred             HHHHHHHHCCCCEEEEEECCCCHHHHHHHCCCCCEEEEE
T ss_conf             899887750774699984888979999753867549998


No 235
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane]
Probab=48.79  E-value=22  Score=16.78  Aligned_cols=24  Identities=38%  Similarity=0.549  Sum_probs=14.0

Q ss_pred             CCCCCCHHH-HHHCCCEEECHHHHH
Q ss_conf             000010688-851871687117774
Q gi|254780669|r  205 TDMRSIPIM-TSMGVPVIFDASHSV  228 (301)
Q Consensus       205 vD~~~i~~l-k~~~~PVi~D~SHs~  228 (301)
                      .||..+-.+ +++++|||-|+.||.
T Consensus       136 ~dm~~i~~la~~~~l~vIEDaAqa~  160 (374)
T COG0399         136 CDMDAIMALAKRHGLPVIEDAAQAH  160 (374)
T ss_pred             CCHHHHHHHHHHCCCEEEEECCHHC
T ss_conf             7989999999873984998760320


No 236
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2.  This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).
Probab=48.48  E-value=23  Score=16.75  Aligned_cols=81  Identities=23%  Similarity=0.359  Sum_probs=38.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCC-CCCCHHHCCCCCCCHHHHH-H--CCCEEECHHHHHHHCC
Q ss_conf             5977998367778999999999999725878089951465-4440100000001068885-1--8716871177742122
Q gi|254780669|r  157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGT-SFGYNTLVTDMRSIPIMTS-M--GVPVIFDASHSVQQPG  232 (301)
Q Consensus       157 t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~-~fgy~~lvvD~~~i~~lk~-~--~~PVi~D~SHs~q~p~  232 (301)
                      ++.|+.||-=  ++++|-..|    ...|.+-|++---|- .+.+.  ..-+..+|...+ .  .+||++|--=      
T Consensus       220 ~~lplilKGI--~~~eDA~~A----~~~G~dgIvVSNHGGRQLD~~--p~~i~~LpeI~~av~~~~~V~~DgGI------  285 (351)
T cd04737         220 SGLPVIVKGI--QSPEDADVA----INAGADGIWVSNHGGRQLDGG--PASFDSLPEIAEAVNHRVPIIFDSGV------  285 (351)
T ss_pred             CCCCEEECCC--CCHHHHHHH----HHCCCCEEEECCCCCCCCCCC--HHHHHHHHHHHHHHCCCCEEEECCCC------
T ss_conf             4998532366--779999999----874998899778751235676--04788999999986689649976986------


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             345321263889999999999718988999
Q gi|254780669|r  233 IHGNCSGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       233 ~~~~~~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                           -.| .+.+     .|+|+|+|++|+
T Consensus       286 -----R~G-~DV~-----KALALGA~aV~i  304 (351)
T cd04737         286 -----RRG-EHVF-----KALASGADAVAV  304 (351)
T ss_pred             -----CCH-HHHH-----HHHHCCCCEEEE
T ss_conf             -----746-8999-----999769988975


No 237
>pfam02548 Pantoate_transf Ketopantoate hydroxymethyltransferase. Ketopantoate hydroxymethyltransferase (EC:2.1.2.11) is the first enzyme in the pantothenate biosynthesis pathway.
Probab=48.41  E-value=23  Score=16.74  Aligned_cols=157  Identities=19%  Similarity=0.197  Sum_probs=92.9

Q ss_pred             HHHHHHHHHHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHC------CCH------HH---HHHHHHC-CCEEEEE--
Q ss_conf             8899988665287688522889999876502-15788225762------899------99---9998505-9779983--
Q gi|254780669|r  104 REIFRDLKKKYGFPILTDVHTEQQCEAIADS-VDILQIPALLC------RQT------DL---LTAAAQT-GRVINVK--  164 (301)
Q Consensus       104 L~il~e~k~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~------rqt------dL---l~a~a~t-~kpV~iK--  164 (301)
                      +.-|.+.|.+-.=-+.....+...+..+.+. +|+|=+|-=+-      .+|      ++   .+++.|- .....+=  
T Consensus         5 v~~l~~~K~~g~ki~~lTayd~~~A~~~d~agiD~iLVGDSlgmv~~G~~~T~~vt~d~mi~H~~aV~rga~~~~iv~Dm   84 (261)
T pfam02548         5 IPDLRKMKGEGEKIVMLTAYDYPTARLADEAGVDVILVGDSLGMVVLGHESTLPVTLEEMIYHTKAVARGAPRAFVVADM   84 (261)
T ss_pred             HHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEEEECCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             99999997489957999828999999999859988997685143125775667279999999999998528886499478


Q ss_pred             -CCCC-CCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHHHCCCEEEC----HHHHHHHCC-CCCCC
Q ss_conf             -6777-8999999999999725878089951465444010000000106888518716871----177742122-34532
Q gi|254780669|r  165 -KGQF-LSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD----ASHSVQQPG-IHGNC  237 (301)
Q Consensus       165 -kgq~-~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~~~~PVi~D----~SHs~q~p~-~~~~~  237 (301)
                       -+.+ .|+++-+..+-++...+.-+.+-||-|..    .    ...+..|.+.+.||+--    |-+..|.-| -..+.
T Consensus        85 Pf~sy~~s~~~a~~nA~rlmke~GadaVKlEgg~~----~----~~~I~~l~~~GIPV~gHiGL~PQ~~~~~GG~r~qGk  156 (261)
T pfam02548        85 PFGSYEASPEQALRNAARLMKEAGADAVKLEGGAE----M----ADTIKALVDRGIPVMGHIGLTPQSVNQLGGYKVQGR  156 (261)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCC----H----HHHHHHHHHCCCCEEEEECCCCHHCCCCCCCCCCCC
T ss_conf             75324679999999999999854999899788853----5----899999998899765342367401123688510259


Q ss_pred             CCCCHHHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             1263889999999999718988999836983
Q gi|254780669|r  238 SGGERQYIVPLAKAAVAIGIAGIFLETHQDP  268 (301)
Q Consensus       238 ~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P  268 (301)
                      +.....-+..-|++--.+|+.++-+|+=|..
T Consensus       157 ~~~ea~~l~~dA~~le~AGa~~ivlE~vp~~  187 (261)
T pfam02548       157 TEEEAEQLLEDAKALEEAGAFALVLECVPAE  187 (261)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCEEEEECCHHH
T ss_conf             9999999999999998468748999667099


No 238
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=48.40  E-value=23  Score=16.74  Aligned_cols=167  Identities=17%  Similarity=0.197  Sum_probs=103.3

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--ECCCHHHHHHHHHH-CC
Q ss_conf             9999999999655339970660155768866632224567124888999886652876885--22889999876502-15
Q gi|254780669|r   60 AFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DVHTEQQCEAIADS-VD  136 (301)
Q Consensus        60 ~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV~~~~~~e~~~~~-vD  136 (301)
                      -.++|+...+.|.+...    =-=.|        +-+|-+  .-.++++++.++..+|+.-  =|...++++.+.+. +|
T Consensus        31 P~~~a~~~~~~Ga~~lh----vvDLd--------aa~g~~--~N~~~I~~i~~~~~~piqvGGGIrs~e~~~~~l~~Ga~   96 (231)
T PRK13586         31 PLKIAEELYNEGYDSIH----VVDLD--------AAEGKG--DNEEYIKRICKIGFSWIQVGGGIRDVEKAERLLSYDCS   96 (231)
T ss_pred             HHHHHHHHHHCCCCEEE----EEECC--------CCCCCC--CHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCC
T ss_conf             99999999987999899----99671--------568998--43999999997459857985671769999999977998


Q ss_pred             EEEECHHHCCCHHHHHHHHHC-C--CE---EEEEC-CC-------CCCHHHHHHHHHHHHHCCCCCEEEEEC---CCCCC
Q ss_conf             788225762899999998505-9--77---99836-77-------789999999999997258780899514---65444
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQT-G--RV---INVKK-GQ-------FLSPWEMHNILQKLHAHGAKDVLFCER---GTSFG  199 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t-~--kp---V~iKk-gq-------~~s~~e~~~a~eki~~~Gn~~i~lcER---G~~fg  199 (301)
                      -+=|++..-.|.+++.++.+. +  +.   +-+++ ++       -.+ .++...++++.+.|...++++.=   |+.-|
T Consensus        97 kViigS~a~~np~~~~~~~~~~G~~~iv~siD~~~~~~v~~~Gw~~~~-~~~~~~i~~~~~~g~~~ii~TdI~~DGt~~G  175 (231)
T PRK13586         97 AIVMSTLPFTNPDTFRRIVAGIGENRVLVSVDYDDRKYVLIKGWKEKS-MKVEDAISHVNSLESLGVIFTYVCNEGTKNG  175 (231)
T ss_pred             EEEECHHHHHCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEECCCCCC-CCHHHHHHHHHHCCCCEEEEEEECCHHCCCC
T ss_conf             899768887695999999998499668999997589689984872688-6699999999975998899976451120368


Q ss_pred             CHHHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             0100000001068885187168711777421223453212638899999999997189889998
Q gi|254780669|r  200 YNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       200 y~~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      |+-   ++  ...++....|+++               +||-+.+ ..+.+ ....|++|..+=
T Consensus       176 ~d~---~l--~~~i~~~~~~~i~---------------aGGi~s~-~Di~~-L~~~G~~gaivG  217 (231)
T PRK13586        176 IDN---NV--KRYVKLVKGEKEY---------------AGGIGSI-QDLQK-LKKMGFDYAIVG  217 (231)
T ss_pred             CCH---HH--HHHHHHCCCCCEE---------------ECCCCCH-HHHHH-HHHCCCCEEEEE
T ss_conf             998---99--9999871899599---------------8688999-99999-986799889999


No 239
>pfam01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme. This family includes enzymes involved in cysteine and methionine metabolism. The following are members: Cystathionine gamma-lyase, Cystathionine gamma-synthase, Cystathionine beta-lyase, Methionine gamma-lyase, OAH/OAS sulfhydrylase, O-succinylhomoserine sulfhydrylase All of these members participate is slightly different reactions. All these enzymes use PLP (pyridoxal-5'-phosphate) as a cofactor.
Probab=48.20  E-value=16  Score=17.74  Aligned_cols=14  Identities=29%  Similarity=0.612  Sum_probs=7.3

Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             68899999999999
Q gi|254780669|r  279 INIKDLPKLLSQLL  292 (301)
Q Consensus       279 l~l~~l~~ll~~l~  292 (301)
                      +-+++.++|+.+|.
T Consensus       364 vGlEd~~DLi~DL~  377 (381)
T pfam01053       364 VGIEDVDDLIADLK  377 (381)
T ss_pred             EEECCHHHHHHHHH
T ss_conf             50099999999999


No 240
>PRK13117 consensus
Probab=47.38  E-value=24  Score=16.64  Aligned_cols=217  Identities=16%  Similarity=0.199  Sum_probs=110.5

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCC-----CCCCCC-CCCCCCHHHHHHHHHHHHHH-CCE
Q ss_conf             999548634999999999999999655339-9706601557688-----666322-24567124888999886652-876
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKAN-----RSSLAG-KRGVGLKKGREIFRDLKKKY-GFP  117 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKan-----RtS~~s-frG~Gle~gL~il~e~k~~~-glp  117 (301)
                      ++.||   --+.|...++++.+.+.|+++. +|.=|-  -+-|-     ++|..+ -.|..+++.+++++++|+++ .+|
T Consensus        22 yitaG---~P~~~~t~~~~~~l~~~GaDiiElGiPfS--DP~ADGpvIq~A~~rAL~~G~~~~~~~~~~~~ir~~~~~~p   96 (268)
T PRK13117         22 FVTLG---DPSPELSLKIIDTLIEAGADALELGIPFS--DPLADGPTIQNANLRALAAGVTPAQCFELLAKIRAKYPTIP   96 (268)
T ss_pred             EECCC---CCCHHHHHHHHHHHHHCCCCEEEECCCCC--CCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             87270---89979999999999966999899789988--85655799999999998459969999999988500478987


Q ss_pred             EE--EECC------CHHHHHHHHH-HCCEEEECHHHCCCH-HHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             88--5228------8999987650-215788225762899-99999850597-799836777899999999999972587
Q gi|254780669|r  118 IL--TDVH------TEQQCEAIAD-SVDILQIPALLCRQT-DLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       118 v~--TeV~------~~~~~e~~~~-~vDilQIgA~~~rqt-dLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn  186 (301)
                      ++  |=.-      ...-++.+++ .+|-+=||----... ++..++.+.+. +|.+=-+  .|+++.+.   ++.+...
T Consensus        97 ivlM~Y~N~i~~~G~e~F~~~~~~aGvdGvIipDLP~eE~~~~~~~~~~~gl~~I~lv~P--tt~~~Ri~---~i~~~a~  171 (268)
T PRK13117         97 IGLLLYANLVFANGIDNFYARCAEAGVDSVLIADVPVEESAPFRQAAKKHGIAPIFICPP--NADDDTLR---QIASLGR  171 (268)
T ss_pred             EEEEECCCHHHHCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEECC--CCCHHHHH---HHHHHCC
T ss_conf             799732628987179999999997698779857999788589999998679837998479--99999999---9997479


Q ss_pred             CCEE-EEECCCCCCCHHHC-CCCC-CCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             8089-95146544401000-0000-10688851-8716871177742122345321263889999999999718988999
Q gi|254780669|r  187 KDVL-FCERGTSFGYNTLV-TDMR-SIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       187 ~~i~-lcERG~~fgy~~lv-vD~~-~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                      -=|. +.-.|+| |.++.+ .++. .+..+|+. ..||++---=|             .++    -++.++..++||+.+
T Consensus       172 GFiY~vs~~GvT-G~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGIs-------------~~e----~v~~~~~~~aDGvIV  233 (268)
T PRK13117        172 GYTYLLSRAGVT-GAENKAAAPLNHLVEKLKEYNAPPPLQGFGIS-------------EPE----QVKAAIKAGAAGAIS  233 (268)
T ss_pred             CEEEEEECCCCC-CCCCCCCHHHHHHHHHHHHCCCCCEEEEECCC-------------CHH----HHHHHHHCCCCEEEE
T ss_conf             859998367778-89866627799999999964799869983789-------------999----999998638998998


Q ss_pred             EECCCHH--HCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             8369833--47978201868899999999999
Q gi|254780669|r  263 ETHQDPD--NAPSDGPNMINIKDLPKLLSQLL  292 (301)
Q Consensus       263 E~Hp~P~--~AlsD~~q~l~l~~l~~ll~~l~  292 (301)
                      =++----  +...+...  -++.+.+++++|+
T Consensus       234 GSaiV~~i~~~~~~~~~--~~~~v~~~v~~Lk  263 (268)
T PRK13117        234 GSAIVKIIEKNLDNPEK--MLAELAEFVRAMK  263 (268)
T ss_pred             CHHHHHHHHHCCCCHHH--HHHHHHHHHHHHH
T ss_conf             78999999871668899--9999999999999


No 241
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes. It catalyses the reaction of quinolinic acid (QA) with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg2+ to produce nicotinic acid mononucleotide (NAMN), pyrophosphate and carbon dioxide. QPRTase functions as a homodimer with two active sites, each formed by the C-terminal region of one subunit and the N-terminal region of the other.
Probab=47.33  E-value=24  Score=16.63  Aligned_cols=88  Identities=22%  Similarity=0.287  Sum_probs=56.6

Q ss_pred             HHHHHHHHHH--CCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             8999886652--87688522889999876502-15788225762899999998505977998367778999999999999
Q gi|254780669|r  105 EIFRDLKKKY--GFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKL  181 (301)
Q Consensus       105 ~il~e~k~~~--glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki  181 (301)
                      +.++++|+..  ..+|..||-+.+|+..+.+. +|++|.--                          ++|+++..+++.+
T Consensus       169 ~av~~~r~~~~~~~kIeVEv~tl~ea~~a~~~g~D~I~LDn--------------------------~~~~~~~~~v~~~  222 (269)
T cd01568         169 EAVKRARAAAPFEKKIEVEVETLEEAEEALEAGADIIMLDN--------------------------MSPEELKEAVKLL  222 (269)
T ss_pred             HHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCEEEECC--------------------------CCHHHHHHHHHHH
T ss_conf             99999998689984399994989999999976999999879--------------------------8999999999984


Q ss_pred             HHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHHHCCC--EEECHHHHH
Q ss_conf             72587808995146544401000000010688851871--687117774
Q gi|254780669|r  182 HAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP--VIFDASHSV  228 (301)
Q Consensus       182 ~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~~~~P--Vi~D~SHs~  228 (301)
                      ...  +++.+-=-|-        +++.++....+++.-  ++-.+|||.
T Consensus       223 ~~~--~~v~ieaSGg--------I~~~ni~~ya~~GvD~Is~g~lt~s~  261 (269)
T cd01568         223 KGL--PRVLLEASGG--------ITLENIRAYAETGVDVISTGALTHSA  261 (269)
T ss_pred             CCC--CCEEEEEECC--------CCHHHHHHHHHCCCCEEEECHHHCCC
T ss_conf             779--9859999899--------99999999997599999908400599


No 242
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the substrate in four kinds of reactions (1) transamination (movement of amino groups), (2) racemization (redistribution of enantiomers), (3) decarboxylation (removing COOH groups), and (4) various side-chain reactions depending on the enzyme involved. Pyridoxal phosphate (PLP) dependent enzymes were previously classified into alpha, beta and gamma classes, based on the chemical characteristics (carbon atom involved) of the reaction they catalyzed. The availability of several structures allowed a comprehensive analysis of  the evolutionary classification of PLP dependent enzymes, and it was found that the functional classification did not always agree with the evolutionary history of these enzymes. Structure and sequence analysis
Probab=47.19  E-value=24  Score=16.62  Aligned_cols=49  Identities=18%  Similarity=0.344  Sum_probs=31.6

Q ss_pred             HHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH-HHHCCCEEECHHHHH
Q ss_conf             999972587808995146544401000000010688-851871687117774
Q gi|254780669|r  178 LQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM-TSMGVPVIFDASHSV  228 (301)
Q Consensus       178 ~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l-k~~~~PVi~D~SHs~  228 (301)
                      .++.....+..++..+-.++.+  -.+.|++.+..+ ++++.++++|..||.
T Consensus        84 ~~~~~~~~~~~~i~~~~~~~~~--g~~~~l~~I~~la~~~gi~livD~a~~~  133 (170)
T cd01494          84 LEELKAKPNVALIVITPNTTSG--GVLVPLKEIRKIAKEYGILLLVDAASAG  133 (170)
T ss_pred             HHHHHCCCCCEEEEEEEECCCC--CCCCCHHHHHHHHHHCCCEEEEECCCHH
T ss_conf             9998559996368877401478--7320199997356207969999468432


No 243
>PRK08574 cystathionine gamma-synthase; Provisional
Probab=47.06  E-value=24  Score=16.61  Aligned_cols=39  Identities=18%  Similarity=0.301  Sum_probs=13.9

Q ss_pred             CCCCEEEEECCCCCCCHHHCCCCCCCHHH-HHHCCCEEECHH
Q ss_conf             87808995146544401000000010688-851871687117
Q gi|254780669|r  185 GAKDVLFCERGTSFGYNTLVTDMRSIPIM-TSMGVPVIFDAS  225 (301)
Q Consensus       185 Gn~~i~lcERG~~fgy~~lvvD~~~i~~l-k~~~~PVi~D~S  225 (301)
                      .|.+++.||-=++..+.  +.|++.+..+ |+.+.++++|-|
T Consensus       136 ~~Tklv~~EspsNP~l~--v~Di~~ia~iA~~~g~~~vvDNT  175 (384)
T PRK08574        136 SRTKLVFIETITNPTLR--VIDVPEVAKAAKDLGAILVVDNT  175 (384)
T ss_pred             CCCEEEEEECCCCCCCC--CCCHHHHHHHHHHCCCEEEEECC
T ss_conf             88549999889998763--47859999999775985997377


No 244
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=46.75  E-value=24  Score=16.57  Aligned_cols=18  Identities=6%  Similarity=0.100  Sum_probs=8.1

Q ss_pred             HCCEEEEECCCHHHHHHH
Q ss_conf             287688522889999876
Q gi|254780669|r  114 YGFPILTDVHTEQQCEAI  131 (301)
Q Consensus       114 ~glpv~TeV~~~~~~e~~  131 (301)
                      .++-.+-|..+.+..+.+
T Consensus        68 ~~iIfVvDssd~~~~~ea   85 (169)
T cd04158          68 QAVVFVVDSSHRDRVSEA   85 (169)
T ss_pred             CEEEEEEECCHHHHHHHH
T ss_conf             279999986306779999


No 245
>PRK12857 putative aldolase; Reviewed
Probab=46.70  E-value=24  Score=16.57  Aligned_cols=174  Identities=17%  Similarity=0.290  Sum_probs=84.5

Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCC-----E
Q ss_conf             99999996553399706601557688666322245671248889998866528768852288999987650215-----7
Q gi|254780669|r   63 IAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD-----I  137 (301)
Q Consensus        63 ~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vD-----i  137 (301)
                      +++.+.+...+...+.|---        |+...+-.|++.-..+.+.+.++..+||.--.-+....+.+.+.+|     |
T Consensus        30 ~~~avi~AAee~~sPvIlq~--------s~~~~~~~g~~~~~~~~~~~a~~~~VpV~lHLDH~~~~e~i~~ai~~Gf~SV  101 (284)
T PRK12857         30 IVQAIVAAAEAERSPVIIQA--------SQGAIKYAGIEYISAMVRTAAEKASVPVALHLDHGTDFEQVMKCIRNGFTSV  101 (284)
T ss_pred             HHHHHHHHHHHHCCCEEEEC--------CCCHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEE
T ss_conf             99999999999789989991--------7147765799999999999999769989996798899999999998099879


Q ss_pred             EEECHH-----HCCCHHHHHH-HHHCCCEEEEE----------------CCCCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             882257-----6289999999-85059779983----------------6777899999999999972587808995146
Q gi|254780669|r  138 LQIPAL-----LCRQTDLLTA-AAQTGRVINVK----------------KGQFLSPWEMHNILQKLHAHGAKDVLFCERG  195 (301)
Q Consensus       138 lQIgA~-----~~rqtdLl~a-~a~t~kpV~iK----------------kgq~~s~~e~~~a~eki~~~Gn~~i~lcERG  195 (301)
                      .-=|+.     |-++|-=+.+ +-..|..|=--                ...+-+|++   |.+.+..+|.+ .+..-=|
T Consensus       102 M~DgS~l~~eeNi~~Tk~vv~~ah~~gv~VEaElG~igg~ed~~~~~~~~~~~T~pee---a~~Fv~~TgvD-~LAvaiG  177 (284)
T PRK12857        102 MIDGSKLPLEENIALTKKVVEIAHAVGVSVEAELGKIGGTEDDITVDEREAFFTDPEE---ARRFVEETGVD-ALAIAIG  177 (284)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCCCCCHHH---HHHHHHHHCCC-EEEHHHC
T ss_conf             9728989999999999999999987089158853013676777776630002589999---99999987978-7701205


Q ss_pred             CCCC-CHHH-CCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             5444-0100-000001068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  196 TSFG-YNTL-VTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       196 ~~fg-y~~l-vvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      +..| |..- -.||.-+...++ .+.|.++   |     |+    | |-   -...-+.|+..|+.=+=+-|
T Consensus       178 n~HG~yk~~p~L~~~~L~~I~~~~~vPLVL---H-----Gg----S-Gi---~~e~i~~ai~~Gi~KiNi~T  233 (284)
T PRK12857        178 TAHGPYKGVPKLDFDRLAKIRELVNIPLVL---H-----GS----S-GV---PDEAIRKAISLGVRKVNIDT  233 (284)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHCCCCEEE---E-----CC----C-CC---CHHHHHHHHHHCCEEEEECH
T ss_conf             666776898856999999998616999897---6-----89----9-99---99999999980975997487


No 246
>COG0439 AccC Biotin carboxylase [Lipid metabolism]
Probab=46.37  E-value=24  Score=16.54  Aligned_cols=130  Identities=18%  Similarity=0.146  Sum_probs=77.4

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEE-E---ECCCCCCCCCCCCCCCCCCCHHHHHHH------HHHHHHH
Q ss_conf             69995486349999999999999996553399706-6---015576886663222456712488899------9886652
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLV-Y---KSSFDKANRSSLAGKRGVGLKKGREIF------RDLKKKY  114 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~i-f---K~sfdKanRtS~~sfrG~Gle~gL~il------~e~k~~~  114 (301)
                      .+-|.+|-+++|+..+..+-......++....+|. |   -+.|..++...--.|.|+.-+ ....+      +++-++-
T Consensus        48 av~i~~~~~~~syl~i~~ii~~a~~~gadai~pGygflsen~~fae~~~~~gl~fiGP~~~-~i~~mgdK~~ar~~~~~a  126 (449)
T COG0439          48 AVCIGPAPSADSYLNIDAIIAAAEETGADAIHPGYGFLSENAAFAEACAEAGLTFIGPSAE-AIRRMGDKITARRLMAKA  126 (449)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHCCCCEECCCCHHHHCCHHHHHHHHHCCCEEECCCHH-HHHHHHHHHHHHHHHHHC
T ss_conf             7983886503456518889989986087667235034217889999999749751084989-999744589999999974


Q ss_pred             CCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEEC-------CCC--CCHHHHHHHHHHHHH--
Q ss_conf             876885228899998765021578822576289999999850597799836-------777--899999999999972--
Q gi|254780669|r  115 GFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK-------GQF--LSPWEMHNILQKLHA--  183 (301)
Q Consensus       115 glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKk-------gq~--~s~~e~~~a~eki~~--  183 (301)
                      |+|++--.-                 |+ .-..-+.+..+.+.|-||+||=       |+.  -+.+|+..+.+.+.+  
T Consensus       127 GVP~vpgs~-----------------~~-~~~~ee~~~~a~~iGyPVivKa~~GgGg~G~r~v~~~~el~~a~~~~~~ea  188 (449)
T COG0439         127 GVPVVPGSD-----------------GA-VADNEEALAIAEEIGYPVIVKAAAGGGGRGMRVVRNEEELEAAFEAARGEA  188 (449)
T ss_pred             CCCCCCCCC-----------------CC-CCCHHHHHHHHHHCCCCEEEEECCCCCCCCEEEECCHHHHHHHHHHHHHHH
T ss_conf             999589978-----------------77-688899999998719978999778899654799799999999999999888


Q ss_pred             ---CCCCCEEEEEC
Q ss_conf             ---58780899514
Q gi|254780669|r  184 ---HGAKDVLFCER  194 (301)
Q Consensus       184 ---~Gn~~i~lcER  194 (301)
                         +||..+ +.|+
T Consensus       189 ~~~fg~~~v-~iEk  201 (449)
T COG0439         189 EAAFGNPRV-YLEK  201 (449)
T ss_pred             HHHCCCCCE-EEEE
T ss_conf             875589727-8634


No 247
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid). It has a widespread application as biocatalyst for the synthesis of sialic acid and its derivatives. This enzyme has been shown to be quite specific for pyruvate as the donor, but flexible to a variety of D- and, to some extent, L-hexoses and pentoses as acceptor substrates. NAL is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases.
Probab=46.24  E-value=25  Score=16.52  Aligned_cols=47  Identities=17%  Similarity=0.150  Sum_probs=25.5

Q ss_pred             HHHHCCCEEEEEE-C--CCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9971898899983-6--983347978201868899999999999999988
Q gi|254780669|r  252 AVAIGIAGIFLET-H--QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKII  298 (301)
Q Consensus       252 a~a~G~dGlfiE~-H--p~P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~v  298 (301)
                      +..+|++|...-+ .  |+.-..+.|.-+.=+.++-..+..++..+.++.
T Consensus       195 ~~~~Ga~G~i~~~~n~~p~~~~~i~~~~~~gd~~~A~~l~~~l~~~~~~~  244 (288)
T cd00954         195 ALALGADGAIGSTYNVNGKRYRKIFEAFNAGDIDTARELQHVINDVITVL  244 (288)
T ss_pred             HHHCCCCEEEECHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             99869989995767867999999999998869999999999999999999


No 248
>PRK07049 methionine gamma-lyase; Validated
Probab=46.12  E-value=25  Score=16.51  Aligned_cols=29  Identities=17%  Similarity=0.264  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHCCEEE--EECCCHHHHHHH
Q ss_conf             88899988665287688--522889999876
Q gi|254780669|r  103 GREIFRDLKKKYGFPIL--TDVHTEQQCEAI  131 (301)
Q Consensus       103 gL~il~e~k~~~glpv~--TeV~~~~~~e~~  131 (301)
                      ...+|.+.-.+||+.++  .|..++..++.+
T Consensus       135 T~~l~~~~l~~~GI~~~~~~d~~d~~~~~~~  165 (427)
T PRK07049        135 TETLLAKTFRNFGVGAVGFADGVSEAAIEAA  165 (427)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCHHHHHHH
T ss_conf             9999999999759889997089999999999


No 249
>PRK09197 fructose-bisphosphate aldolase; Provisional
Probab=45.70  E-value=24  Score=16.62  Aligned_cols=33  Identities=12%  Similarity=0.182  Sum_probs=18.7

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             778999999999999725878089951465444
Q gi|254780669|r  167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFG  199 (301)
Q Consensus       167 q~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg  199 (301)
                      .+-+|+|....+|..-.-.....+.+-=|++.|
T Consensus       186 lyT~Peea~~fve~tg~ds~~~~LAvaiGt~HG  218 (349)
T PRK09197        186 LYTQPEDVAYAYEALGKISPRFTIAASFGNVHG  218 (349)
T ss_pred             CCCCHHHHHHHHHHHCCCCCCEEEEEEECCCCC
T ss_conf             579989999999996788875467766314554


No 250
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed
Probab=45.69  E-value=25  Score=16.47  Aligned_cols=178  Identities=17%  Similarity=0.203  Sum_probs=82.9

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCC
Q ss_conf             69995486349999999999999996553399706601557688666322245671248889998866528768852288
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHT  124 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~  124 (301)
                      +-+|..|- .++.+ .++..+.+-+.|.++ +.+--|.       .+...+.     +-.+-+.++.++++.+++-.  +
T Consensus         9 lYlIT~~~-~~~~~-~~~~~~~~l~~Gv~~-vQlR~K~-------~~~~~~~-----~~a~~l~~i~~~~~~~liIN--d   71 (210)
T PRK00043          9 LYLITDSR-DSTGD-LLEVVEAALAGGVTL-VQLREKG-------ADARERL-----ELARALKALCRRYGVPLIVN--D   71 (210)
T ss_pred             EEEEECCC-CCCCC-HHHHHHHHHHCCCCE-EEECCCC-------CCHHHHH-----HHHHHHHHHHHHHCCEEEEC--C
T ss_conf             89991985-34554-999999999869999-9992699-------8999999-----99999999999809959976--8


Q ss_pred             HHHHHHHHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHH-
Q ss_conf             999987650-215788225762899999998505977998367778999999999999725878089951465444010-
Q gi|254780669|r  125 EQQCEAIAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT-  202 (301)
Q Consensus       125 ~~~~e~~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~-  202 (301)
                        +++.+.+ .+|-+.+|..-+. ..-+.+.-..++.|-+-  - -+.++...|    ...|.+=+.+.   ..|...+ 
T Consensus        72 --~~~lA~~~~adGvHLgq~d~~-~~~~r~~l~~~~iiG~S--~-h~~~e~~~A----~~~gaDYi~~G---pvf~T~tK  138 (210)
T PRK00043         72 --RVDLALAVGADGVHLGQDDLP-VADARAILGPDAIIGVS--T-HTLEEAAAA----AAAGADYVGVG---PIFPTPTK  138 (210)
T ss_pred             --HHHHHHHHCCCEEECCCCCCC-HHHHHHHCCCCCEEEEE--C-CCHHHHHHH----HHHCCCEEEEC---CCCCCCCC
T ss_conf             --899998719998976988768-99999751988789984--7-999999999----88289838874---52147988


Q ss_pred             ---H-CCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCC-HHHHHHHHHHHHHHCCCEEEEEE----CCCHHHC
Q ss_conf             ---0-000001068885-18716871177742122345321263-88999999999971898899983----6983347
Q gi|254780669|r  203 ---L-VTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGE-RQYIVPLAKAAVAIGIAGIFLET----HQDPDNA  271 (301)
Q Consensus       203 ---l-vvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~-r~~v~~la~aa~a~G~dGlfiE~----Hp~P~~A  271 (301)
                         . ...+..+..+++ ...||+.               .||- .+-+    ......|+||+-+=.    ++||+.|
T Consensus       139 ~~~~~~~g~~~l~~~~~~~~iPvvA---------------IGGI~~~ni----~~~~~~Ga~giAvis~I~~a~dp~~a  198 (210)
T PRK00043        139 KDAKPAVGLELLREAREAIDIPIVA---------------IGGITPENA----AEVLEAGADGVAVVSAITAAEDPAAA  198 (210)
T ss_pred             CCCCCCCCHHHHHHHHHHCCCCEEE---------------ECCCCHHHH----HHHHHCCCCEEEEEHHHHCCCCHHHH
T ss_conf             8887778999999999847999899---------------808899999----99998099999970897769999999


No 251
>PRK08045 cystathionine gamma-synthase; Provisional
Probab=45.68  E-value=25  Score=16.47  Aligned_cols=37  Identities=24%  Similarity=0.378  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHCCEEE-EECCCHHHHHHH-HHHCCEEEE
Q ss_conf             8899988665287688-522889999876-502157882
Q gi|254780669|r  104 REIFRDLKKKYGFPIL-TDVHTEQQCEAI-ADSVDILQI  140 (301)
Q Consensus       104 L~il~e~k~~~glpv~-TeV~~~~~~e~~-~~~vDilQI  140 (301)
                      ..++++.-.++|+.+. .|..+++.++.+ .+...++++
T Consensus       105 ~~l~~~~~~~~gi~v~~~d~~d~~~~~~~i~~~Tklv~~  143 (386)
T PRK08045        105 YRLFDSLAKRGCYRVLFVDQGDEQALRAALAEKPKLVLV  143 (386)
T ss_pred             HHHHHHHHCCCCEEEEEECCCCHHHHHHHCCCCCEEEEE
T ss_conf             999998720795799996999989999753778559999


No 252
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate.
Probab=45.50  E-value=25  Score=16.45  Aligned_cols=111  Identities=12%  Similarity=0.049  Sum_probs=58.8

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCC
Q ss_conf             69995486349999999999999996553399706601557688666322245671248889998866528768852288
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHT  124 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~  124 (301)
                      ..+|+|= + .|-+...+.|+..++.|.+..  .+.-          |+.|++ .-+.-.++++++.+..++|++-=-+ 
T Consensus        75 ~~vi~gv-g-~~t~~ai~la~~a~~~Gad~v--~v~p----------Pyy~~~-~~~~l~~~f~~ia~a~~~pi~lYn~-  138 (296)
T TIGR03249        75 VPVYTGV-G-GNTSDAIEIARLAEKAGADGY--LLLP----------PYLING-EQEGLYAHVEAVCESTDLGVIVYQR-  138 (296)
T ss_pred             CEEECCC-C-HHHHHHHHHHHHHHHCCCCEE--EECC----------CCCCCC-CHHHHHHHHHHHHHHCCCCEEEECC-
T ss_conf             4151278-6-129999999999987599978--9779----------988999-9999999999999715997787307-


Q ss_pred             HHHHHHHHHHCCEEEECHHHCCCHHHHHHHHH-CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             99998765021578822576289999999850-597799836777899999999999972587808995
Q gi|254780669|r  125 EQQCEAIADSVDILQIPALLCRQTDLLTAAAQ-TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFC  192 (301)
Q Consensus       125 ~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~-t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lc  192 (301)
                                      +.. .-..+++.++++ ....+-+|-.   + .++....+.+...+.+-.+++
T Consensus       139 ----------------~~~-~~~~~~l~~L~~~~p~i~giK~s---~-~d~~~~~~~~~~~~~~~~~~~  186 (296)
T TIGR03249       139 ----------------DNA-VLNADTLERLADRCPNLVGFKDG---I-GDMEQMIEITQRLGDRLGYLG  186 (296)
T ss_pred             ----------------CCC-CCCHHHHHHHHHCCCCEEEEEEC---C-CCHHHHHHHHHHCCCCCEEEE
T ss_conf             ----------------787-87999999998157987999977---6-689999999997399727973


No 253
>PRK08249 cystathionine gamma-synthase; Provisional
Probab=45.41  E-value=25  Score=16.44  Aligned_cols=63  Identities=25%  Similarity=0.417  Sum_probs=34.8

Q ss_pred             HHHHHHHHHHHHCCEEE-EECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHHC-CCEEEEEC
Q ss_conf             88899988665287688-522889999876-502157882-----25762899999998505-97799836
Q gi|254780669|r  103 GREIFRDLKKKYGFPIL-TDVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQT-GRVINVKK  165 (301)
Q Consensus       103 gL~il~e~k~~~glpv~-TeV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~t-~kpV~iKk  165 (301)
                      ...+|.+.-.++|+.|. .|..+++.++.. .+...++++     |.+-...-+-+.++++. |.++.+-+
T Consensus       116 T~~l~~~~l~~~Gi~v~fvd~~d~~~~~~ai~~~Tklv~~EtpsNP~l~v~Di~~ia~iA~~~g~~~vVDN  186 (398)
T PRK08249        116 TNKIFEEFLPRMGVDVTLCETGDHEQIEREIAKGCDLLYLETPTNPTLKITDIRRLSAAAHEVGALVVVDN  186 (398)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCEEECHHHHHHHHHHCCCEEEEEC
T ss_conf             99999976015986999879998699998558886189984489997466647999999987499699847


No 254
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=45.27  E-value=25  Score=16.43  Aligned_cols=116  Identities=18%  Similarity=0.146  Sum_probs=55.8

Q ss_pred             ECCCHHHHHHHHHHCCEEEECHHHCCC-HHHHHHHHHCC-CEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             228899998765021578822576289-99999985059-7799836777899999999999972587808995146544
Q gi|254780669|r  121 DVHTEQQCEAIADSVDILQIPALLCRQ-TDLLTAAAQTG-RVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSF  198 (301)
Q Consensus       121 eV~~~~~~e~~~~~vDilQIgA~~~rq-tdLl~a~a~t~-kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~f  198 (301)
                      +||+.-+.|...-+  |+|.|-   |. -.|.+++.+.| .||+=     -|++..-.|=+|-+ +   .-+|=+=|+.=
T Consensus       639 ~Vm~I~e~E~~~GV--IVq~GG---Qtp~nlA~~L~~~GG~~iLG-----TS~~~ID~AEDR~k-F---s~~l~~Lgi~Q  704 (1089)
T TIGR01369       639 DVMNIIELEKPEGV--IVQFGG---QTPLNLAKELEEAGGVPILG-----TSPESIDRAEDREK-F---SELLDELGIPQ  704 (1089)
T ss_pred             CCEEHEEECCCCEE--EEECCC---HHHHHHHHHHHHCCCCEEEC-----CCHHHHHHHCCHHH-H---HHHHHHCCCCC
T ss_conf             10011000586679--997487---32678999999708931736-----88578751318679-9---99997158798


Q ss_pred             CCHHHCCCCCCCHH----HHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             40100000001068----88518716871177742122345321263889999999999718
Q gi|254780669|r  199 GYNTLVTDMRSIPI----MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIG  256 (301)
Q Consensus       199 gy~~lvvD~~~i~~----lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G  256 (301)
                      .-+.-   ..++..    -++.||||++=|||=+   ||.+=.+.-+-+-...+.+-|.+.-
T Consensus       705 P~~~~---a~s~eea~~~A~~iGYPvlvRPSYVL---gG~aM~iv~~~eeL~~yl~~a~~~S  760 (1089)
T TIGR01369       705 PEWKI---ATSVEEAKEFASEIGYPVLVRPSYVL---GGRAMEIVYNEEELARYLEEAVEVS  760 (1089)
T ss_pred             CCCCE---ECCHHHHHHHHHHCCCCEEECCCCCC---CCCCHHEECCHHHHHHHHHHHHHHC
T ss_conf             98852---72879999998546992898168300---3362100267889999999999720


No 255
>pfam07075 DUF1343 Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
Probab=45.14  E-value=9.4  Score=19.26  Aligned_cols=106  Identities=20%  Similarity=0.299  Sum_probs=60.6

Q ss_pred             EEECCCCCCCH-HHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEC---
Q ss_conf             99548634999-99999999999965533997066015576886663222456712488899988665287688522---
Q gi|254780669|r   47 LIAGPCQIESH-DHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDV---  122 (301)
Q Consensus        47 iIAGPCsiES~-e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV---  122 (301)
                      +|+-|-++-+. .+..+   .|.+.. ...+--+|-|      -   ++|||.. +.|.++-..+...+|+||.+=-   
T Consensus         3 LitN~t~v~~~~~~~~d---~L~~~~-~v~l~~lF~P------E---HG~~G~~-~ag~~v~~~~D~~tglpv~SLYg~~   68 (359)
T pfam07075         3 LITNQTGVDRDLEHLVD---LLLAAP-GVNLKALFGP------E---HGFRGDA-QAGEKVGDYVDPKTGLPVYSLYGKT   68 (359)
T ss_pred             EEECHHHCCCCCCCHHH---HHHHCC-CCCEEEEECC------C---CCCCCCC-CCCCCCCCCCCCCCCCEEEECCCCC
T ss_conf             99360233899878999---996656-9868998179------8---7874042-1498567876888899089798999


Q ss_pred             C--CHHHHHHHHH-HCCEEEECHHHCCC----HHHHHHHHHCCCEEEE-ECC
Q ss_conf             8--8999987650-21578822576289----9999998505977998-367
Q gi|254780669|r  123 H--TEQQCEAIAD-SVDILQIPALLCRQ----TDLLTAAAQTGRVINV-KKG  166 (301)
Q Consensus       123 ~--~~~~~e~~~~-~vDilQIgA~~~rq----tdLl~a~a~t~kpV~i-Kkg  166 (301)
                      .  .+++++-+-- +.|+=-||+|---=    ...++|+++.+++|.+ -|+
T Consensus        69 ~~Pt~~~L~~iDvlv~DiQDvG~R~YTyi~Tm~~~meaaa~~~~~~iVLDRP  120 (359)
T pfam07075        69 RKPTPEMLKGVDVLVFDIQDVGVRFYTYISTLAYAMEAAAEAGKEFIVLDRP  120 (359)
T ss_pred             CCCCHHHHHCCCEEEEEEECCCEEEEEHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             9999999836999999742276156545999999999999749958994789


No 256
>PRK01395 V-type ATP synthase subunit F; Provisional
Probab=45.00  E-value=13  Score=18.28  Aligned_cols=54  Identities=22%  Similarity=0.410  Sum_probs=29.4

Q ss_pred             CCCCCCCCCCCC--------HHHHHHHHHHH-HHHCCEEEEECCCHHHHHHHHHHCC-----EEEECH
Q ss_conf             666322245671--------24888999886-6528768852288999987650215-----788225
Q gi|254780669|r   89 RSSLAGKRGVGL--------KKGREIFRDLK-KKYGFPILTDVHTEQQCEAIADSVD-----ILQIPA  142 (301)
Q Consensus        89 RtS~~sfrG~Gl--------e~gL~il~e~k-~~~glpv~TeV~~~~~~e~~~~~vD-----ilQIgA  142 (301)
                      |-|..+|+.+|+        +++.+.++++. ++|++-.+||=.-..--+.+.+|-.     |++||.
T Consensus        12 ~DsvlgF~~lG~dvfpv~~~eEa~~~l~~La~~~y~II~ITE~~a~~i~~~i~~y~~~~lPaII~IP~   79 (104)
T PRK01395         12 KDSILPFKALGFDVFPVIEEQEARNTLRKLAMEDYAIIYITEDIAKDIPETIERYDNQVLPAIILIPS   79 (104)
T ss_pred             HHHHHHHHHCCEEEEECCCHHHHHHHHHHHHHCCEEEEEEEHHHHHHHHHHHHHHHCCCCCEEEECCC
T ss_conf             57878888658047854887999999999986792799972999845699999985257877998689


No 257
>PRK13127 consensus
Probab=44.63  E-value=26  Score=16.36  Aligned_cols=219  Identities=17%  Similarity=0.222  Sum_probs=114.7

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEE------CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-970660------1557688666322245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYK------SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK------~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv  118 (301)
                      ++.||=   -+.|...++++.+.+.|+++. +|.=|.      |..-+|+.-+.  -.|..+++.+++++++|++.+.|+
T Consensus        16 yitaG~---P~~e~t~~~l~~l~~~GaDiiElGiPfSDP~ADGPvIq~a~~rAL--~~G~~~~~~~~~~~~~r~~~~~pi   90 (262)
T PRK13127         16 YLVAGD---PDPEATLEFVKALVKGGADVIELGIPFSDPVADGPTIQAADVRAL--SAGMKIDKYFELVKELRVDSSVPL   90 (262)
T ss_pred             EECCCC---CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH--HCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             862708---998999999999997699999978988887765799999999999--769979999999999745699887


Q ss_pred             EEE-----C---CCHHHHHHHHHH-CCEEEECHHHCCC-HHHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             852-----2---889999876502-1578822576289-999999850597-7998367778999999999999725878
Q gi|254780669|r  119 LTD-----V---HTEQQCEAIADS-VDILQIPALLCRQ-TDLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       119 ~Te-----V---~~~~~~e~~~~~-vDilQIgA~~~rq-tdLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      +-=     +   -..+-++.+++. +|-+=||--.... .++..++.+.+. +|.+=-+  .|+++.+   +++.+....
T Consensus        91 vlM~Y~N~i~~~G~e~F~~~~~~~GvdGlIipDLP~eE~~~~~~~~~~~gi~~I~lvaP--tt~~~Ri---~~i~~~a~g  165 (262)
T PRK13127         91 VLMTYYNPVYRYGVEKFVKKAAEAGVSGLIIPDLPVEEATDLREACKKHGLDLVFLVAP--TTPEERL---KRIDEASSG  165 (262)
T ss_pred             EEEECCHHHHHCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCEEEEEECC--CCCHHHH---HHHHHCCCC
T ss_conf             99966138876089999999987599769966999789999999998558327998589--9989999---999843898


Q ss_pred             CEEE-EECCCCCCCHHHCCCCC-CCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             0899-51465444010000000-1068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  188 DVLF-CERGTSFGYNTLVTDMR-SIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       188 ~i~l-cERG~~fgy~~lvvD~~-~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      =|.+ .-.|+|=..+.+..+.. .+..+|+ +..||++---=+             .++-    +++....|+||+.+=+
T Consensus       166 FiY~vs~~GvTG~~~~~~~~~~~~i~~ik~~t~~Pv~vGFGI~-------------~~e~----v~~~~~~~aDGvIVGS  228 (262)
T PRK13127        166 FVYLVSRLGVTGAREDVEEATFDLLKRARTTCKNKIAVGFGIS-------------KGEH----AEELLDAGADGVIVGS  228 (262)
T ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEEC-------------CHHH----HHHHHHCCCCEEEECH
T ss_conf             1899843555687655528899999999961799848993348-------------8999----9999864999999878


Q ss_pred             CCCHHHCCCCCC-CCCCHHHHHHHHHHHHH
Q ss_conf             698334797820-18688999999999999
Q gi|254780669|r  265 HQDPDNAPSDGP-NMINIKDLPKLLSQLLA  293 (301)
Q Consensus       265 Hp~P~~AlsD~~-q~l~l~~l~~ll~~l~~  293 (301)
                      +---  .+.++. +.=.++.+.+++++|++
T Consensus       229 aiv~--~i~~~~~~~~~~~~v~~~~~~lk~  256 (262)
T PRK13127        229 ALVD--IIAEGGDNEEVADRLEELARELKS  256 (262)
T ss_pred             HHHH--HHHHCCCHHHHHHHHHHHHHHHHH
T ss_conf             9999--999669978999999999999999


No 258
>TIGR00742 yjbN TIM-barrel protein, yjbN family; InterPro: IPR004653   This family represents one branch of COG0042 from COG (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family) although NifR3 itself, a protein of unknown function associated with nitrogen regulation in Rhodobacter capsulatus, is not a member of this branch. Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA . They show a distant relationship to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase.; GO: 0016491 oxidoreductase activity, 0050660 FAD binding, 0008033 tRNA processing.
Probab=44.43  E-value=26  Score=16.34  Aligned_cols=123  Identities=17%  Similarity=0.110  Sum_probs=71.6

Q ss_pred             CCCCHHHHHHHHHHHHHHH-HHCCCCEEEEC----CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE---ECCC
Q ss_conf             3499999999999999965-53399706601----55768866632224567124888999886652876885---2288
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAIC-QSLNIGLVYKS----SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT---DVHT  124 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~-~~~~~~~ifK~----sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T---eV~~  124 (301)
                      --||||.+...-+.+...| .+-++=.+.|+    -=+|-||+=|      -|+  -+-.-++|++|---++.   =|..
T Consensus       143 kndSYe~l~~Fv~~v~~~Gec~~FivHARkAwL~GlSPKeNR~IP------pL~--y~~VYqLKkdfp~L~i~INGGI~~  214 (326)
T TIGR00742       143 KNDSYEELCDFVEIVSGKGECQNFIVHARKAWLSGLSPKENREIP------PLR--YERVYQLKKDFPHLTIEINGGIKN  214 (326)
T ss_pred             CCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCCCCCC------CCC--CHHHHHHHCCCCCCEEEECCCCCC
T ss_conf             323378999999986178861134687899985788862257877------987--246776520032105633578553


Q ss_pred             HHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHH-HHHHHHHHHCCC
Q ss_conf             99998765021578822576289999999850597799836777899999-999999972587
Q gi|254780669|r  125 EQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEM-HNILQKLHAHGA  186 (301)
Q Consensus       125 ~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~-~~a~eki~~~Gn  186 (301)
                      .+|+..=..+||-+=||=---+|..|+-.+.+   -+.=+...-++..|. ..-++||+..-+
T Consensus       215 ~E~~k~HL~~vD~VMvGR~Ay~NP~l~A~~dr---~~~~~~~~~~~~~~i~~~M~pYie~~l~  274 (326)
T TIGR00742       215 SEQIKQHLSHVDGVMVGREAYENPYLLANVDR---EIFNETDEILTRKEIVEQMLPYIEERLS  274 (326)
T ss_pred             HHHHHHHHHHHHHHHHCHHHHHCHHHHHHHHH---HHHCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             59999765564311302243005268999989---9707787777979999986799999974


No 259
>pfam05636 DUF795 Protein of unknown function (DUF795). This family consists of several bacterial proteins of unknown function.
Probab=44.35  E-value=18  Score=17.38  Aligned_cols=32  Identities=13%  Similarity=0.052  Sum_probs=17.9

Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHH
Q ss_conf             488899988665287688522889999876502
Q gi|254780669|r  102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADS  134 (301)
Q Consensus       102 ~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~  134 (301)
                      -|..+|..++- -.+-.-+|--+......+++.
T Consensus        85 gaV~lL~~lgv-d~l~FGsE~~d~~~l~~~a~~  116 (389)
T pfam05636        85 GAVSILDSLGI-DTLAFGSEEGDIEDLKKIAKI  116 (389)
T ss_pred             HHHHHHHHCCC-CEEEECCCCCCHHHHHHHHHH
T ss_conf             99999998699-989965888989999999999


No 260
>PRK13670 hypothetical protein; Provisional
Probab=44.27  E-value=19  Score=17.28  Aligned_cols=31  Identities=10%  Similarity=0.069  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCHHHHHHHHH
Q ss_conf             48889998866528768852288999987650
Q gi|254780669|r  102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIAD  133 (301)
Q Consensus       102 ~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~  133 (301)
                      -|..+|..++- -.+-.-+|--+.+....+++
T Consensus        85 gaV~lL~~lgv-d~l~FGsE~~d~~~l~~~a~  115 (390)
T PRK13670         85 GAVSILDALGV-DDLVFGSESGDIEDFQKLAK  115 (390)
T ss_pred             HHHHHHHHCCC-CEEEECCCCCCHHHHHHHHH
T ss_conf             99999998699-98996688898999999999


No 261
>PRK07360 FO synthase subunit 2; Reviewed
Probab=44.19  E-value=26  Score=16.32  Aligned_cols=223  Identities=15%  Similarity=0.154  Sum_probs=104.8

Q ss_pred             EECCCCCC----CHHHHHHHHHHHHHHHHH-CCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC-CEEEEE
Q ss_conf             95486349----999999999999996553-399706601557688666322245671248889998866528-768852
Q gi|254780669|r   48 IAGPCQIE----SHDHAFMIAEKLYAICQS-LNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYG-FPILTD  121 (301)
Q Consensus        48 IAGPCsiE----S~e~~~~~A~~lk~~~~~-~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~g-lpv~Te  121 (301)
                      -..|-..+    |.|++++.|+..++.|.+ ..+.+=.+|-++         ++...++.-+++++.+|+++. +-+  -
T Consensus        80 ~r~p~~~~ay~ls~eEi~~~~~~a~~~G~tEv~~~gG~~P~l~---------~~~~~~~~y~~~~~~ik~~~p~i~i--~  148 (375)
T PRK07360         80 RRDKGDPGAFWLDIEEILEKAAEAVKAGATEVCIQGGLHPAAD---------LNGSSLDFYLEILKAIKAEFPGIHL--H  148 (375)
T ss_pred             CCCCCCCCCEECCHHHHHHHHHHHHHCCCEEEEECCCCCCCCC---------CCCCHHHHHHHHHHHHHHHCCCCEE--E
T ss_conf             0788997660278999999999998658808997688783445---------4645189999999999986898556--4


Q ss_pred             CCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHH-----HCCCEEEEEC------CCCCCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             2889999876502157882257628999999985-----0597799836------7778999999999999725878089
Q gi|254780669|r  122 VHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA-----QTGRVINVKK------GQFLSPWEMHNILQKLHAHGAKDVL  190 (301)
Q Consensus       122 V~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a-----~t~kpV~iKk------gq~~s~~e~~~a~eki~~~Gn~~i~  190 (301)
                      -..+..+...++...   ++.+-+  ..-|+++|     .++-.|+..+      +-=.+.++|+.+.+-....|-+-- 
T Consensus       149 a~s~~Ei~~~a~~~g---~~~~e~--l~~LkeAGl~s~pG~gaEil~~~vr~~i~P~K~~~~~wl~v~~~Ah~lGi~tt-  222 (375)
T PRK07360        149 AFSPQEVQFAAREDG---LSYEEV--LKALKDAGLDSMPGTAAEILDDEVRRIICPEKITTAEWIEIVKTAHKLGLPTT-  222 (375)
T ss_pred             ECCHHHHHHHHHHCC---CCHHHH--HHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCC-
T ss_conf             089999999886649---988999--99999769875888762103455664659898899999999999998299701-


Q ss_pred             EEECCCCCC----CHHHCCCCCCCHHHHH-H-CC-CEE---ECH----------------------HHHHHH---CCCCC
Q ss_conf             951465444----0100000001068885-1-87-168---711----------------------777421---22345
Q gi|254780669|r  191 FCERGTSFG----YNTLVTDMRSIPIMTS-M-GV-PVI---FDA----------------------SHSVQQ---PGIHG  235 (301)
Q Consensus       191 lcERG~~fg----y~~lvvD~~~i~~lk~-~-~~-PVi---~D~----------------------SHs~q~---p~~~~  235 (301)
                         -|..||    +..++-.+..+-.++. + |+ .+|   |-|                      +|++-+   ++--.
T Consensus       223 ---atmL~Gh~Et~eerv~hL~~iR~lqd~tggf~efIp~~F~~~nt~l~~~~~~~~~~~~~e~lk~~AvaRl~Ldn~i~  299 (375)
T PRK07360        223 ---STMMYGHIETPEHRIDHLSILREIQKETGGITEFIPLPFVHENAPLYERGRVKRGAPGLEDLKLYAVSRIFLGNWIK  299 (375)
T ss_pred             ---EEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             ---00261898999999999999998887449846997114358998500015678888669899999999998338887


Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCC---EEEEEECCCHHHCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             32126388999999999971898---899983698334797820186889999999999
Q gi|254780669|r  236 NCSGGERQYIVPLAKAAVAIGIA---GIFLETHQDPDNAPSDGPNMINIKDLPKLLSQL  291 (301)
Q Consensus       236 ~~~gG~r~~v~~la~aa~a~G~d---GlfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~~l  291 (301)
                      +..+-+-.+-+.+++.|+.+|+|   |.++|-|..+.... +.++.++++++..++++.
T Consensus       300 ~Iqa~Wv~~g~~~~q~aL~~GanD~ggt~~ee~i~~~aG~-~~~~~~~~~~l~~~i~~a  357 (375)
T PRK07360        300 NIQPSWVKLGLKLAQEALNCGANDLGGTLMEEHITKMAGA-SGGTCMSVEELENAIKSI  357 (375)
T ss_pred             CEECCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC-CCCCCCCHHHHHHHHHHC
T ss_conf             6577775448999999996699767665666750012268-998889999999999984


No 262
>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism]
Probab=43.43  E-value=27  Score=16.24  Aligned_cols=145  Identities=20%  Similarity=0.358  Sum_probs=74.1

Q ss_pred             CHHHHHHHHHHHHHHCCEEEEECCC---HHHHHHHHH--HCCEEEECHHH-----CCCH-HHHHHHHHCCCEEEEECCC-
Q ss_conf             1248889998866528768852288---999987650--21578822576-----2899-9999985059779983677-
Q gi|254780669|r  100 LKKGREIFRDLKKKYGFPILTDVHT---EQQCEAIAD--SVDILQIPALL-----CRQT-DLLTAAAQTGRVINVKKGQ-  167 (301)
Q Consensus       100 le~gL~il~e~k~~~glpv~TeV~~---~~~~e~~~~--~vDilQIgA~~-----~rqt-dLl~a~a~t~kpV~iKkgq-  167 (301)
                      .+-...+...+.++|++||+--.-+   .+.+...-+  +--+..=|+.+     ...| +.++-+...|..|=.-=|. 
T Consensus        60 ~~~~~~~v~~~a~~~~vPV~lHlDHg~~~~~~~~ai~~GFsSvMiDgS~~p~eENi~~tkevv~~ah~~gvsVEaElG~~  139 (286)
T COG0191          60 ADSLAHMVKALAEKYGVPVALHLDHGASFEDCKQAIRAGFSSVMIDGSHLPFEENIAITKEVVEFAHAYGVSVEAELGTL  139 (286)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             88999999999997799889977789999999999756882587538757788899999999999998298189985133


Q ss_pred             ---------------CCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC-CH--HHCCCCCCCHHHHH-HCCCEEECHHHHH
Q ss_conf             ---------------78999999999999725878089951465444-01--00000001068885-1871687117774
Q gi|254780669|r  168 ---------------FLSPWEMHNILQKLHAHGAKDVLFCERGTSFG-YN--TLVTDMRSIPIMTS-MGVPVIFDASHSV  228 (301)
Q Consensus       168 ---------------~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg-y~--~lvvD~~~i~~lk~-~~~PVi~D~SHs~  228 (301)
                                     ...|++   +.+.+..+|. +-+..-=|++.| |.  +--.||--+...++ ..+|.++   |  
T Consensus       140 GG~Edg~~~~~~~~~~tdp~e---a~~fv~~tgi-D~LA~aiGn~HG~Yk~~~p~L~f~~L~~i~~~~~~PlVl---H--  210 (286)
T COG0191         140 GGEEDGVVLYTDPADLTDPEE---ALEFVERTGI-DALAAAIGNVHGVYKPGNPKLDFDRLKEIQEAVSLPLVL---H--  210 (286)
T ss_pred             CCCCCCCCCCCCHHHHCCHHH---HHHHHHCCCC-CEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEE---E--
T ss_conf             575677535666655079999---9999861286-656110035666788999988979999999985898797---6--


Q ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             212234532126388999999999971898899983
Q gi|254780669|r  229 QQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       229 q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                         |+.    |=-.    .--+.|+.+|+.=+=|-|
T Consensus       211 ---GgS----Gip~----eeI~~aI~~GV~KvNi~T  235 (286)
T COG0191         211 ---GGS----GIPD----EEIREAIKLGVAKVNIDT  235 (286)
T ss_pred             ---CCC----CCCH----HHHHHHHHHCCEEEEECC
T ss_conf             ---799----9999----999999972955885472


No 263
>pfam01946 Thi4 Thi4 family. This family includes a putative thiamine biosynthetic enzyme.
Probab=43.31  E-value=27  Score=16.23  Aligned_cols=12  Identities=17%  Similarity=-0.166  Sum_probs=5.3

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999655
Q gi|254780669|r   61 FMIAEKLYAICQ   72 (301)
Q Consensus        61 ~~~A~~lk~~~~   72 (301)
                      +..|..|.+.+.
T Consensus        30 L~aA~~LAk~g~   41 (229)
T pfam01946        30 LTAAYYLAKKGL   41 (229)
T ss_pred             HHHHHHHHHCCC
T ss_conf             999999987898


No 264
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional
Probab=43.10  E-value=27  Score=16.21  Aligned_cols=183  Identities=17%  Similarity=0.163  Sum_probs=91.4

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEC
Q ss_conf             70699954863499999999999999965533997066015576886663222456712488899988665287688522
Q gi|254780669|r   43 QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDV  122 (301)
Q Consensus        43 ~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV  122 (301)
                      -+|.+|. |-..+....    ++.|...-..-.+..+-=       |-+-.+-+..  ..--+-|+++-+++|+|.+-. 
T Consensus        13 ~rLYLIT-P~~~d~~~~----~~~l~~aL~~g~Va~vql-------R~k~~d~~~~--~~~a~~L~~lc~~~gv~lIIN-   77 (221)
T PRK06512         13 CRIVLVA-PPIADGAAL----AKLLRAALSGGDVASVIL-------PDYGLDEATF--QKQAEKYVPVIQEAGAAALIA-   77 (221)
T ss_pred             CEEEEEC-CCCCCHHHH----HHHHHHHHCCCCEEEEEE-------ECCCCCHHHH--HHHHHHHHHHHHHCCCCEEEC-
T ss_conf             7589978-997466789----999999984698559997-------5799999999--999999999999829919988-


Q ss_pred             CCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCH
Q ss_conf             889999876502-1578822576289999999850597799836777899999999999972587808995146544401
Q gi|254780669|r  123 HTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN  201 (301)
Q Consensus       123 ~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~  201 (301)
                         ++++.+..+ +|-+.+|-   ..-++-++-...+.-..|=-+-.-|..+-+.+.|    .|.+=|.+-.    |...
T Consensus        78 ---D~~dlA~~~gADGVHlGq---~d~~~~~aR~~lg~~~IIG~~~~~s~~~A~~A~e----~GADYv~fG~----~~~~  143 (221)
T PRK06512         78 ---GDTRIAGRVKADGLHIEG---NAAALAEAIEKHAPKMIVGFGNLRDRHGAMEVGE----LQPDYLFFGK----LGAD  143 (221)
T ss_pred             ---CCHHHHHHCCCCEEEECC---CCCCHHHHHHHHCCCCEEEEECCCCHHHHHHHHH----CCCCEEEECC----CCCC
T ss_conf             ---979999970998665268---7531999999847886786405788999999997----3998576578----7888


Q ss_pred             HH----CCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCC-HHHHHHHHHHHHHHCCCEEEEEE----CCCHHHC
Q ss_conf             00----000001068885-18716871177742122345321263-88999999999971898899983----6983347
Q gi|254780669|r  202 TL----VTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGE-RQYIVPLAKAAVAIGIAGIFLET----HQDPDNA  271 (301)
Q Consensus       202 ~l----vvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~-r~~v~~la~aa~a~G~dGlfiE~----Hp~P~~A  271 (301)
                      +.    ...+.-+.++++ ..+|++.               .||. .+-+    ..-+.+|+||+-+-.    ++||..|
T Consensus       144 ~k~~a~~~~l~~l~~~~~~~~iP~VA---------------IGGIt~~n~----~~v~~aGad~vAVisaI~~a~Dp~~A  204 (221)
T PRK06512        144 NKPEAHPRNLSLAEWWAEMIEIPCIV---------------QAGSDLASI----VEVAETGAEFVALGRAVFDAHDPPLA  204 (221)
T ss_pred             CCCCCCCCCHHHHHHHHHCCCCCEEE---------------ECCCCHHHH----HHHHHHCCCEEEEHHHHHCCCCHHHH
T ss_conf             89988754258999999747999899---------------827899999----99998199899885996089999999


Q ss_pred             CC
Q ss_conf             97
Q gi|254780669|r  272 PS  273 (301)
Q Consensus       272 ls  273 (301)
                      .-
T Consensus       205 ~~  206 (221)
T PRK06512        205 VA  206 (221)
T ss_pred             HH
T ss_conf             99


No 265
>PRK00719 alkanesulfonate monooxygenase; Provisional
Probab=42.93  E-value=22  Score=16.91  Aligned_cols=48  Identities=15%  Similarity=0.149  Sum_probs=33.8

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCC
Q ss_conf             234532126388999999999971898899983698334797820186
Q gi|254780669|r  232 GIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI  279 (301)
Q Consensus       232 ~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l  279 (301)
                      |+.|...=|..+-|-.-...=..+|+||+++---|--++|.==|.+-|
T Consensus       297 gG~gtaLVGspeqVAd~i~~y~~~Gvd~fiLsg~p~leEa~~fge~Vl  344 (377)
T PRK00719        297 GGAGTALVGDPPTVAARIREYADLGIDTFILSGYPHLEEAYRFAELVF  344 (377)
T ss_pred             CCCCCEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHC
T ss_conf             888640758989999999999974997899738998799999997644


No 266
>PRK05968 hypothetical protein; Provisional
Probab=42.90  E-value=26  Score=16.37  Aligned_cols=37  Identities=19%  Similarity=0.284  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHHCCEEEE-ECCCHHHHHHHHHHCCEEEE
Q ss_conf             88999886652876885-22889999876502157882
Q gi|254780669|r  104 REIFRDLKKKYGFPILT-DVHTEQQCEAIADSVDILQI  140 (301)
Q Consensus       104 L~il~e~k~~~glpv~T-eV~~~~~~e~~~~~vDilQI  140 (301)
                      ..++.+.-.+||+.+.. |..+++.++.+-....++++
T Consensus       116 ~~l~~~~l~~~GI~v~~vd~~d~~~~~~~i~~Tklv~~  153 (389)
T PRK05968        116 YRLFGTLLKRMGVEVDYVDGRDEEAVAKALPGAKLLYL  153 (389)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHCCCCCCEEEE
T ss_conf             99999888607846999689999999962768728999


No 267
>TIGR02549 CRISPR_DxTHG CRISPR-associated protein DxTHG motif; InterPro: IPR013383    Clusters of short DNA repeats with nonhomologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognizable features . This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry describes a short region highly conserved found in two otherwise substantially different cas proteins. This region includes the motif [VIL]-D-x-[ST]-H-[GS]..
Probab=42.72  E-value=11  Score=18.73  Aligned_cols=19  Identities=32%  Similarity=0.628  Sum_probs=13.8

Q ss_pred             EEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             687117774212234532126388999999999
Q gi|254780669|r  220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAA  252 (301)
Q Consensus       220 Vi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa  252 (301)
                      |+.|.||+.              .|+|-++..|
T Consensus         2 i~LD~THG~--------------n~~p~~~~~~   20 (21)
T TIGR02549         2 IILDVTHGI--------------NFMPLLALEA   20 (21)
T ss_pred             EEEEECCCH--------------HHHHHHHHHC
T ss_conf             788730782--------------4688999870


No 268
>pfam01729 QRPTase_C Quinolinate phosphoribosyl transferase, C-terminal domain. Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase EC:2.4.2.19 is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes. It catalyses the reaction of quinolinic acid with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg2+ to give rise to nicotinic acid mononucleotide (NaMN), pyrophosphate and carbon dioxide. The QA substrate is bound between the C-terminal domain of one subunit, and the N-terminal domain of the other. The C-terminal domain has a 7 beta-stranded TIM barrel-like fold.
Probab=42.60  E-value=28  Score=16.16  Aligned_cols=114  Identities=19%  Similarity=0.285  Sum_probs=68.0

Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHH
Q ss_conf             997066015576886663222456712488899988665287688522889999876502-1578822576289999999
Q gi|254780669|r   75 NIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTA  153 (301)
Q Consensus        75 ~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a  153 (301)
                      -|-+.+-.-.-|.|--..   -| |+++.++-+++.. .+..+|.-||...+|++.+.+. +|++|.--           
T Consensus        45 HR~gL~d~ilikdnHi~~---~g-~~~~~i~~~~~~~-~~~~~I~VEv~tl~e~~~a~~~~~d~I~LDn-----------  108 (169)
T pfam01729        45 HRLGLSDAVLIKDNHIAA---AG-SITEAVRRAREVA-PFAVKIEVEVENLEELEEALEAGADIIMLDN-----------  108 (169)
T ss_pred             CCCCCCHHEEEHHHHHHH---HC-CHHHHHHHHHHHC-CCCCEEEEEEEHHHHHHHHHHCCCCEEEECC-----------
T ss_conf             216887103654778875---27-9999999999967-9997099996019989999846998999779-----------


Q ss_pred             HHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHHHCCCE--EECHHHHH
Q ss_conf             8505977998367778999999999999725878089951465444010000000106888518716--87117774
Q gi|254780669|r  154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV--IFDASHSV  228 (301)
Q Consensus       154 ~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~~~~PV--i~D~SHs~  228 (301)
                                     ++|+++..+++++.+.+.+ +.+---|-        +.+.++....+++.-+  +-..|||.
T Consensus       109 ---------------~spe~l~~~v~~l~~~~~~-v~iEaSGg--------I~~~ni~~yA~tGvD~IS~galt~sa  161 (169)
T pfam01729       109 ---------------FSPEEVREAVEELDERAGR-VLLEVSGG--------ITLDNVLEYAKTGVDVISVGALTHSV  161 (169)
T ss_pred             ---------------CCHHHHHHHHHHHHHHCCC-EEEEECCC--------CCHHHHHHHHHCCCCEEECCHHHCCC
T ss_conf             ---------------9999999999999975896-79996189--------99999999997699999858644699


No 269
>PRK08776 cystathionine gamma-synthase; Provisional
Probab=42.59  E-value=28  Score=16.16  Aligned_cols=63  Identities=24%  Similarity=0.329  Sum_probs=31.2

Q ss_pred             HHHHHHHHHHHHCCEEEE-ECCCHHHHHHH-HHHCCEEEEC-----HHHCCCHHHHHHHHH-CCCEEEEEC
Q ss_conf             888999886652876885-22889999876-5021578822-----576289999999850-597799836
Q gi|254780669|r  103 GREIFRDLKKKYGFPILT-DVHTEQQCEAI-ADSVDILQIP-----ALLCRQTDLLTAAAQ-TGRVINVKK  165 (301)
Q Consensus       103 gL~il~e~k~~~glpv~T-eV~~~~~~e~~-~~~vDilQIg-----A~~~rqtdLl~a~a~-t~kpV~iKk  165 (301)
                      ...+|.+.-..+|+.+.. |..+++.++.. .+...++++=     .+-+.+-.-+.++++ .|.++.+-+
T Consensus       112 T~~l~~~~~~~~gi~~~~vd~~d~~~~~~~i~~~Tklv~~EtpsNP~l~v~Di~~ia~iA~~~g~~~vVDN  182 (405)
T PRK08776        112 SWRLFNALAKKGHFALITADLTDPRSLADALAQSPKLVLIETPSNPLLRITDLRFVIEAAHKVGALTVVDN  182 (405)
T ss_pred             HHHHHHHHHHHCCEEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCEEECCHHHHHHHHHCCCEEEEEC
T ss_conf             99999998754888999968999899997437776599998899998860275999999987399799979


No 270
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI. TMP synthase catalyzes an important step in the thiamine biosynthesis pathway, the substitution of the pyrophosphate of 2-methyl-4-amino-5- hydroxymethylpyrimidine pyrophosphate by 4-methyl-5- (beta-hydroxyethyl) thiazole phosphate to yield thiamine phosphate. TenI is a enzymatically inactive regulatory protein involved in the regulation of several extracellular enzymes. This superfamily also contains other enzymatically inactive proteins with unknown functions.
Probab=42.29  E-value=28  Score=16.13  Aligned_cols=136  Identities=20%  Similarity=0.228  Sum_probs=59.3

Q ss_pred             HHHHHHHHHHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8899988665287688522889999876502-157882257628999999985059779983677789999999999997
Q gi|254780669|r  104 REIFRDLKKKYGFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLH  182 (301)
Q Consensus       104 L~il~e~k~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~  182 (301)
                      .+-+.++-.+++.+++-.    ++.+.+.+. +|-+.+|..-+... -++..-..++.|-+=-+   +.+|...|.    
T Consensus        45 a~~~~~~~~~~~~~liIn----d~~~lA~~~~~dGvHl~~~d~~~~-~~r~~~~~~~iiG~S~h---~~~e~~~a~----  112 (196)
T cd00564          45 ARALRELCRKYGVPLIIN----DRVDLALAVGADGVHLGQDDLPVA-EARALLGPDLIIGVSTH---SLEEALRAE----  112 (196)
T ss_pred             HHHHHHHHHHHCCEEEEC----CHHHHHHHHCCCEEECCCCCCCHH-HHHHHHCCCCEEEECCC---CHHHHHHHH----
T ss_conf             999999999809979978----869999973998795584668999-99987288975882478---899999988----


Q ss_pred             HCCCCCEEEEECCCCC---CCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCC-HHHHHHHHHHHHHHCC
Q ss_conf             2587808995146544---40100000001068885-18716871177742122345321263-8899999999997189
Q gi|254780669|r  183 AHGAKDVLFCERGTSF---GYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGE-RQYIVPLAKAAVAIGI  257 (301)
Q Consensus       183 ~~Gn~~i~lcERG~~f---gy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~-r~~v~~la~aa~a~G~  257 (301)
                      ..|.+=+.+-.---|-   ++.. ......+..+.+ ...||+.               .||- .+-+    .....+|+
T Consensus       113 ~~g~DYi~~gpvf~T~tK~~~~~-~~g~~~l~~~~~~~~~Pv~A---------------iGGI~~~ni----~~~~~~G~  172 (196)
T cd00564         113 ELGADYVGFGPVFPTPTKPGAGP-PLGLELLREIAELVEIPVVA---------------IGGITPENA----AEVLAAGA  172 (196)
T ss_pred             HHCCCEEEECCCCCCCCCCCCCC-CCCHHHHHHHHHHCCCCEEE---------------ECCCCHHHH----HHHHHCCC
T ss_conf             70999388646557898888778-77889999999867999899---------------858999999----99998099


Q ss_pred             CEEEEEE----CCCHHHC
Q ss_conf             8899983----6983347
Q gi|254780669|r  258 AGIFLET----HQDPDNA  271 (301)
Q Consensus       258 dGlfiE~----Hp~P~~A  271 (301)
                      ||+-+-.    ++||..+
T Consensus       173 ~giAv~s~i~~~~dp~~~  190 (196)
T cd00564         173 DGVAVISAITGADDPAAA  190 (196)
T ss_pred             CEEEEHHHHHCCCCHHHH
T ss_conf             999972997779999999


No 271
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain.  MDH is part of a widespread family of homologous FMN-dependent a-hydroxy acid oxidizing enzymes that oxidizes (S)-mandelate to phenylglyoxalate. MDH is an enzyme in the mandelate pathway that occurs in several strains of Pseudomonas which converts (R)-mandelate to benzoate. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).
Probab=42.09  E-value=28  Score=16.11  Aligned_cols=33  Identities=18%  Similarity=0.180  Sum_probs=13.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             597799836777899999999999972587808995146
Q gi|254780669|r  157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERG  195 (301)
Q Consensus       157 t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG  195 (301)
                      ++.|+.||==  ++++|-..|    ...|.+-|++---|
T Consensus       235 w~~plilKGI--~~~eDA~~A----~~~G~dgIiVSNHG  267 (361)
T cd04736         235 WPHKLLVKGI--VTAEDAKRC----IELGADGVILSNHG  267 (361)
T ss_pred             CCCCEEEECC--CCHHHHHHH----HHCCCCEEEECCCC
T ss_conf             6997455214--899999999----87699999975886


No 272
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional
Probab=42.02  E-value=28  Score=16.10  Aligned_cols=111  Identities=14%  Similarity=0.009  Sum_probs=62.2

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCC
Q ss_conf             69995486349999999999999996553399706601557688666322245671248889998866528768852288
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHT  124 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~  124 (301)
                      ..+|+| |.- +-+...+.|+..++.|++..  .+. |         ||.++ +.-+.-.++++++.+..++|++-=-  
T Consensus        71 vpvi~g-vg~-~t~~ai~la~~A~~~Gadai--~v~-p---------Pyy~~-~~~~~l~~~~~~ia~a~~lPi~lYn--  133 (296)
T PRK03620         71 VPVIAG-AGG-GTAQAIEYAQAAERAGADGI--LLL-P---------PYLTE-APQEGLAAHVEAVCKSTDLGVIVYN--  133 (296)
T ss_pred             CEEEEC-CCC-CHHHHHHHHHHHHHCCCCEE--EEC-C---------CCCCC-CCHHHHHHHHHHHHHHCCCCEEEEC--
T ss_conf             359825-775-37999999999998299989--966-9---------86789-9999999999999983189977517--


Q ss_pred             HHHHHHHHHHCCEEEECHHHCCCHHHHHHHHH-CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             99998765021578822576289999999850-597799836777899999999999972587808995
Q gi|254780669|r  125 EQQCEAIADSVDILQIPALLCRQTDLLTAAAQ-TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFC  192 (301)
Q Consensus       125 ~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~-t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lc  192 (301)
                                     .+.. .-..+++.++++ ....|-||-.-. ++.   ...+.+...+.+=.+++
T Consensus       134 ---------------~~~~-~~~~~~l~~L~~~~pnivgiKdss~-d~~---~~~~~~~~~~~~~~v~~  182 (296)
T PRK03620        134 ---------------RDNA-VLTADTLARLAERCPNLIGFKDGVG-DIE---LMVRITRALGDRLLYLG  182 (296)
T ss_pred             ---------------CCCC-CCCHHHHHHHHHHCCCEEEEEECCC-CHH---HHHHHHHHCCCCEEEEE
T ss_conf             ---------------8887-7699999999972898899995868-899---99999997699759982


No 273
>PRK07671 cystathionine beta-lyase; Provisional
Probab=41.58  E-value=29  Score=16.06  Aligned_cols=62  Identities=13%  Similarity=0.239  Sum_probs=30.5

Q ss_pred             HHHHHHHHHHHHCCEEEE-ECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHH-CCCEEEEE
Q ss_conf             888999886652876885-22889999876-502157882-----2576289999999850-59779983
Q gi|254780669|r  103 GREIFRDLKKKYGFPILT-DVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQ-TGRVINVK  164 (301)
Q Consensus       103 gL~il~e~k~~~glpv~T-eV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~-t~kpV~iK  164 (301)
                      ...++.+.-.++|+.+.- |..+++.++.. .+..+++++     |.+-+.+-.-+.++|+ .|.++.+-
T Consensus       101 T~~l~~~~l~~~Gi~v~fvd~~d~~~~~~ai~~~Tklv~~EspsNP~l~v~Di~~ia~iA~~~g~~~vVD  170 (377)
T PRK07671        101 TYRVMTKVLNRFGIEHTFVDTTNLEEVEEAIRPNTKAIYVETPTNPLLKITDIKKISTLAKEKGLLTIVD  170 (377)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCEECCHHHHHHHHHHCCCEEEEC
T ss_conf             8999998886369769994388868899647888449999789998875016799999999829969851


No 274
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed
Probab=41.56  E-value=29  Score=16.06  Aligned_cols=174  Identities=14%  Similarity=0.226  Sum_probs=87.1

Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCC-----E
Q ss_conf             99999996553399706601557688666322245671248889998866528768852288999987650215-----7
Q gi|254780669|r   63 IAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD-----I  137 (301)
Q Consensus        63 ~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vD-----i  137 (301)
                      +++.+.+...+...+.|.--        |+....-.|++.-..+.+.+.+++.+||.--.-+....+.+.+.+|     |
T Consensus        30 ~~~Avi~AAee~~sPvIlq~--------~~~~~~~~g~~~~~~~~~~~a~~~~VPV~lHLDH~~~~e~i~~ai~~GftSV  101 (284)
T PRK09195         30 TMQVVVETAAELHSPVIIAG--------TPGTFSYAGTEYLLAIVSAAAKQYHHPLALHLDHHEKFDDIAQKVRSGVRSV  101 (284)
T ss_pred             HHHHHHHHHHHHCCCEEEEC--------CHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEE
T ss_conf             99999999999599989998--------8516644798999999999998779988996698799999999997499868


Q ss_pred             EEECHHH-----CCCH-HHHHHHHHCCCEEEEEC----------------CCCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             8822576-----2899-99999850597799836----------------777899999999999972587808995146
Q gi|254780669|r  138 LQIPALL-----CRQT-DLLTAAAQTGRVINVKK----------------GQFLSPWEMHNILQKLHAHGAKDVLFCERG  195 (301)
Q Consensus       138 lQIgA~~-----~rqt-dLl~a~a~t~kpV~iKk----------------gq~~s~~e~~~a~eki~~~Gn~~i~lcERG  195 (301)
                      .-=|+.+     .+.| +.++.+...|.+|=--=                ..+.+|++   |.+.+..+|.+ .+..-=|
T Consensus       102 M~DgS~l~~eeNi~~Tk~vv~~Ah~~gv~VEaElG~vgg~ed~~~~~~~~~~~T~pee---a~~Fv~~TgvD-~LAvaiG  177 (284)
T PRK09195        102 MIDGSHLPFAQNISLVKEVVDFCHRFDVSVEAELGRLGGQEDDLQVDEKDALYTDPAQ---AREFVEATGID-SLAVAIG  177 (284)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHH---HHHHHHHHCCC-EEEEEEC
T ss_conf             8638989999999999999999987288189974001565778776663235689999---99999975998-8986506


Q ss_pred             CCCC-CHH-HCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             5444-010-0000001068885-1871687117774212234532126388999999999971898899983
Q gi|254780669|r  196 TSFG-YNT-LVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       196 ~~fg-y~~-lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      +..| |.. --.||--+..+++ .+.|.++--+-            |=.    ...-+.|+..|+.=+=+-|
T Consensus       178 t~HG~yk~~p~L~~~~L~~I~~~~~vPLVLHGgS------------G~~----~e~i~~ai~~Gv~KiNi~T  233 (284)
T PRK09195        178 TAHGMYKSAPKLDFDRLENIRQWVNIPLVLHGAS------------GLP----TKDIQQTIKLGICKVNVAT  233 (284)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHCCCEEEECCC------------CCC----HHHHHHHHHCCCEEEEECH
T ss_conf             5455558988459999999999749998987899------------989----9999999984976998685


No 275
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT,  Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein 
Probab=41.48  E-value=29  Score=16.05  Aligned_cols=114  Identities=19%  Similarity=0.245  Sum_probs=60.8

Q ss_pred             HHHHHHHHHHHHCCEEEEECCCHHHHHH-HHHH-----CCEEEECHHHCCCHHHHHHHHHCC-CEEEEE--C-CCCCCHH
Q ss_conf             8889998866528768852288999987-6502-----157882257628999999985059-779983--6-7778999
Q gi|254780669|r  103 GREIFRDLKKKYGFPILTDVHTEQQCEA-IADS-----VDILQIPALLCRQTDLLTAAAQTG-RVINVK--K-GQFLSPW  172 (301)
Q Consensus       103 gL~il~e~k~~~glpv~TeV~~~~~~e~-~~~~-----vDilQIgA~~~rqtdLl~a~a~t~-kpV~iK--k-gq~~s~~  172 (301)
                      --+.=+++++.+|..-..=|..-..+-. +...     =|-+=+||+.|--|-  .++...| +||.+-  . ...++++
T Consensus        20 v~~fE~~~~~~~g~k~~v~~~sgt~Al~lal~~l~~~~gdeVi~p~~t~~at~--~ai~~~G~~pv~~Di~~~t~~id~~   97 (352)
T cd00616          20 VREFEKAFAEYLGVKYAVAVSSGTAALHLALRALGIGPGDEVIVPSFTFVATA--NAILLLGATPVFVDIDPDTYNIDPE   97 (352)
T ss_pred             HHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHCCCCCCCEEEECCCCCHHHH--HHHHHCCCEEEEEECCCCCCCCCHH
T ss_conf             99999999999785939997688999999999869788399998997639899--9999859989984077785775889


Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH-HHHCCCEEECHHHHH
Q ss_conf             99999999972587808995146544401000000010688-851871687117774
Q gi|254780669|r  173 EMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM-TSMGVPVIFDASHSV  228 (301)
Q Consensus       173 e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l-k~~~~PVi~D~SHs~  228 (301)
                      +...+   + ..--+-|++++   .||+.   .|+..+..+ ++.++|||-|+.||.
T Consensus        98 ~l~~~---i-~~~tkaIi~vh---~~G~~---~d~~~i~~~~~~~~i~lIeDaA~a~  144 (352)
T cd00616          98 LIEAA---I-TPRTKAIIPVH---LYGNP---ADMDAIMAIAKRHGLPVIEDAAQAL  144 (352)
T ss_pred             HHHHH---C-CCCCCEEEEEC---CCCCC---CCHHHHHHHHHHCCCEEEEHHHHHC
T ss_conf             99976---2-86870999968---98986---6889999999977989980220021


No 276
>pfam02679 ComA (2R)-phospho-3-sulfolactate synthase (ComA). In methanobacteria (2R)-phospho-3-sulfolactate synthase (ComA) catalyses the first step of the biosynthesis of coenzyme M from phosphoenolpyruvate (P-enolpyruvate). This novel enzyme catalyses the stereospecific Michael addition of sulfite to P-enolpyruvate, forming L-2-phospho-3-sulfolactate (PSL). It is suggested that the ComA-catalysed reaction is analogous to those reactions catalysed by beta-elimination enzymes that proceed through an enolate intermediate.
Probab=41.13  E-value=29  Score=16.02  Aligned_cols=28  Identities=25%  Similarity=0.321  Sum_probs=22.4

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             7789999999999997258780899514
Q gi|254780669|r  167 QFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       167 q~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      .-.++.+|+.-+++.++.|...||+=-|
T Consensus       143 ~~~~~~~~I~~~~~~LeaGA~~ViiEar  170 (245)
T pfam02679       143 SELTPDELIEQIERDLEAGADKVIIEAR  170 (245)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             5679999999999999769828998510


No 277
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional
Probab=41.05  E-value=29  Score=16.01  Aligned_cols=123  Identities=15%  Similarity=0.123  Sum_probs=62.3

Q ss_pred             HHHHHHHCCEEEEECCCHHHHH-----HHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9886652876885228899998-----76502157882257628999999985059779983677789999999999997
Q gi|254780669|r  108 RDLKKKYGFPILTDVHTEQQCE-----AIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLH  182 (301)
Q Consensus       108 ~e~k~~~glpv~TeV~~~~~~e-----~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~  182 (301)
                      +++.+-+|-+-.-=...-.++.     .+..--|++=.-.. + .-.+++.+--++-.  +++-.+.+++++....++..
T Consensus        94 ~~lA~~~g~e~allf~SGy~aN~~~i~aL~~~~d~i~~D~l-~-HaSiidG~~ls~a~--~~~f~HnD~~~Le~~L~~~~  169 (395)
T PRK06939         94 QKLAKFLGTEDAILYSSCFDANGGLFETLLGKEDAIISDAL-N-HASIIDGVRLCKAK--RYRYANNDMADLEAQLKEAK  169 (395)
T ss_pred             HHHHHHHCCCCEEEECCHHHHHHHHHHHHCCCCCEEEEECC-C-CHHHHHHHHHCCCC--EEEECCCCHHHHHHHHHHHH
T ss_conf             99999869994999755277678899996479988998456-3-58899999865894--79966899999999999600


Q ss_pred             HCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCC
Q ss_conf             258780899514654440100000001068885-18716871177742122345
Q gi|254780669|r  183 AHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHG  235 (301)
Q Consensus       183 ~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~  235 (301)
                      ..+.++++++--|+.--.++ +.|+..+..+++ ++.-+++|=.||+=-.|..|
T Consensus       170 ~~~~~~~~ivtegVfSMdGD-iapL~~l~~L~~~y~a~L~vDeAH~~GvlG~~G  222 (395)
T PRK06939        170 EAGARHKLIATDGVFSMDGD-IANLPEICDLADKYDALVMVDDSHAVGFLGENG  222 (395)
T ss_pred             HCCCCEEEEEEECCCCCCCC-CCCHHHHHHHHHHHCEEEEEECCCCEEEECCCC
T ss_conf             21586289999667777876-015999999999727379861430000345899


No 278
>TIGR02707 butyr_kinase butyrate kinase; InterPro: IPR011245   This group represents bacterial butyrate kinase, an enzyme that facilitates the formation of butyryl-CoA by phosphorylating butyrate in the presence of ATP to form butyryl phosphate . The final steps in butyrate synthesis by anaerobic bacteria can occur via butyrate kinase and phosphotransbutyrylase or via butyryl-CoA:acetate CoA-transferase, the latter providing the dominant route for butyrate formation in human colonic bacteria .; GO: 0005524 ATP binding, 0047761 butyrate kinase activity, 0016310 phosphorylation, 0005737 cytoplasm.
Probab=41.00  E-value=14  Score=18.17  Aligned_cols=129  Identities=20%  Similarity=0.215  Sum_probs=77.6

Q ss_pred             HHHHHHHHHHHHC-------CCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHH--HH
Q ss_conf             9999999965533-------99706601557688666322245671248889998866528768852288999987--65
Q gi|254780669|r   62 MIAEKLYAICQSL-------NIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEA--IA  132 (301)
Q Consensus        62 ~~A~~lk~~~~~~-------~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~--~~  132 (301)
                      -+.+.|++.|-++       .|||--||     --+=.|---    ++   ||+.+|+...      =-+++-+-.  +.
T Consensus        51 ~i~~~L~e~Gi~~~~l~AvVgRGGLLkP-----i~GGTY~Vn----~~---MleDLk~~~~------GeHASNLGaIIA~  112 (353)
T TIGR02707        51 VILEVLEEKGINISKLDAVVGRGGLLKP-----IEGGTYLVN----EK---MLEDLKEGKR------GEHASNLGAIIAR  112 (353)
T ss_pred             HHHHHHHHCCCCHHHEEEEEECCCCCCC-----CCCCEEEEC----HH---HHHHHHHCCC------CCCCCCHHHHHHH
T ss_conf             9999987408871243157972770233-----389604776----55---6888851058------8784336899999


Q ss_pred             HHCCEEE-ECHHHCCCH--HHHHHHHH-CCCEEEEECCCCCCHHHHHHHHHHHHHCCCC-----CEEEEECC--CCCCCH
Q ss_conf             0215788-225762899--99999850-5977998367778999999999999725878-----08995146--544401
Q gi|254780669|r  133 DSVDILQ-IPALLCRQT--DLLTAAAQ-TGRVINVKKGQFLSPWEMHNILQKLHAHGAK-----DVLFCERG--TSFGYN  201 (301)
Q Consensus       133 ~~vDilQ-IgA~~~rqt--dLl~a~a~-t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~-----~i~lcERG--~~fgy~  201 (301)
                      +.+|=+- ||||-.-==  |=|+.+|| ||-|-.=||.+|..++. +-++.|++..-|+     |+++||=|  +|-|=+
T Consensus       113 ~lA~~~~diPafIVDPVVVDEledvARISG~P~i~RkSIfHALNq-KAvARr~A~e~gK~YE~~N~ivaHlGGGISvaAH  191 (353)
T TIGR02707       113 ELADELNDIPAFIVDPVVVDELEDVARISGLPEIERKSIFHALNQ-KAVARRIAKELGKRYEEMNLIVAHLGGGISVAAH  191 (353)
T ss_pred             HHHHHCCCCCEEEECCCEECCCCCHHHHCCCCCCCCEEHHHHHHH-HHHHHHHHHHCCCCCCCCCEEEEECCCCCEEEEE
T ss_conf             987651894358826833505510132138898641104444338-8999999997289600445489982887034145


Q ss_pred             H--HCCCCCC
Q ss_conf             0--0000001
Q gi|254780669|r  202 T--LVTDMRS  209 (301)
Q Consensus       202 ~--lvvD~~~  209 (301)
                      +  .++|..|
T Consensus       192 ~~Gr~vDVNN  201 (353)
T TIGR02707       192 RKGRVVDVNN  201 (353)
T ss_pred             CCCCEEEEEC
T ss_conf             4861799734


No 279
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=40.89  E-value=30  Score=15.99  Aligned_cols=88  Identities=17%  Similarity=0.352  Sum_probs=55.1

Q ss_pred             HHHHHHHHH-CCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             999886652-87688522889999876502-1578822576289999999850597799836777899999999999972
Q gi|254780669|r  106 IFRDLKKKY-GFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHA  183 (301)
Q Consensus       106 il~e~k~~~-glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~  183 (301)
                      .++.+|+.. ..+|.-||.+.+|++++.+. +|++|.--                          ++|+++..+++++..
T Consensus       188 ai~~~r~~~~~~kIeVEv~sl~q~~ea~~~gaDiImLDN--------------------------ms~e~~~~av~~~~~  241 (288)
T PRK07896        188 ALRAVRAAAPDLPCEVEVDSLEQLDEVLAEGAELILLDN--------------------------FPVWQTQEAVQRRDA  241 (288)
T ss_pred             HHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEEEECC--------------------------CCHHHHHHHHHHHHC
T ss_conf             999999858996199997979999998746999999779--------------------------999999999999837


Q ss_pred             CCCCCEEEEECCCCCCCHHHCCCCCCCHHHHHHCCC--EEECHHHHH
Q ss_conf             587808995146544401000000010688851871--687117774
Q gi|254780669|r  184 HGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP--VIFDASHSV  228 (301)
Q Consensus       184 ~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~~~~P--Vi~D~SHs~  228 (301)
                      .. +++.+-=-|-        +.+.++....+++.-  .+-..|||.
T Consensus       242 ~~-~~v~lEaSGg--------I~~~ni~~yA~tGVD~IS~G~LThs~  279 (288)
T PRK07896        242 RA-PTVLLESSGG--------LTLDTAAAYAATGVDYLAVGALTHSV  279 (288)
T ss_pred             CC-CCEEEEEECC--------CCHHHHHHHHHCCCCEEECCHHHCCC
T ss_conf             69-8748999889--------99999999996599999878532699


No 280
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism]
Probab=40.76  E-value=30  Score=15.98  Aligned_cols=24  Identities=21%  Similarity=0.354  Sum_probs=12.7

Q ss_pred             CHHHHHHHHHHHHHHCCEEEEECC
Q ss_conf             124888999886652876885228
Q gi|254780669|r  100 LKKGREIFRDLKKKYGFPILTDVH  123 (301)
Q Consensus       100 le~gL~il~e~k~~~glpv~TeV~  123 (301)
                      +++-+..-+.+.+-.++||+.|+-
T Consensus        63 ~~e~~~~vrrI~~a~~lPv~vD~d   86 (289)
T COG2513          63 LDEVLADARRITDAVDLPVLVDID   86 (289)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999998652787688656


No 281
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated
Probab=40.39  E-value=30  Score=15.94  Aligned_cols=68  Identities=16%  Similarity=0.219  Sum_probs=36.2

Q ss_pred             HHHHHHHHHHHHCCEEE-EECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHHC-CCEEEEECCCCCCH
Q ss_conf             88899988665287688-522889999876-502157882-----25762899999998505-97799836777899
Q gi|254780669|r  103 GREIFRDLKKKYGFPIL-TDVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQT-GRVINVKKGQFLSP  171 (301)
Q Consensus       103 gL~il~e~k~~~glpv~-TeV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~t-~kpV~iKkgq~~s~  171 (301)
                      ...++.+.-.++|+.+. .|..+.+.++.. .+...++++     |.+-+.+-+-+.++++. |.++.+-+ -|+||
T Consensus       116 T~~l~~~~l~~~Gi~~~~vd~~d~~~~~~~i~~~Tklv~~EspsNP~l~v~Di~aia~iA~~~g~~~vVDN-T~atP  191 (433)
T PRK08134        116 SHNLLHYTLPRFGIETTFVKPRDIDGWRAAIRPNTRLLFGETLGNPGLEVLDIPTVAAIAHEAGVPLLVDS-TFTTP  191 (433)
T ss_pred             HHHHHHHHHHHCCEEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEEC-CCCHH
T ss_conf             79999987763483799988978467887559875289985389997503589999999975676199716-65115


No 282
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed
Probab=40.16  E-value=30  Score=15.92  Aligned_cols=52  Identities=23%  Similarity=0.365  Sum_probs=26.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEC
Q ss_conf             63499999999999999965533997066015576886663222456712488899988665287688522
Q gi|254780669|r   52 CQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDV  122 (301)
Q Consensus        52 CsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV  122 (301)
                      +=+.+.++++++++.+...-      ..||-.+        .-|--.|    .+++++++ +.|+++.-|.
T Consensus         9 lD~~~~~~~~~l~~~l~~~i------~~~Kig~--------~l~~~~G----~~~i~~l~-~~g~~iFlDl   60 (231)
T PRK00230          9 LDFPSKEEALAFLDQLDPAV------LFVKVGM--------ELFTAGG----PQFVRELK-QRGFKVFLDL   60 (231)
T ss_pred             ECCCCHHHHHHHHHHHCCCC------CEEEECH--------HHHHHCC----HHHHHHHH-HCCCCEEEEE
T ss_conf             64899999999999717755------2999898--------9986418----99999999-7799689872


No 283
>TIGR01496 DHPS dihydropteroate synthase; InterPro: IPR006390   This domain is present in sequences representing dihydropteroate synthase, the enzyme that catalyzes the second to last step in folic acid biosynthesis.   Dihydropteroate synthase (2.5.1.15 from EC) (DHPS) catalyses the condensation of 6-hydroxymethyl-7,8-dihydropteridine pyrophosphate to para-aminobenzoic acid to form 7,8-dihydropteroate. This is the second step in the three-step pathway leading from 6-hydroxymethyl-7,8-dihydropterin to 7,8-dihydrofolate. DHPS is the target of sulphonamides, which are substrate analogues that compete with para-aminobenzoic acid. Bacterial DHPS (gene sul or folP)  is a protein of about 275 to 315 amino acid residues that is either chromosomally encoded or found on various antibiotic resistance plasmids. In the lower eukaryote Pneumocystis carinii, DHPS is the C-terminal domain of a multifunctional folate synthesis enzyme (gene fas) .; GO: 0004156 dihydropteroate synthase activity, 0009396 folic acid and derivative biosynthetic process.
Probab=40.02  E-value=31  Score=15.90  Aligned_cols=215  Identities=19%  Similarity=0.272  Sum_probs=135.2

Q ss_pred             CEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHC-CCCEEEECCCCCCCCCCCCCCCCCC---CH
Q ss_conf             7068357877279769970699954863499999999999999965533-9970660155768866632224567---12
Q gi|254780669|r   26 AAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVG---LK  101 (301)
Q Consensus        26 ~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~-~~~~ifK~sfdKanRtS~~sfrG~G---le  101 (301)
                      +++|+.+.    .|+.+.++         -+.+.+++-|+++-+-|+++ .+||.         =|.|.+-.-.-   ++
T Consensus         4 GIlNvTPD----SFsDgG~~---------~~~~~A~~~a~~m~~~GA~IiDiGGe---------STRPG~~~vs~~eE~~   61 (268)
T TIGR01496         4 GILNVTPD----SFSDGGRF---------LSVDKALEHAERMLEEGADIIDIGGE---------STRPGADRVSPEEELN   61 (268)
T ss_pred             EEEECCCC----CCCCCCCC---------CCHHHHHHHHHHHHHCCCCEEEECCC---------CCCCCCCCCCHHHHHH
T ss_conf             88855877----54788766---------67789999999999739988965770---------5797698789799999


Q ss_pred             HHHHHHHHHHHHH---C--CEEEEECCCHHHHHHH-HH-HCCEEE-ECHHHCCCHHHHHHHHHCCCEEEEECCC------
Q ss_conf             4888999886652---8--7688522889999876-50-215788-2257628999999985059779983677------
Q gi|254780669|r  102 KGREIFRDLKKKY---G--FPILTDVHTEQQCEAI-AD-SVDILQ-IPALLCRQTDLLTAAAQTGRVINVKKGQ------  167 (301)
Q Consensus       102 ~gL~il~e~k~~~---g--lpv~TeV~~~~~~e~~-~~-~vDilQ-IgA~~~rqtdLl~a~a~t~kpV~iKkgq------  167 (301)
                      -=+..++++++++   +  +||=-|=..++-++.+ .. .+|||= |-++ -...++++-+++.+.|+.|=.-+      
T Consensus        62 Rv~Pv~~~~~~~~~~~dQC~~iSvDT~~a~Va~~Al~~~Ga~iiNDv~G~-~~dp~m~~vaae~~~~~vlMH~~g~P~~~  140 (268)
T TIGR01496        62 RVVPVIKALREQYLFSDQCVPISVDTYRAEVARAALEAFGADIINDVSGG-QFDPDMLEVAAEYGVPLVLMHMRGTPETM  140 (268)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHCCCCEEEECCCC-CCCHHHHHHHHHHCCCEEEECCCCCCCCC
T ss_conf             88999999997448999841477618828999999986798678604114-66835899999848988987687638876


Q ss_pred             -CCC----H-HH----HHHHHHHHHHCCCC-CEEEEECCCCCCC--H--HHCCCCCCCHHHHH-HCCCEEECHHHHHHHC
Q ss_conf             -789----9-99----99999999725878-0899514654440--1--00000001068885-1871687117774212
Q gi|254780669|r  168 -FLS----P-WE----MHNILQKLHAHGAK-DVLFCERGTSFGY--N--TLVTDMRSIPIMTS-MGVPVIFDASHSVQQP  231 (301)
Q Consensus       168 -~~s----~-~e----~~~a~eki~~~Gn~-~i~lcERG~~fgy--~--~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p  231 (301)
                       ...    + +|    +..-++.+...|-. +||| .=|+-|+=  .  +..-=|++++.+++ +++||.+=.|==-..-
T Consensus       141 q~~~~Y~dv~~e~~~fl~~~~~~~~~~Gv~~~I~L-DPG~GF~K~~t~~~Nl~ll~~l~~f~~~lg~PlL~G~SRK~fiG  219 (268)
T TIGR01496       141 QENPRYEDVVEEVLRFLEARAEELLAAGVAERIIL-DPGIGFGKSDTVEHNLELLKRLEEFKAVLGYPLLVGVSRKSFIG  219 (268)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEE-CCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEECCCHHHHH
T ss_conf             66777656689999999999999997588665787-17757788888767899998689999985770212011046888


Q ss_pred             CCCC--CCCCCCHHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             2345--3212638899999999997189889998369
Q gi|254780669|r  232 GIHG--NCSGGERQYIVPLAKAAVAIGIAGIFLETHQ  266 (301)
Q Consensus       232 ~~~~--~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp  266 (301)
                      .-.|  .....|-.=--.++-.|+..|++.  +=||.
T Consensus       220 ~~~gg~~~~~~R~~Gt~a~~~~a~~~Ga~i--vRVHD  254 (268)
T TIGR01496       220 ALLGGETPPEERLEGTLAASAYAVQKGADI--VRVHD  254 (268)
T ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHCCCCE--EEECC
T ss_conf             651678897564268899999998679867--98538


No 284
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins. The type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins, some of which contain a conserved catalytic serine/threonine protein kinase (STKc) domain in the N-terminal region. Members of this group are sequence-similar to the branched-chain amino acid ABC transporter leucine-isoleucine-valine-binding protein (LIVBP); their ligand specificity has not been determined experimentally, however.
Probab=39.99  E-value=31  Score=15.90  Aligned_cols=15  Identities=7%  Similarity=-0.033  Sum_probs=5.2

Q ss_pred             HHHHHHHHHCCEEEE
Q ss_conf             999886652876885
Q gi|254780669|r  106 IFRDLKKKYGFPILT  120 (301)
Q Consensus       106 il~e~k~~~glpv~T  120 (301)
                      .+++.-++.|+.++.
T Consensus       155 ~~~~~~~~~G~~vv~  169 (336)
T cd06326         155 GVEKALAARGLKPVA  169 (336)
T ss_pred             HHHHHHHHCCCCEEE
T ss_conf             999999977993799


No 285
>TIGR03012 sulf_tusD_dsrE sulfur relay protein TusD/DsrE. The three proteins TusB, TusC, and TusD form a heterohexamer responsible for a sulfur relay reaction. In large numbers of proteobacterial species, this complex acts on a Cys-derived persulfide moiety, delivered by the cysteine desulfurase IscS to TusA, then to TusBCD. The activated sulfur group is then transferred to TusE (DsrC), then by MnmA (TrmU) for modification of an anticodon nucleotide in tRNAs for Glu, Lys, and Gln. The sulfur relay complex TusBCD is also found, under the designation DsrEFH, in phototrophic and chemotrophic sulfur bacteria, such as Chromatium vinosum. In these organisms, it seems the primary purpose is related to sulfur flux, such as oxidation from sulfide to molecular sulfur to sulfate.
Probab=39.77  E-value=31  Score=15.88  Aligned_cols=114  Identities=17%  Similarity=0.170  Sum_probs=74.3

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCC-CCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEC-
Q ss_conf             699954863499999999999999965533997066015576886-663222456712488899988665287688522-
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR-SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDV-  122 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanR-tS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV-  122 (301)
                      +++.++|-+-++-..++..|+.+.+.|-++.+=+-|--.---||+ .+|-+..    -.-..-|+++.++++++++.=| 
T Consensus         4 l~V~~~py~~q~a~~A~~FA~A~l~~GH~I~~VFFy~DGV~~An~~~~p~~DE----~nl~~~W~~La~~~~v~L~vCva   79 (127)
T TIGR03012         4 LLVTGPPYGTQAASSAYQFAQALLAKGHEIVRVFFYQDGVLNANNLVSPASDE----FDLVAAWQQLAQEHQVDLVVCVA   79 (127)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEEEEHHHHHHHHCCCCCCCCC----HHHHHHHHHHHHHCCCEEEEEHH
T ss_conf             99946998757799999999999988994779998206778876477787640----57999999999852985997488


Q ss_pred             -------CCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEE
Q ss_conf             -------8899998765021578822576289999999850597799
Q gi|254780669|r  123 -------HTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN  162 (301)
Q Consensus       123 -------~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~  162 (301)
                             .+.++++...-..+-|.=|-.++==-+|.+++..++|.|-
T Consensus        80 aA~rRGv~d~~ea~~~~~~~~nl~~~F~l~GLGeL~ea~~~sDRvi~  126 (127)
T TIGR03012        80 AALRRGVVDEEEASRLQIKHGNLAPGFELSGLGELAEAALTADRLVQ  126 (127)
T ss_pred             HHHHCCCCCHHHHHHHCCCCCCCCCCCEECCHHHHHHHHHHCCEEEE
T ss_conf             89862898678888734442235888587069999999984793660


No 286
>PRK05937 8-amino-7-oxononanoate synthase; Provisional
Probab=39.32  E-value=31  Score=15.84  Aligned_cols=110  Identities=15%  Similarity=0.118  Sum_probs=60.3

Q ss_pred             HHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHH-HHCCCEEECHHHH
Q ss_conf             999998505977998367778999999999999725878089951465444010000000106888-5187168711777
Q gi|254780669|r  149 DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT-SMGVPVIFDASHS  227 (301)
Q Consensus       149 dLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk-~~~~PVi~D~SHs  227 (301)
                      .+++.+.-++..+.  +=.+.++++.....++....+..++|++--|..--.++ +.|+..+..++ +++.-+++|-.||
T Consensus       107 Si~dG~rls~a~~~--~f~Hnd~~~Le~~L~~~~~~~~~~~~iv~egVfSMdGd-iapL~~l~~l~~~y~a~l~vDeAH~  183 (370)
T PRK05937        107 SVVYSLSVISGKHQ--SFRHNDLDHLESLLESCRAVSFGRIFIFVCSVYSFKGT-LAPLEQIIALSKKYHAHLIVDEAHA  183 (370)
T ss_pred             HHHHHHHHCCCCEE--EECCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCC-CCCHHHHHHHHHHCCCEEEEECCHH
T ss_conf             99999986499869--96899989999999853311788559999405667787-5589999999998197899733000


Q ss_pred             HHHCCCCCCC---CCCCHH---HHHHHHHHHHHHCCCEEEEEE
Q ss_conf             4212234532---126388---999999999971898899983
Q gi|254780669|r  228 VQQPGIHGNC---SGGERQ---YIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       228 ~q~p~~~~~~---~gG~r~---~v~~la~aa~a~G~dGlfiE~  264 (301)
                      +=-.|..|.-   .-|..+   .+-+++   .|+|.-|=|+=.
T Consensus       184 ~Gv~G~~GrG~~e~~g~~~~~~i~~Tls---KAlGs~Ggfv~~  223 (370)
T PRK05937        184 MGIFGDDGKGFCHSLGYENFYAVLVTYS---KALGSMGAALLS  223 (370)
T ss_pred             CCCCCCCCCCHHHHCCCCCCCEEEEEHH---HHHHHCCEEEEC
T ss_conf             0433799975788739988778981325---662106538982


No 287
>TIGR00519 asnASE_I L-asparaginases, type I; InterPro: IPR006033    Two related families of asparaginase are designated type I and type II according to the terminology in Escherichia coli, which has both: L-asparaginase I is a low-affinity enzyme found in the cytoplasm, while L-asparaginase II is a high-affinity secreted enzyme synthesized with a cleavable signal sequence. This family includes L-asparaginases related to type I of E. coli. Archaeal putative asparaginases are of this type but contain an extra ~80 residues in a conserved N-terminal region. These archaeal homologs are included in this family. ; GO: 0004067 asparaginase activity, 0006520 amino acid metabolic process.
Probab=39.30  E-value=31  Score=15.83  Aligned_cols=29  Identities=28%  Similarity=0.312  Sum_probs=13.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             779983677789999999999997258780899
Q gi|254780669|r  159 RVINVKKGQFLSPWEMHNILQKLHAHGAKDVLF  191 (301)
Q Consensus       159 kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~l  191 (301)
                      +..+||=-+++|++    ++++..+.|-+-++|
T Consensus       221 ~V~lik~yPGl~~d----i~~~~~~~~YkGiVi  249 (347)
T TIGR00519       221 KVALIKLYPGLSPD----IIRAYLSKGYKGIVI  249 (347)
T ss_pred             CEEEEEECCCCCHH----HHHHHCCCCCEEEEE
T ss_conf             14899866898889----999862699348998


No 288
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]
Probab=39.22  E-value=31  Score=15.82  Aligned_cols=44  Identities=25%  Similarity=0.419  Sum_probs=18.6

Q ss_pred             CCHHHHHHHHHHHHHHCCEEE-EECCCHHHHHH-HHHHCC---EEEECH
Q ss_conf             712488899988665287688-52288999987-650215---788225
Q gi|254780669|r   99 GLKKGREIFRDLKKKYGFPIL-TDVHTEQQCEA-IADSVD---ILQIPA  142 (301)
Q Consensus        99 Gle~gL~il~e~k~~~glpv~-TeV~~~~~~e~-~~~~vD---ilQIgA  142 (301)
                      |+.....-.-++-+.+|.-++ -|-.-.-|-|. +.+.+|   ++.+|.
T Consensus       127 GlS~at~~~i~~ldAaG~DvIIVETVGvGQsev~I~~~aDt~~~v~~pg  175 (323)
T COG1703         127 GLSRATREAIKLLDAAGYDVIIVETVGVGQSEVDIANMADTFLVVMIPG  175 (323)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHCCEEEEEECCC
T ss_conf             1668899999999861898899981478841557765216689996578


No 289
>KOG2971 consensus
Probab=38.87  E-value=11  Score=18.88  Aligned_cols=36  Identities=11%  Similarity=0.128  Sum_probs=16.1

Q ss_pred             EEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHH
Q ss_conf             7882257628999999985059779983677789999
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWE  173 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e  173 (301)
                      .+-||-|.|.|.=.+-+ |.-+-|++.+++++.||.-
T Consensus       220 L~EiGPRfvl~~ikif~-gsFgG~~lYenp~yvspn~  255 (299)
T KOG2971         220 LIEIGPRFVLNVIKIFE-GSFGGPTLYENPKYVSPNM  255 (299)
T ss_pred             EEEECCHHHHHHHHHHH-CCCCCCEEECCCCCCCHHH
T ss_conf             04645388886999974-4578960212865458889


No 290
>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases. The enzyme catalyses the zinc-dependent, reversible aldol condensation of dihydroxyacetone phosphate with glyceraldehyde-3-phosphate to form fructose-1,6-bisphosphate. FBP aldolase is homodimeric and used in gluconeogenesis and glycolysis. The type A and type B Class II FBPA's differ in the presence and absence of distinct indels in the sequence that result in differing loop lengths in the structures.
Probab=38.66  E-value=19  Score=17.28  Aligned_cols=34  Identities=15%  Similarity=0.272  Sum_probs=21.6

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC-C
Q ss_conf             778999999999999725878089951465444-0
Q gi|254780669|r  167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFG-Y  200 (301)
Q Consensus       167 q~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg-y  200 (301)
                      .+-.|++....++.+.....-+.+.+-=||+.| |
T Consensus       181 ~yT~Peea~~f~~~~~~~tgvd~LAvaiGt~HG~Y  215 (345)
T cd00946         181 LYTQPEDVWYVYEALSKISPNFSIAAAFGNVHGVY  215 (345)
T ss_pred             CCCCHHHHHHHHHHHCCCCCCCEEEEEECCCCCCC
T ss_conf             27999999999999636777605655311245434


No 291
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. This subgroup includes the type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. Members of this subgroup are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine-binding protein (LIVBP); their ligand specificity has not been determined experimentally, however.
Probab=38.56  E-value=32  Score=15.76  Aligned_cols=20  Identities=30%  Similarity=0.434  Sum_probs=9.4

Q ss_pred             HHHHHHHHHCCCCCEEEEEC
Q ss_conf             99999997258780899514
Q gi|254780669|r  175 HNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       175 ~~a~eki~~~Gn~~i~lcER  194 (301)
                      ...++++...|.++|.+..-
T Consensus       122 ~~~~~~~~~~g~kkvail~~  141 (312)
T cd06333         122 EAILADMKKRGVKTVAFIGF  141 (312)
T ss_pred             HHHHHHHHHCCCCEEEEEEC
T ss_conf             99999999739988999961


No 292
>PRK08123 histidinol-phosphatase; Reviewed
Probab=38.53  E-value=32  Score=15.76  Aligned_cols=12  Identities=25%  Similarity=0.872  Sum_probs=5.6

Q ss_pred             CHHHHHHCCCEE
Q ss_conf             068885187168
Q gi|254780669|r  210 IPIMTSMGVPVI  221 (301)
Q Consensus       210 i~~lk~~~~PVi  221 (301)
                      +...++.+.|++
T Consensus       232 l~~~~~~G~~i~  243 (266)
T PRK08123        232 ITLAKKLGIPLV  243 (266)
T ss_pred             HHHHHHCCCEEE
T ss_conf             999998699199


No 293
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated
Probab=38.47  E-value=32  Score=15.75  Aligned_cols=208  Identities=18%  Similarity=0.139  Sum_probs=102.4

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCC-CEEEEC---CCCCCCCCCCCCCCCCCCHHHHHHH------HHHHHHH
Q ss_conf             69995486349999999999999996553399-706601---5576886663222456712488899------9886652
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNI-GLVYKS---SFDKANRSSLAGKRGVGLKKGREIF------RDLKKKY  114 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~-~~ifK~---sfdKanRtS~~sfrG~Gle~gL~il------~e~k~~~  114 (301)
                      -+.|.|+-..|||-.+-.+.+..++.+.+..- ||=|=+   .|-++....--.|=|+.- +.++.+      +++-++.
T Consensus        48 ~v~ig~~~~~~sYln~~~Ii~~A~~~g~dAIHPGYGFLSEna~FA~~~~~~gi~fIGP~~-~~i~~~GdK~~ar~~a~~~  126 (449)
T PRK06111         48 AYLIGGPRVQESYLNLEKIIEIAKKTGAEAIHPGYGLLSENASFAERCKEEGIVFIGPSA-EIIAKMGSKIEARRAMQAA  126 (449)
T ss_pred             EEEECCCCHHHHHCCHHHHHHHHHHHCCCEEECCCCCCCCCHHHHHHHHHCCCEEECCCH-HHHHHHHCHHHHHHHHHHC
T ss_conf             888089974543339999999999839999977987311698999999988998999299-9999864869999999983


Q ss_pred             CCEEEEECCCHHHHHHHHHHCCEEEECHHHCCC-HHHHHHHHHCCCEEEEECCC---------CCCHHHHHHHHH-----
Q ss_conf             876885228899998765021578822576289-99999985059779983677---------789999999999-----
Q gi|254780669|r  115 GFPILTDVHTEQQCEAIADSVDILQIPALLCRQ-TDLLTAAAQTGRVINVKKGQ---------FLSPWEMHNILQ-----  179 (301)
Q Consensus       115 glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rq-tdLl~a~a~t~kpV~iKkgq---------~~s~~e~~~a~e-----  179 (301)
                      |+|++--...+                   .++ -++++.+.+.|-||+||--.         --+.+|+..+.+     
T Consensus       127 gvPvvPG~~~~-------------------~~~~~ea~~~a~~iGyPvliKAa~GGGGrGmriv~~~~el~~~~~~~~~e  187 (449)
T PRK06111        127 GVPVVPGITTA-------------------LEDAEEAIAIARQIGYPVMLKASAGGGGIGMQLVETEQELTKAFESNKKR  187 (449)
T ss_pred             CCCCCCCCCCC-------------------CCCHHHHHHHHHHCCCCEEEEECCCCCCCCEEEECCHHHHHHHHHHHHHH
T ss_conf             99855786777-------------------89999999999865980266203589867208957999999999999999


Q ss_pred             HHHHCCCCCEEEEECCCCCCCHH---HCCCC-CCCHHH-------HHHCCCEE-ECHHHHHHHCCCCCCCCCCCHHHHHH
Q ss_conf             99725878089951465444010---00000-010688-------85187168-71177742122345321263889999
Q gi|254780669|r  180 KLHAHGAKDVLFCERGTSFGYNT---LVTDM-RSIPIM-------TSMGVPVI-FDASHSVQQPGIHGNCSGGERQYIVP  247 (301)
Q Consensus       180 ki~~~Gn~~i~lcERG~~fgy~~---lvvD~-~~i~~l-------k~~~~PVi-~D~SHs~q~p~~~~~~~gG~r~~v~~  247 (301)
                      -..++||..|+ .||=..-+.+-   .+-|- -++.++       ++.+-.|| .-|+-.+        ...-+.++...
T Consensus       188 A~~~Fg~~~v~-iEk~i~~~RHIEVQvl~D~~Gn~vhlgeRdCSiQRr~QKviEeaPap~l--------~~~~r~~~~~~  258 (449)
T PRK06111        188 AANFFGNGEMY-LEKYIEDARHIEIQLLADTHGNTVYLWERECSVQRRHQKVIEEAPSPFL--------DEETRKAMGEA  258 (449)
T ss_pred             HHHHCCCCCEE-EEEECCCCCEEEEEEEECCCCCEEEEECCCCCCCCCCCCEEEECCCCCC--------CHHHHHHHHHH
T ss_conf             99863996025-5441357733799999706888888305122663577416997899999--------99999999999


Q ss_pred             HHHHHHHHCCCE--------------EEEEECCC--HHHCCCCCCCCCCH
Q ss_conf             999999718988--------------99983698--33479782018688
Q gi|254780669|r  248 LAKAAVAIGIAG--------------IFLETHQD--PDNAPSDGPNMINI  281 (301)
Q Consensus       248 la~aa~a~G~dG--------------lfiE~Hp~--P~~AlsD~~q~l~l  281 (301)
                      -.+.|.+.|+.|              .|+|+-|.  -++..+-.-+-++|
T Consensus       259 A~~la~~v~Y~g~gTvEFl~d~~~~fyFlEvNtRlQVEHpVTE~vtGiDL  308 (449)
T PRK06111        259 AVQAAKAIGYTNAGTIEFLVDNQKNFYFLEMNTRLQVEHPVTEEITGIDL  308 (449)
T ss_pred             HHHHHHHCCEEEEEEEEEEEECCCCEEEEEEECCCCCCCCEEEEECCCCH
T ss_conf             99998871710246899999489868999534354446640455538848


No 294
>pfam01591 6PF2K 6-phosphofructo-2-kinase. This enzyme occurs as a bifunctional enzyme with fructose-2,6-bisphosphatase. The bifunctional enzyme catalyses both the synthesis and degradation of fructose-2,6-bisphosphate, a potent regulator of glycolysis. This enzyme contains a P-loop motif.
Probab=38.41  E-value=28  Score=16.12  Aligned_cols=39  Identities=33%  Similarity=0.522  Sum_probs=28.3

Q ss_pred             HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             1871687117774212234532126388999999999971898899983698
Q gi|254780669|r  216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD  267 (301)
Q Consensus       216 ~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~  267 (301)
                      -+-=-|+|+|.++.          -+|.++....+   ..|+.=+|+|+-++
T Consensus        96 ~G~VaI~DATN~T~----------~RR~~i~~~~~---~~~~~vlFiEsic~  134 (223)
T pfam01591        96 SGQVAIFDATNTTR----------ERRKNILDFAE---ENGLKVFFLESICD  134 (223)
T ss_pred             CCEEEEEECCCCCH----------HHHHHHHHHHH---HCCCEEEEEEEECC
T ss_conf             98299996887689----------99999999998---66974999999738


No 295
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes. It catalyses the reaction of quinolinic acid (QA) with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg2+ to produce nicotinic acid mononucleotide (NAMN), pyrophosphate and carbon dioxide. QPRTase functions as a homodimer with two active sites, each formed by the C-terminal region of one subunit and the N-terminal region of the other.
Probab=38.41  E-value=32  Score=15.74  Aligned_cols=85  Identities=22%  Similarity=0.315  Sum_probs=54.9

Q ss_pred             HHHHHHHHH--CCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             999886652--87688522889999876502-157882257628999999985059779983677789999999999997
Q gi|254780669|r  106 IFRDLKKKY--GFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLH  182 (301)
Q Consensus       106 il~e~k~~~--glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~  182 (301)
                      .++.+|+..  ..+|..||.+.+|+..+.+. +|++|.--                          ++|+++..+++.+.
T Consensus       171 av~~~r~~~~~~~~IeVEv~s~~e~~~a~~~gadiI~LDn--------------------------~spe~~~~~v~~~~  224 (268)
T cd01572         171 AVRRARAAAPFTLKIEVEVETLEQLKEALEAGADIIMLDN--------------------------MSPEELREAVALLK  224 (268)
T ss_pred             HHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCEEEECC--------------------------CCHHHHHHHHHHHC
T ss_conf             9999998679985299994889999999975999999779--------------------------99999999999866


Q ss_pred             HCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHHHCCC--EEECHHHHH
Q ss_conf             2587808995146544401000000010688851871--687117774
Q gi|254780669|r  183 AHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP--VIFDASHSV  228 (301)
Q Consensus       183 ~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~~~~P--Vi~D~SHs~  228 (301)
                      .    ++.+-=-|-        .+..++....+++.-  ++-.+||+.
T Consensus       225 ~----~v~ieaSGg--------In~~ni~~ya~~GvD~Is~g~lt~~~  260 (268)
T cd01572         225 G----RVLLEASGG--------ITLENIRAYAETGVDYISVGALTHSA  260 (268)
T ss_pred             C----CEEEEEECC--------CCHHHHHHHHHCCCCEEECCHHHCCC
T ss_conf             9----569999899--------98999999997599999838543699


No 296
>PRK04296 thymidine kinase; Provisional
Probab=38.34  E-value=32  Score=15.74  Aligned_cols=45  Identities=16%  Similarity=0.147  Sum_probs=32.2

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCC
Q ss_conf             06999548634999999999999999655339970660155768866632
Q gi|254780669|r   44 RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA   93 (301)
Q Consensus        44 ~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~   93 (301)
                      .|.+|.||=-----..+++.+...+..+.+   -.+|||++|.  |.+.+
T Consensus         3 ~L~~i~GpMfSGKTteLi~~~~~~~~~gkk---vl~~kp~~D~--Ry~~~   47 (197)
T PRK04296          3 KLYFIYGAMNSGKSTELLQRAYNYEERGMK---VLVFTPAIDD--RYGEG   47 (197)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHCCCE---EEEEEECCCC--CCCCC
T ss_conf             599999342788899999999999987995---9999853446--57778


No 297
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism]
Probab=38.30  E-value=24  Score=16.62  Aligned_cols=26  Identities=31%  Similarity=0.630  Sum_probs=20.1

Q ss_pred             CCHHHHHHHHHHHHHHCCEEEEECCCH
Q ss_conf             712488899988665287688522889
Q gi|254780669|r   99 GLKKGREIFRDLKKKYGFPILTDVHTE  125 (301)
Q Consensus        99 Gle~gL~il~e~k~~~glpv~TeV~~~  125 (301)
                      |..++|..++.+ ++|++||+|=|-.+
T Consensus       135 GyRKAlRlm~~A-ekF~lPiitfIDT~  160 (317)
T COG0825         135 GYRKALRLMKLA-EKFGLPIITFIDTP  160 (317)
T ss_pred             HHHHHHHHHHHH-HHHCCCEEEEECCC
T ss_conf             889999999999-98599879995089


No 298
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea. This subfamily of enzymes is adapted for high thermostability and shows specificity for non-phosphorylated substrates. The enzyme catalyses the reversible aldol cleavage of 2-keto-3-dexoygluconate to pyruvate and glyceraldehyde, the third step of a modified non-phosphorylated Entner-Doudoroff pathway of glucose oxidation. KDG aldolase shows no significant sequence similarity to microbial 2-keto-3-deoxyphosphogluconate (KDPG) aldolases, and the enzyme shows no activity with glyceraldehyde 3-phosphate as substrate. The enzyme is a tetramer and a member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=38.01  E-value=33  Score=15.70  Aligned_cols=79  Identities=14%  Similarity=0.163  Sum_probs=42.8

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHH-HHHHHHHHHHCCEEEEECCCHHHHHHHHHH
Q ss_conf             9999999999999965533997066015576886663222456712488-899988665287688522889999876502
Q gi|254780669|r   56 SHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR-EIFRDLKKKYGFPILTDVHTEQQCEAIADS  134 (301)
Q Consensus        56 S~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL-~il~e~k~~~glpv~TeV~~~~~~e~~~~~  134 (301)
                      |-+...+.|+..++.|++..  .+.=|          +.|.++- ++++ +.++++.+.  +|+                
T Consensus        76 ~~~~ai~la~~A~~~Gad~i--~~~pP----------~y~~~~~-~~~l~~yf~~va~~--lPi----------------  124 (279)
T cd00953          76 NLEESIELARAAKSFGIYAI--ASLPP----------YYFPGIP-EEWLIKYFTDISSP--YPT----------------  124 (279)
T ss_pred             CHHHHHHHHHHHHHCCCCEE--EEECC----------CCCCCCC-HHHHHHHHHHHHHH--CCE----------------
T ss_conf             79999999999997799989--97688----------6789999-99999999999850--987----------------


Q ss_pred             CCEEEECHHHCC--CHHHHHHHHHCC-CEEEEECC
Q ss_conf             157882257628--999999985059-77998367
Q gi|254780669|r  135 VDILQIPALLCR--QTDLLTAAAQTG-RVINVKKG  166 (301)
Q Consensus       135 vDilQIgA~~~r--qtdLl~a~a~t~-kpV~iKkg  166 (301)
                       =++++|.+.-.  ..|++.++++.. ..+-+|-.
T Consensus       125 -~lYn~P~~tg~~l~~~~~~~L~~~~~~v~giKds  158 (279)
T cd00953         125 -FIYNYPKATGYDINARMAKEIKKAGGDIIGVKDT  158 (279)
T ss_pred             -EEEECCCCCCCCCCHHHHHHHHHCCCCEEEEECC
T ss_conf             -6996775358888999999998179988999738


No 299
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional
Probab=37.84  E-value=33  Score=15.69  Aligned_cols=19  Identities=26%  Similarity=0.146  Sum_probs=9.5

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             99548634999999999999999655
Q gi|254780669|r   47 LIAGPCQIESHDHAFMIAEKLYAICQ   72 (301)
Q Consensus        47 iIAGPCsiES~e~~~~~A~~lk~~~~   72 (301)
                      +=|||+.       +..|..|.+.+.
T Consensus        31 VGaGpsG-------LtAAy~LAk~g~   49 (257)
T PRK04176         31 VGAGPSG-------LTAAYYLAKAGL   49 (257)
T ss_pred             ECCCCHH-------HHHHHHHHHCCC
T ss_conf             8888279-------999999986896


No 300
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated
Probab=37.71  E-value=22  Score=16.90  Aligned_cols=26  Identities=27%  Similarity=0.607  Sum_probs=20.7

Q ss_pred             CCHHHHHHHHHHHHHHCCEEEEECCCH
Q ss_conf             712488899988665287688522889
Q gi|254780669|r   99 GLKKGREIFRDLKKKYGFPILTDVHTE  125 (301)
Q Consensus        99 Gle~gL~il~e~k~~~glpv~TeV~~~  125 (301)
                      |..+++.+++.+ ++|++||+|=|-.|
T Consensus       135 GYRKAlRlm~lA-ekf~~Pvit~IDTp  160 (318)
T PRK05724        135 GYRKALRLMEMA-ERFGLPIITFIDTP  160 (318)
T ss_pred             HHHHHHHHHHHH-HHCCCCEEEEECCC
T ss_conf             899999999999-97099779993489


No 301
>PRK04147 N-acetylneuraminate lyase; Provisional
Probab=37.48  E-value=33  Score=15.65  Aligned_cols=24  Identities=4%  Similarity=0.252  Sum_probs=11.7

Q ss_pred             CCHHHHHHHHHHHHHHC--CEEEEEC
Q ss_conf             71248889998866528--7688522
Q gi|254780669|r   99 GLKKGREIFRDLKKKYG--FPILTDV  122 (301)
Q Consensus        99 Gle~gL~il~e~k~~~g--lpv~TeV  122 (301)
                      -.+|-.++++.+.+..+  +||+.-|
T Consensus        55 s~~Er~~l~~~~~~~~~~r~pvi~gv   80 (294)
T PRK04147         55 STEERKQVLEIVAEEAKGKIKLIAQV   80 (294)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99999999999999818973276347


No 302
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF). This group includes the type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF), found in bacteria and Archaea. AmiC controls expression of the amidase operon by a ligand-triggered conformational switch. In the absence of ligand or presence of butyramide (repressor), AmiC (the ligand sensor and negative regulator) adopts an open conformation and inhibits the transcription antitermination function of AmiR by direct protein-protein interaction.  In the presence of inducing ligands such as acetamide, AmiC adopts a closed conformation which disrupts a silencing AmiC-AmiR complex and the expression of amidase and other genes of the operon is induced. FmdDEF is predicted to be an ATP-dependent transporter and closely resembles the periplasmic binding protein and the two t
Probab=37.41  E-value=33  Score=15.64  Aligned_cols=14  Identities=21%  Similarity=0.631  Sum_probs=5.5

Q ss_pred             HHHHHHHHHHHCCC
Q ss_conf             99999999972587
Q gi|254780669|r  173 EMHNILQKLHAHGA  186 (301)
Q Consensus       173 e~~~a~eki~~~Gn  186 (301)
                      ||-..+.++.+.+.
T Consensus       175 Dfs~~l~~i~~~~p  188 (333)
T cd06331         175 DFGSVIEKIKAAGP  188 (333)
T ss_pred             CHHHHHHHHHHCCC
T ss_conf             47999999876599


No 303
>cd05803 PGM_like4 This PGM-like (phosphoglucomutase-like) domain is located C-terminal to a mannose-1-phosphate guanyltransferase domain in a protein of unknown function that is found in both prokaryotes and eukaryotes. This domain belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Members of this superfamily include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Probab=37.37  E-value=34  Score=15.64  Aligned_cols=19  Identities=21%  Similarity=0.344  Sum_probs=9.0

Q ss_pred             CCHHHHHHHHHHHHHHCCC
Q ss_conf             6388999999999971898
Q gi|254780669|r  240 GERQYIVPLAKAAVAIGIA  258 (301)
Q Consensus       240 G~r~~v~~la~aa~a~G~d  258 (301)
                      |.+.+...|.+....+|..
T Consensus       307 G~k~i~~~m~~~~~~~ggE  325 (445)
T cd05803         307 GEANVVEKMKEVDAVIGGE  325 (445)
T ss_pred             CHHHHHHHHHHCCCEEEEE
T ss_conf             4499999999669878871


No 304
>pfam01276 OKR_DC_1 Orn/Lys/Arg decarboxylase, major domain.
Probab=37.33  E-value=16  Score=17.69  Aligned_cols=48  Identities=19%  Similarity=0.310  Sum_probs=34.0

Q ss_pred             CCHHHCCCCCCCHHH-HHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCE
Q ss_conf             401000000010688-8518716871177742122345321263889999999999718988
Q gi|254780669|r  199 GYNTLVTDMRSIPIM-TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG  259 (301)
Q Consensus       199 gy~~lvvD~~~i~~l-k~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dG  259 (301)
                      .|.-.+.|++.+... ++.+.|+++|--|.            +.-.|-| +-+.|++.|+|+
T Consensus       178 tY~G~~~di~~i~~~~h~~~~~llvDEAhG------------ah~~F~p-lp~~a~~~gad~  226 (417)
T pfam01276       178 TYDGTIYNAKEIVDTLGHLSDYILFDSAWV------------GYEQFIP-IYADASPMGGDN  226 (417)
T ss_pred             CCCEEEECHHHHHHHHHHCCCEEEEECCCC------------CCCCCCC-CCHHHHHCCCCC
T ss_conf             987065289999999863398799978875------------2024687-833466567886


No 305
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism]
Probab=37.27  E-value=28  Score=16.16  Aligned_cols=82  Identities=22%  Similarity=0.267  Sum_probs=40.9

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCC--
Q ss_conf             995486349999999999999996553399706601557688666322245671248889998866528768852288--
Q gi|254780669|r   47 LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHT--  124 (301)
Q Consensus        47 iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~--  124 (301)
                      -.||+--+|..+--...++..... .+-.-...+|-      -+|-+.|.+.   --++-|.++.+++|+|+++|--.  
T Consensus       129 ~~aG~~l~EvG~tn~t~~~d~~~A-Ine~ta~llkV------~s~~~~f~~~---l~~~~l~~ia~~~~lpvivD~aSg~  198 (395)
T COG1921         129 RLAGAKLVEVGTTNRTHLKDYELA-INENTALLLKV------HSSNYGFTGM---LSEEELVEIAHEKGLPVIVDLASGA  198 (395)
T ss_pred             HHCCCEEEEECCCCCCCHHHHHHH-HCCCCEEEEEE------EECCCCCCCC---CCHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             971977998156576778889988-54587058999------5036661464---5599999999876997799667763


Q ss_pred             -----HHHHHHHHHHCCEE
Q ss_conf             -----99998765021578
Q gi|254780669|r  125 -----EQQCEAIADSVDIL  138 (301)
Q Consensus       125 -----~~~~e~~~~~vDil  138 (301)
                           +.+=+.++..+|++
T Consensus       199 ~v~~e~~l~~~la~GaDLV  217 (395)
T COG1921         199 LVDKEPDLREALALGADLV  217 (395)
T ss_pred             CCCCCCCHHHHHHCCCCEE
T ss_conf             0035544568886079789


No 306
>TIGR02708 L_lactate_ox L-lactate oxidase; InterPro: IPR014080   Members of this entry oxidize L-lactate to pyruvate, reducing molecular oxygen to hydrogen peroxide. The enzyme is known in Aerococcus viridans, Streptococcus iniae, and some strains of Streptococcus pyogenes where it appears to contribute to virulence..
Probab=37.08  E-value=34  Score=15.61  Aligned_cols=90  Identities=22%  Similarity=0.233  Sum_probs=53.9

Q ss_pred             HHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHH---HCCCEEECHH
Q ss_conf             9999985059779983677789999999999997258780899514654440100000001068885---1871687117
Q gi|254780669|r  149 DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS---MGVPVIFDAS  225 (301)
Q Consensus       149 dLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~---~~~PVi~D~S  225 (301)
                      |+=.-+.-+|.||.+|=.|+.  +|.    ++-...|...||++--|..==|.- ---|-+++..-|   ...||+||--
T Consensus       220 DiE~IA~ySGLPVyVKG~Q~~--ED~----~~al~AGASGIWV~NHG~RQl~~~-PaaFD~L~~vAE~V~~rVPIVFDSG  292 (368)
T TIGR02708       220 DIEEIAAYSGLPVYVKGPQCP--EDA----DRALKAGASGIWVTNHGGRQLDGG-PAAFDSLQEVAEAVDKRVPIVFDSG  292 (368)
T ss_pred             HHHHHHHHCCCCEEEECCCCH--HHH----HHHHHCCCCEEEEECCCCCCCCCC-CCCCHHHHHHHHHHCCCCCEEEECC
T ss_conf             089997217983686078886--689----999972886257604775023678-7520006999998528556685088


Q ss_pred             HHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             7742122345321263889999999999718988999
Q gi|254780669|r  226 HSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       226 Hs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                      =              ||=  .-++ .|+|.|+|=+=+
T Consensus       293 v--------------RRG--~Hv~-KALASGAD~VAl  312 (368)
T TIGR02708       293 V--------------RRG--QHVF-KALASGADLVAL  312 (368)
T ss_pred             C--------------CCH--HHHH-HHHHCCCCEEEC
T ss_conf             4--------------325--7899-987235644301


No 307
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=36.91  E-value=34  Score=15.59  Aligned_cols=25  Identities=8%  Similarity=0.199  Sum_probs=17.5

Q ss_pred             HHHHHCCEEEEECCCHHHHHHHHHH
Q ss_conf             8665287688522889999876502
Q gi|254780669|r  110 LKKKYGFPILTDVHTEQQCEAIADS  134 (301)
Q Consensus       110 ~k~~~glpv~TeV~~~~~~e~~~~~  134 (301)
                      .+...|+-.|-|..+.+..+.+.+.
T Consensus        82 y~~~~giI~VvD~sd~~~~~~~~~~  106 (182)
T PTZ00133         82 YQNTNGIIFVVDSNDRERIGDARQE  106 (182)
T ss_pred             CCCCCEEEEEEECCCHHHHHHHHHH
T ss_conf             5676449999966787899999999


No 308
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase; InterPro: IPR004549   This family represents the biotin carboxylase subunit found usually as a component of acetyl-CoA carboxylase. Acetyl-CoA carboxylase (6.4.1.2 from EC) is a heterohexamer of biotin carboxyl carrier protein, biotin carboxylase (6.3.4.14 from EC), and two subunits of carboxyl transferase in a 2:2 complex. In the first step of long-chain fatty acid synthesis, biotin carboxylase catalyses the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-coA. Homologous domains are found in eukaryotic forms of acetyl-CoA carboxylase and in a number of other carboxylases (e.g. pyruvate carboxylase). In some systems, the biotin carboxyl carrier protein and this protein (biotin carboxylase) may be shared by different carboxyltransferases. However, this model is not intended to identify the biotin carboxylase domain of propionyl-coA carboxylase. The model should hit the full length of proteins, except for chloroplast transit peptides in plants. If it hits a domain only of a longer protein, there may be a problem with the identification.; GO: 0016874 ligase activity.
Probab=36.89  E-value=34  Score=15.59  Aligned_cols=147  Identities=26%  Similarity=0.371  Sum_probs=84.1

Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCHH-----HHHHHHHHCC---------EEEECHHHCCCHHHHHHHHHCCCEEEEECC
Q ss_conf             24888999886652876885228899-----9987650215---------788225762899999998505977998367
Q gi|254780669|r  101 KKGREIFRDLKKKYGFPILTDVHTEQ-----QCEAIADSVD---------ILQIPALLCRQTDLLTAAAQTGRVINVKKG  166 (301)
Q Consensus       101 e~gL~il~e~k~~~glpv~TeV~~~~-----~~e~~~~~vD---------ilQIgA~~~rqtdLl~a~a~t~kpV~iKkg  166 (301)
                      |-+|.||+-. ++.|+++|. ||..-     |+.++-|-|=         -|.||+        +.++|++.-...|-=|
T Consensus        12 EIA~RIiRAC-~ElGi~TVA-VyS~aD~dalHV~LADEavCIGea~S~kSYL~Ipn--------I~aAA~~tG~~AiHPG   81 (451)
T TIGR00514        12 EIALRIIRAC-KELGIATVA-VYSTADRDALHVLLADEAVCIGEAPSAKSYLNIPN--------IIAAAEITGADAIHPG   81 (451)
T ss_pred             HHHHHHHHHH-HHCCCCEEE-ECCHHHHHHHHHHHHCCCCCCCCCHHHCCCCHHHH--------HHHHHHHCCCCEECCC
T ss_conf             6788999988-864986398-60044133234343025300686221124411588--------9998877488076288


Q ss_pred             C-CCCHHHHHHHHHHHHHCCCC------CEEEEECCC---------------CCCCHH-HCCCC-CCCHHHHHHCCCEEE
Q ss_conf             7-78999999999999725878------089951465---------------444010-00000-010688851871687
Q gi|254780669|r  167 Q-FLSPWEMHNILQKLHAHGAK------DVLFCERGT---------------SFGYNT-LVTDM-RSIPIMTSMGVPVIF  222 (301)
Q Consensus       167 q-~~s~~e~~~a~eki~~~Gn~------~i~lcERG~---------------~fgy~~-lvvD~-~~i~~lk~~~~PVi~  222 (301)
                      . |||-+  -.-||-+.+.|-.      +.|- -=|.               --|..= ++-|. .++.+-|+.|+|||+
T Consensus        82 YGFLSEN--A~FAe~c~~~g~~FIGP~pe~Ir-~MGDK~~A~~~mKkaGVP~VPGS~GP~~~~~~e~~~~A~~IGyPv~I  158 (451)
T TIGR00514        82 YGFLSEN--ADFAEICEDHGITFIGPSPEAIR-LMGDKVTAKETMKKAGVPVVPGSDGPLVEDEEEAVRIAKEIGYPVII  158 (451)
T ss_pred             CCHHHHH--HHHHHHHHHCCCEEECCCCCCCC-CCCCHHHHHHHHHHCCCCEECCCCCCCCCCHHHHHHHHHHCCCCEEE
T ss_conf             7734431--24788987388266678712011-26886899999974887662388886310278899999747896899


Q ss_pred             CHHHHHHHCCCCCC---CCCCCHHHHHHH----HHHHHHHCCCEEEEEEC
Q ss_conf             11777421223453---212638899999----99999718988999836
Q gi|254780669|r  223 DASHSVQQPGIHGN---CSGGERQYIVPL----AKAAVAIGIAGIFLETH  265 (301)
Q Consensus       223 D~SHs~q~p~~~~~---~~gG~r~~v~~l----a~aa~a~G~dGlfiE~H  265 (301)
                      =+|=     ||+|.   ..-..-||+..+    +=|+.|++=||+.||=.
T Consensus       159 KA~A-----GGGGRGmR~vR~~~El~~~~~~a~~EA~AAF~N~~VYiEKf  203 (451)
T TIGR00514       159 KATA-----GGGGRGMRVVREEDELVKLIKAARAEAAAAFNNDGVYIEKF  203 (451)
T ss_pred             EEEC-----CCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             9625-----89972258862868999999999999974028796278633


No 309
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=36.88  E-value=34  Score=15.59  Aligned_cols=17  Identities=12%  Similarity=0.147  Sum_probs=8.2

Q ss_pred             CCEEEEECCCHHHHHHH
Q ss_conf             87688522889999876
Q gi|254780669|r  115 GFPILTDVHTEQQCEAI  131 (301)
Q Consensus       115 glpv~TeV~~~~~~e~~  131 (301)
                      ++-.+-|+.+++..+.+
T Consensus        76 ~ii~VvD~sd~~~~~~~   92 (167)
T cd04160          76 AIIYVIDSTDRERFEES   92 (167)
T ss_pred             EEEEEEECCCHHHHHHH
T ss_conf             89999866867889999


No 310
>PRK06740 histidinol-phosphatase; Validated
Probab=36.81  E-value=34  Score=15.58  Aligned_cols=71  Identities=18%  Similarity=0.210  Sum_probs=35.6

Q ss_pred             HHHHHHHHHCCC------EEEEECCCC-CCHHHHH----HHHHHHHHCCCCCEEEEECCCCCCCHHHCC----CCCCCHH
Q ss_conf             999999850597------799836777-8999999----999999725878089951465444010000----0001068
Q gi|254780669|r  148 TDLLTAAAQTGR------VINVKKGQF-LSPWEMH----NILQKLHAHGAKDVLFCERGTSFGYNTLVT----DMRSIPI  212 (301)
Q Consensus       148 tdLl~a~a~t~k------pV~iKkgq~-~s~~e~~----~a~eki~~~Gn~~i~lcERG~~fgy~~lvv----D~~~i~~  212 (301)
                      |++++.+|+||.      |=+||+--+ ..-.+.+    .+++-++..|    +.+|=-+.-+|+.-|-    -.+-+..
T Consensus       204 F~~ve~~A~SGLFDIiGHlDlIK~Fg~rp~~~~~~~~~e~~a~aik~~~----~avEINAGLg~RkPV~EiYPs~~~Le~  279 (338)
T PRK06740        204 FKTVECAVRSELFDIIAHLDNIKVFNYRLDENEQLSYYKEIARALVETN----TATEINAGLYYRYPVREMCPSPLYLQV  279 (338)
T ss_pred             HHHHHHHHHCCCCCEECCHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCC----CEEEEECCCCCCCCCCCCCCCHHHHHH
T ss_conf             9999999975997262362167661888991258999999999999749----379982675346874456887999999


Q ss_pred             HHHHCCCEEE
Q ss_conf             8851871687
Q gi|254780669|r  213 MTSMGVPVIF  222 (301)
Q Consensus       213 lk~~~~PVi~  222 (301)
                      ..+.+.||++
T Consensus       280 ~~~~gIPItl  289 (338)
T PRK06740        280 LAKHGVPITL  289 (338)
T ss_pred             HHHCCCCEEE
T ss_conf             9976998785


No 311
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH; InterPro: IPR011909   Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system .    Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond.   Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed  that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro.    NrdH-redoxin is a representative of a class of small redox proteins that contain a conserved CXXC motif and are characterised by a glutaredoxin-like amino acid sequence and thioredoxin-like activity profile. Unlike other the glutaredoxins to which it is most closely related, NrdH aparrently does not interact with glutathione/glutathione reductase, but rather with thioredoxin reductase to catalyze the reduction of ribonucleotide reductase .; GO: 0006118 electron transport, 0045454 cell redox homeostasis.
Probab=36.56  E-value=14  Score=18.23  Aligned_cols=36  Identities=22%  Similarity=0.401  Sum_probs=27.9

Q ss_pred             EEEECCCCCCCHHHCCCCCCCHHHHHHC---CCEEEC-HH
Q ss_conf             9951465444010000000106888518---716871-17
Q gi|254780669|r  190 LFCERGTSFGYNTLVTDMRSIPIMTSMG---VPVIFD-AS  225 (301)
Q Consensus       190 ~lcERG~~fgy~~lvvD~~~i~~lk~~~---~PVi~D-~S  225 (301)
                      +|-+||+.|.-=|.-.|.-.+.++|+.|   .|||.- -.
T Consensus        18 ~L~~~~i~Fe~inid~~pea~d~vk~lGF~~~PVi~~~g~   57 (72)
T TIGR02194        18 ALEEHGIAFEEINIDEQPEAVDYVKALGFRQVPVIVAEGD   57 (72)
T ss_pred             HHHHCCCCEEEEECCCCHHHHHHHHHCCCEECCEEEECCC
T ss_conf             6763799615763588843789998748630762676797


No 312
>smart00426 TEA TEA domain.
Probab=36.24  E-value=27  Score=16.20  Aligned_cols=34  Identities=18%  Similarity=0.480  Sum_probs=27.7

Q ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCC
Q ss_conf             9999999972587808995146544401000000
Q gi|254780669|r  174 MHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM  207 (301)
Q Consensus       174 ~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~  207 (301)
                      +..|.+-+-..|-.++.+-+||-++|.|.|+.|+
T Consensus        14 F~eaL~~ipk~g~rKi~~~~~gk~~GRNeLIs~y   47 (68)
T smart00426       14 FQEALAIYPPCGRRKIILSDEGKMYGRNELIARY   47 (68)
T ss_pred             HHHHHHHCCCCCCCCEEECCCCCCCCHHHHHHHH
T ss_conf             9999985576887434632578774435899999


No 313
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated
Probab=36.22  E-value=35  Score=15.52  Aligned_cols=41  Identities=17%  Similarity=0.256  Sum_probs=16.8

Q ss_pred             CCCCEEEEECCCCCCCHHHCCCCCCCHHH-HHHCCCEEECHHHH
Q ss_conf             87808995146544401000000010688-85187168711777
Q gi|254780669|r  185 GAKDVLFCERGTSFGYNTLVTDMRSIPIM-TSMGVPVIFDASHS  227 (301)
Q Consensus       185 Gn~~i~lcERG~~fgy~~lvvD~~~i~~l-k~~~~PVi~D~SHs  227 (301)
                      .|.+++.+|-=++....  ++|++.+..+ ++.+.|+++|-|-+
T Consensus       133 ~~Tklv~~EspsNP~l~--v~Di~~ia~ia~~~gi~~vvDNT~a  174 (379)
T PRK06176        133 PNTKALYLETPSNPLLK--ITDLAQCASVAKDHGLLTIVDNTFA  174 (379)
T ss_pred             CCCEEEEEECCCCCCCC--CCCCHHHHHHHHHCCCEEEEECCCC
T ss_conf             77459999779998760--1585899999997698799736721


No 314
>COG0325 Predicted enzyme with a TIM-barrel fold [General function prediction only]
Probab=36.17  E-value=35  Score=15.52  Aligned_cols=122  Identities=18%  Similarity=0.213  Sum_probs=59.5

Q ss_pred             EEEECCCHHHHHH---HHHHCCEEEECHHHCCCHHHHHHHHHCCCE------EEE-----ECCCCCCHHHHHHHHHHHHH
Q ss_conf             8852288999987---650215788225762899999998505977------998-----36777899999999999972
Q gi|254780669|r  118 ILTDVHTEQQCEA---IADSVDILQIPALLCRQTDLLTAAAQTGRV------INV-----KKGQFLSPWEMHNILQKLHA  183 (301)
Q Consensus       118 v~TeV~~~~~~e~---~~~~vDilQIgA~~~rqtdLl~a~a~t~kp------V~i-----Kkgq~~s~~e~~~a~eki~~  183 (301)
                      +.--.--+-|-.+   +++.+|.++-=-|+---..|=+.+...++|      ||+     |-|  .+|+|....+..+..
T Consensus        74 i~WHfIG~LQsNK~k~v~~~~~~ihSlDr~klA~~l~kra~~~~~~l~v~iQVNi~~E~sK~G--~~~~e~~~~~~~~~~  151 (228)
T COG0325          74 IEWHFIGPLQSNKVKLVAENFDWIHSLDRLKLAKELNKRALELPKPLNVLIQVNISGEESKSG--VPPEELDELAQEVQE  151 (228)
T ss_pred             EEEEEECHHHHHHHHHHHHHCCEEEECCHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCC--CCHHHHHHHHHHHHH
T ss_conf             179996411356799998424233330779999999989973798863899994388623379--998999999999974


Q ss_pred             CCCCCEEEEECCCC----CC--CHHHCCCCCCCHHHHHH---CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             58780899514654----44--01000000010688851---87168711777421223453212638899999999997
Q gi|254780669|r  184 HGAKDVLFCERGTS----FG--YNTLVTDMRSIPIMTSM---GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVA  254 (301)
Q Consensus       184 ~Gn~~i~lcERG~~----fg--y~~lvvD~~~i~~lk~~---~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a  254 (301)
                      .-|    |+-||-|    |+  +......|+.+-.+++.   ..+   +++.   +      +.|=..+|-     .|+.
T Consensus       152 ~~~----L~l~GLM~ipp~~~d~~~~~~~F~~l~~l~~~l~~~~~---~~~~---L------SMGMS~D~e-----~AI~  210 (228)
T COG0325         152 LPN----LELRGLMTIPPLTDDPEEIFAVFRKLRKLFDELKAKYP---PIDE---L------SMGMSNDYE-----IAIA  210 (228)
T ss_pred             CCC----CEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCC---CCCE---E------CCCCCCCHH-----HHHH
T ss_conf             899----76757774179989979999999999999999987458---9785---2------686762599-----9998


Q ss_pred             HCCCEEEE
Q ss_conf             18988999
Q gi|254780669|r  255 IGIAGIFL  262 (301)
Q Consensus       255 ~G~dGlfi  262 (301)
                      .|+.-+=|
T Consensus       211 ~GaT~VRI  218 (228)
T COG0325         211 EGATMVRI  218 (228)
T ss_pred             CCCCEEEE
T ss_conf             59988997


No 315
>COG1084 Predicted GTPase [General function prediction only]
Probab=35.77  E-value=35  Score=15.48  Aligned_cols=97  Identities=20%  Similarity=0.302  Sum_probs=54.7

Q ss_pred             EECCCEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHH-HHHHHHHHHHHHC--CCCEEEECCCCCCCCCCCCCCCCC
Q ss_conf             8317706835787727976997069995486349999999-9999999965533--997066015576886663222456
Q gi|254780669|r   22 IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAF-MIAEKLYAICQSL--NIGLVYKSSFDKANRSSLAGKRGV   98 (301)
Q Consensus        22 ~~~~~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~-~~A~~lk~~~~~~--~~~~ifK~sfdKanRtS~~sfrG~   98 (301)
                      =++.+.++||.    +..+ ..+..+|--|--++-..-=+ .|-.....+-.++  .+=++|-|          .-..|.
T Consensus       199 PFTTK~i~vGh----fe~~-~~R~QvIDTPGlLDRPl~ErN~IE~qAi~AL~hl~~~IlF~~D~----------Se~cgy  263 (346)
T COG1084         199 PFTTKGIHVGH----FERG-YLRIQVIDTPGLLDRPLEERNEIERQAILALRHLAGVILFLFDP----------SETCGY  263 (346)
T ss_pred             CCCCCCEEEEE----EECC-CCEEEEECCCCCCCCCHHHHCHHHHHHHHHHHHHCCEEEEEECC----------CCCCCC
T ss_conf             85336546765----5048-70589842886457885773689999999999742858999768----------500289


Q ss_pred             CCHHHHHHHHHHHHHHCCEEEE-----ECCCHHHHHHHHH
Q ss_conf             7124888999886652876885-----2288999987650
Q gi|254780669|r   99 GLKKGREIFRDLKKKYGFPILT-----DVHTEQQCEAIAD  133 (301)
Q Consensus        99 Gle~gL~il~e~k~~~glpv~T-----eV~~~~~~e~~~~  133 (301)
                      ++|+-..+|+++|..|+.|+++     |+++.+..+.+..
T Consensus       264 ~lE~Q~~L~~eIk~~f~~p~v~V~nK~D~~~~e~~~~~~~  303 (346)
T COG1084         264 SLEEQISLLEEIKELFKAPIVVVINKIDIADEEKLEEIEA  303 (346)
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHH
T ss_conf             9999999999999853887699974101246667899999


No 316
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO). In green plants, glycolate oxidase is one of the key enzymes in photorespiration where it oxidizes glycolate to glyoxylate. LMO catalyzes the oxidation of L-lactate to acetate and carbon dioxide. MDH oxidizes (S)-mandelate to phenylglyoxalate. It is an enzyme in the mandelate pathway that occurs in several strains of Pseudomonas which converts (R)-mandelate to benzoate.
Probab=35.69  E-value=36  Score=15.47  Aligned_cols=185  Identities=16%  Similarity=0.217  Sum_probs=90.9

Q ss_pred             ECCCCCEEEEECCCCCCC---HHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCC--CCCCCCCCC---CCHHHHHHHHHH
Q ss_conf             769970699954863499---999999999999965533997066015576886--663222456---712488899988
Q gi|254780669|r   39 FSNEQRFVLIAGPCQIES---HDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR--SSLAGKRGV---GLKKGREIFRDL  110 (301)
Q Consensus        39 ig~~~~l~iIAGPCsiES---~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanR--tS~~sfrG~---Gle~gL~il~e~  110 (301)
                      +|-+-.+.|+..|...-.   ++--..+|+..++.+.-+.....--.|+..--.  ..+.-||..   -.+...++++++
T Consensus        59 lG~~~~~P~~iAP~g~~~l~~p~GE~~~AraA~~~gi~~~lSt~ss~slEei~~~~~~~~wfQLY~~~d~~~~~~li~rA  138 (299)
T cd02809          59 LGQKLAMPFGIAPTGLQGLAHPDGELATARAAAAAGIPFTLSTVSTTSLEEVAAAAPGPRWFQLYVPRDREITEDLLRRA  138 (299)
T ss_pred             CCCCCCCCEEECCHHHHCCCCCCHHHHHHHHHHHHCCCEECCCCCCCCHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHH
T ss_conf             89768897688852201256787269999999970564311376656689999744898467764369999999999999


Q ss_pred             HHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHH-HCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             665287688522889999876502157882257628999999985-0597799836777899999999999972587808
Q gi|254780669|r  111 KKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA-QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDV  189 (301)
Q Consensus       111 k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a-~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i  189 (301)
                      + +.|.+.+-            =-||.-..|-|+  +.+-++.+. .++.|+.+| |. ++++|-..|    ...|.+-|
T Consensus       139 ~-~aG~~al~------------lTvD~p~~g~R~--~w~~i~~l~~~~~~p~i~K-Gi-~~~~DA~~a----~~~G~dgI  197 (299)
T cd02809         139 E-AAGYKALV------------LTVDTPVLGRRL--TWDDLAWLRSQWKGPLILK-GI-LTPEDALRA----VDAGADGI  197 (299)
T ss_pred             H-HCCCCEEE------------EECCCCCCCCCC--CHHHHHHHHHHCCCCEEEE-CC-CCHHHHHHH----HHCCCCEE
T ss_conf             9-85999899------------970589878879--9999999998669987997-27-889999999----98599889


Q ss_pred             EEEECCC-CCCCHHHCCCCCCCHHHHH-H--CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             9951465-4440100000001068885-1--87168711777421223453212638899999999997189889998
Q gi|254780669|r  190 LFCERGT-SFGYNTLVTDMRSIPIMTS-M--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE  263 (301)
Q Consensus       190 ~lcERG~-~fgy~~lvvD~~~i~~lk~-~--~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE  263 (301)
                      ++---|- ..-+.  ..-+..+|...+ .  .+||++|-.=           -.| .+.+     .|+|+|+|.+|+=
T Consensus       198 ~VSNHGGRqlD~~--p~~i~~L~~i~~~v~~~~~v~~DgGv-----------R~G-~Dv~-----KAlaLGA~~V~iG  256 (299)
T cd02809         198 VVSNHGGRQLDGA--PATIDALPEIVAAVGGRIEVLLDGGI-----------RRG-TDVL-----KALALGADAVLIG  256 (299)
T ss_pred             EECCCCCCCCCCC--CCHHHHHHHHHHHHCCCEEEEECCCC-----------CCH-HHHH-----HHHHCCCCEEEEC
T ss_conf             9728873336888--77899999999985467289971884-----------753-6899-----9997699889877


No 317
>PRK07811 cystathionine gamma-synthase; Provisional
Probab=35.68  E-value=32  Score=15.74  Aligned_cols=39  Identities=21%  Similarity=0.346  Sum_probs=15.3

Q ss_pred             CCCCEEEEECCCCCCCHHHCCCCCCCHHH-HHHCCCEEECHH
Q ss_conf             87808995146544401000000010688-851871687117
Q gi|254780669|r  185 GAKDVLFCERGTSFGYNTLVTDMRSIPIM-TSMGVPVIFDAS  225 (301)
Q Consensus       185 Gn~~i~lcERG~~fgy~~lvvD~~~i~~l-k~~~~PVi~D~S  225 (301)
                      .|.+++.+|-=++....  +.|+..+..+ |+.+.|+|+|-|
T Consensus       142 ~~Tkli~~Esp~NP~l~--v~Di~~i~~ia~~~g~~~vVDNT  181 (386)
T PRK07811        142 PRTKLIWVETPTNPLLS--ITDIAAIAELAHDAGAKVVVDNT  181 (386)
T ss_pred             CCCEEEEEECCCCCCCC--CCCCHHHHHHHHHCCCEEEEECC
T ss_conf             88349999779998764--05858999999855781883167


No 318
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis. This pathway is unique to microorganisms and plants, rendering the enzyme an attractive target for the development of antimicrobials and herbicides. This subgroup also includes cystathionine gamma-lyases (CGL), O-acetylhomoserine sulfhydrylases and O-acetylhomoserine thiol lyases. CGL's are very similar to CGS's. Members of this group are widely distributed among all three forms of life.
Probab=35.48  E-value=36  Score=15.45  Aligned_cols=63  Identities=19%  Similarity=0.324  Sum_probs=30.0

Q ss_pred             HHHHHHHHHHHHCCEEEE-ECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHHC-CCEEEEEC
Q ss_conf             888999886652876885-22889999876-502157882-----25762899999998505-97799836
Q gi|254780669|r  103 GREIFRDLKKKYGFPILT-DVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQT-GRVINVKK  165 (301)
Q Consensus       103 gL~il~e~k~~~glpv~T-eV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~t-~kpV~iKk  165 (301)
                      ...++++.-.+||+.+.. |..+++.++.+ .+-.+++++     |.+-+.+-.-+.++++. |-++.+-+
T Consensus        92 t~~~~~~~l~~~Gi~v~~~d~~d~~~~~~~i~~~t~li~~EspsNP~l~v~Di~~i~~~A~~~g~~~vvDN  162 (369)
T cd00614          92 TYRLFERLLPKLGIEVTFVDPDDPEALEAAIKPETKLVYVESPTNPTLKVVDIEAIAELAHEHGALLVVDN  162 (369)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCEECCCHHHHHHHHHCCEEEEEEC
T ss_conf             99999977860892389767878688997638785089996589997062272999999976671799747


No 319
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional
Probab=35.39  E-value=24  Score=16.63  Aligned_cols=26  Identities=27%  Similarity=0.618  Sum_probs=20.2

Q ss_pred             CCHHHHHHHHHHHHHHCCEEEEECCCH
Q ss_conf             712488899988665287688522889
Q gi|254780669|r   99 GLKKGREIFRDLKKKYGFPILTDVHTE  125 (301)
Q Consensus        99 Gle~gL~il~e~k~~~glpv~TeV~~~  125 (301)
                      |..+++.+++.+ ++|++||+|=|-.|
T Consensus        83 GYRKA~Rlm~lA-ekf~~PvitfIDTp  108 (256)
T PRK12319         83 GYRKALRLMKQA-EKFGRPVVTFINTA  108 (256)
T ss_pred             HHHHHHHHHHHH-HHHCCCEEEEECCC
T ss_conf             999999999999-98099879996079


No 320
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clam
Probab=34.86  E-value=35  Score=15.53  Aligned_cols=32  Identities=22%  Similarity=0.297  Sum_probs=23.0

Q ss_pred             CCCEEECCCCCEEEEECCCCCCCHHHHHHHHH
Q ss_conf             77279769970699954863499999999999
Q gi|254780669|r   34 KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAE   65 (301)
Q Consensus        34 ~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~   65 (301)
                      .|++.+++++++.+|.||+.-=---.+..++-
T Consensus        21 pNdi~l~~~~~~~iiTGpN~sGKSt~Lk~igl   52 (216)
T cd03284          21 PNDTELDPERQILLITGPNMAGKSTYLRQVAL   52 (216)
T ss_pred             CCEEEECCCCEEEEEECCCCCCHHHHHHHHHH
T ss_conf             65689789845999989987745999999999


No 321
>pfam00448 SRP54 SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins.
Probab=34.64  E-value=37  Score=15.36  Aligned_cols=156  Identities=14%  Similarity=0.147  Sum_probs=92.3

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEE--EC
Q ss_conf             6999548634999999999999999655339970660155768866632224567124888999886652876885--22
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT--DV  122 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~T--eV  122 (301)
                      .+.+.||-.+=--..+.+.|..++.-+.+  ++           =-+.++||.-    +.+-|+...+..|+|+.+  +.
T Consensus         3 vi~lvGptGvGKTTTiaKLAa~~~~~~~~--V~-----------lit~Dt~R~g----A~eQL~~ya~~l~v~~~~~~~~   65 (196)
T pfam00448         3 VILLVGLQGSGKTTTIAKLAAYLKKQGKK--VL-----------LVAADTFRAA----AIEQLKQLAERLGVPVFGSGTG   65 (196)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCE--EE-----------EEECCCCCHH----HHHHHHHHHHHCCCEEEECCCC
T ss_conf             99998999998899999999999977992--89-----------9975877688----9999999998639817814877


Q ss_pred             CCHHHH-----HHH-HHHCCEE--EECHHHCCCHHHHHHHHHC---CCE---EEEECCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             889999-----876-5021578--8225762899999998505---977---9983677789999999999997258780
Q gi|254780669|r  123 HTEQQC-----EAI-ADSVDIL--QIPALLCRQTDLLTAAAQT---GRV---INVKKGQFLSPWEMHNILQKLHAHGAKD  188 (301)
Q Consensus       123 ~~~~~~-----e~~-~~~vDil--QIgA~~~rqtdLl~a~a~t---~kp---V~iKkgq~~s~~e~~~a~eki~~~Gn~~  188 (301)
                      .++.++     +.. .+..|++  --+-|+-++.+++.++.+.   .+|   +++=- -....+++..+..+....+-..
T Consensus        66 ~d~~~~~~~~l~~~~~~~~D~IlIDTaGr~~~d~~~~~el~~~~~~~~~~~~~LVl~-a~~~~~~~~~~~~f~~~~~~~~  144 (196)
T pfam00448        66 SDPAAVAFDAVEKAKAENYDVVLVDTAGRLQNDKNLMDELKKIKRVIAPDEVLLVLD-ATTGQNALNQAKAFNEAVGITG  144 (196)
T ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEE-CCCCCCHHHHHHHHHHHCCCCC
T ss_conf             787899999999988468999999899987476778999999985228730289985-6778213789998760047762


Q ss_pred             EEEEECCCCCCCHHHCCCCCCCHHHHHHCCCEEECH
Q ss_conf             899514654440100000001068885187168711
Q gi|254780669|r  189 VLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA  224 (301)
Q Consensus       189 i~lcERG~~fgy~~lvvD~~~i~~lk~~~~PVi~D~  224 (301)
                      +|++-=--+-.|+.+      +..+.++++||.|=.
T Consensus       145 ~I~TKlDet~~~G~~------l~~~~~~~~Pi~~~t  174 (196)
T pfam00448       145 VILTKLDGDAKGGAA------LSIAAETGKPIKFIG  174 (196)
T ss_pred             EEEEEECCCCCCCHH------HHHHHHHCCCEEEEE
T ss_conf             688840578875299------989999896979996


No 322
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=34.46  E-value=37  Score=15.34  Aligned_cols=153  Identities=15%  Similarity=0.193  Sum_probs=94.0

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEC--
Q ss_conf             699954863499999999999999965533997066015576886663222456712488899988665287688522--
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDV--  122 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV--  122 (301)
                      .+++.||-.+=--..+-+.|..+.+-+.+  ++           =-+.+.||--    +.+-|+...+..|+|+..--  
T Consensus         2 Vi~lvGptGvGKTTTiaKLA~~~~~~~~k--V~-----------lit~Dt~R~g----A~eQL~~~a~~l~v~~~~~~~~   64 (173)
T cd03115           2 VILLVGLQGVGKTTTAAKLALYLKKKGKK--VL-----------LVAADTYRPA----AIEQLRVLGEQVGVPVFEEGEG   64 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCE--EE-----------EEECCCCCHH----HHHHHHHHHHHCCCEEEECCCC
T ss_conf             99998999998899999999999976992--89-----------9974887577----9999999999749859922775


Q ss_pred             CCHHHHH-----HH-HHHCCEEEE--CHHHCCCHHHHHHHHHCC---CE---EEEECCCCCCHHHHHHHHHHHH-HCCCC
Q ss_conf             8899998-----76-502157882--257628999999985059---77---9983677789999999999997-25878
Q gi|254780669|r  123 HTEQQCE-----AI-ADSVDILQI--PALLCRQTDLLTAAAQTG---RV---INVKKGQFLSPWEMHNILQKLH-AHGAK  187 (301)
Q Consensus       123 ~~~~~~e-----~~-~~~vDilQI--gA~~~rqtdLl~a~a~t~---kp---V~iKkgq~~s~~e~~~a~eki~-~~Gn~  187 (301)
                      .++..+.     .. .+..|++=|  +-|+-++.+++.++.+..   +|   .++=-+  .+..+....++.+. ..|-.
T Consensus        65 ~~~~~~~~~~~~~~~~~~~D~IlIDTaGr~~~d~~~~~el~~l~~~~~p~~~~LVl~a--~~~~~~~~~~~~f~~~~~~~  142 (173)
T cd03115          65 KDPVSIAKRAIEHAREENFDVVIVDTAGRLQIDENLMEELKKIKRVVKPDEVLLVVDA--MTGQDAVNQAKAFNEALGIT  142 (173)
T ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEECCC--CCHHHHHHHHHHHHHCCCCC
T ss_conf             5879999999999875689989997888787999999999999864489721574246--55065899999987427997


Q ss_pred             CEEEEECCCCCCCHHHCCCCCCCHHHHHHCCCEEE
Q ss_conf             08995146544401000000010688851871687
Q gi|254780669|r  188 DVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF  222 (301)
Q Consensus       188 ~i~lcERG~~fgy~~lvvD~~~i~~lk~~~~PVi~  222 (301)
                      .+|++-=-.+-.|+.+      +..+.++++||.|
T Consensus       143 ~~I~TKlDet~~~G~~------ls~~~~~~~Pi~f  171 (173)
T cd03115         143 GVILTKLDGDARGGAA------LSIRAVTGKPIKF  171 (173)
T ss_pred             EEEEEEECCCCCCCHH------HHHHHHHCCCEEE
T ss_conf             8999714389975799------9999998909085


No 323
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, a
Probab=34.31  E-value=35  Score=15.48  Aligned_cols=35  Identities=11%  Similarity=0.141  Sum_probs=25.1

Q ss_pred             CCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             77279769970699954863499999999999999
Q gi|254780669|r   34 KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLY   68 (301)
Q Consensus        34 ~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk   68 (301)
                      .|++.+++++++.+|.||+.-=---.+..++-.+.
T Consensus        19 ~Ndi~l~~~~~~~iiTGpN~sGKSt~lk~i~l~~i   53 (200)
T cd03280          19 PLDIQLGENKRVLVITGPNAGGKTVTLKTLGLLTL   53 (200)
T ss_pred             CCEEEECCCCEEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             62589779933999988987750999999999999


No 324
>PRK09248 putative hydrolase; Validated
Probab=34.14  E-value=36  Score=15.45  Aligned_cols=31  Identities=19%  Similarity=0.193  Sum_probs=16.6

Q ss_pred             HHHHCCCEEECH-HHHHHHCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             885187168711-777421223453212638899999999
Q gi|254780669|r  213 MTSMGVPVIFDA-SHSVQQPGIHGNCSGGERQYIVPLAKA  251 (301)
Q Consensus       213 lk~~~~PVi~D~-SHs~q~p~~~~~~~gG~r~~v~~la~a  251 (301)
                      .++++.||+++. .|+...       . |+-++...+++.
T Consensus       181 a~~~Gv~i~i~SDAH~~~~-------v-g~~~~~~~~ar~  212 (246)
T PRK09248        181 CKKAGVWVALGSDAHIAFD-------I-GRFEEALKLLDE  212 (246)
T ss_pred             HHHCCCEEEEECCCCCHHH-------H-CCHHHHHHHHHH
T ss_conf             9981993998589888777-------5-459999999998


No 325
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional
Probab=33.91  E-value=38  Score=15.28  Aligned_cols=74  Identities=14%  Similarity=0.012  Sum_probs=29.7

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCCCC-EEEEC---CCCCCCCCCCCCCCCCCCHHHHHH------HHHHHHHHC
Q ss_conf             99954863499999999999999965533997-06601---557688666322245671248889------998866528
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLNIG-LVYKS---SFDKANRSSLAGKRGVGLKKGREI------FRDLKKKYG  115 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~-~ifK~---sfdKanRtS~~sfrG~Gle~gL~i------l~e~k~~~g  115 (301)
                      +.|.|+-..+||-.+-.+.+..++.+.+..-+ |=|=+   .|-++....---|=|+.. +.++.      .+++-.+.|
T Consensus        52 v~ig~~~~~~sYln~~~Ii~~A~~~g~dAiHPGYGFLSEna~FA~~~~~~gi~fIGPs~-~~i~~~GdK~~ar~~a~~~g  130 (458)
T PRK12833         52 VHIGPSHAAKSYLNPAAILAAARQCGADAIHPGYGFLSENAAFAAQVEAAGLIFVGPDA-QVIATMGDKARARETARRAG  130 (458)
T ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHCCCEEECCCCHHHHCHHHHHHHHHCCCEEECCCH-HHHHHHHCHHHHHHHHHHCC
T ss_conf             98289870013269999999999829999976866255299999999978998999499-99998509699999999849


Q ss_pred             CEEEE
Q ss_conf             76885
Q gi|254780669|r  116 FPILT  120 (301)
Q Consensus       116 lpv~T  120 (301)
                      +|++-
T Consensus       131 vPvvp  135 (458)
T PRK12833        131 VPTVP  135 (458)
T ss_pred             CCCCC
T ss_conf             99668


No 326
>pfam03308 ArgK ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems.
Probab=33.90  E-value=38  Score=15.28  Aligned_cols=28  Identities=11%  Similarity=-0.064  Sum_probs=14.9

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             9954863499999999999999965533
Q gi|254780669|r   47 LIAGPCQIESHDHAFMIAEKLYAICQSL   74 (301)
Q Consensus        47 iIAGPCsiES~e~~~~~A~~lk~~~~~~   74 (301)
                      =|.||=.+---..+-.....+.+.+.+.
T Consensus        33 GiTG~PGaGKStli~~l~~~~~~~g~~v   60 (267)
T pfam03308        33 GITGVPGAGKSTLIEALGMELRRRGHRV   60 (267)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHCCCEE
T ss_conf             8768998879999999999999689868


No 327
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional
Probab=33.73  E-value=32  Score=15.80  Aligned_cols=111  Identities=17%  Similarity=0.212  Sum_probs=55.0

Q ss_pred             CCCCCCCCCCCCCCHHHH----HHHHHHHHHHCCEEEEEC-CCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCE
Q ss_conf             886663222456712488----899988665287688522-889999876502-15788225762899999998505977
Q gi|254780669|r   87 ANRSSLAGKRGVGLKKGR----EIFRDLKKKYGFPILTDV-HTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRV  160 (301)
Q Consensus        87 anRtS~~sfrG~Gle~gL----~il~e~k~~~glpv~TeV-~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kp  160 (301)
                      -.|.-..|..|+-+..-.    ++.++++ +.|+.|--=| -++.|++.+++. +|.+-+=+   -.|  ..+-.     
T Consensus        95 e~r~e~TTegGld~~~~~~~L~~~i~~lk-~~gIrvSLFiDPd~~~i~~a~~~Gad~VElhT---G~Y--a~a~~-----  163 (240)
T PRK05265         95 EKREELTTEGGLDVAGQFDKLKPAIARLK-DAGIRVSLFIDPDPEQIEAAAEVGADRIELHT---GPY--ADAKT-----  163 (240)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHH-HCCCEEEEEECCCHHHHHHHHHHCCCEEEEEC---HHH--HHHCC-----
T ss_conf             99886267889377657899999999998-65981799727987899999984939999834---787--86357-----


Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHHH
Q ss_conf             99836777899999999999972587808995146544401000000010688851
Q gi|254780669|r  161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM  216 (301)
Q Consensus       161 V~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~~  216 (301)
                         ++.+-...+....++++..+.|    +-|.-|---.|.|+. .+..+|.+++.
T Consensus       164 ---~~~~~~el~~i~~aa~~A~~lG----L~VnAGHgLn~~Nl~-~i~~ip~i~Ev  211 (240)
T PRK05265        164 ---EAEQAAELERIAEAAALAASLG----LGVNAGHGLNYHNVK-PIAAIPGIEEL  211 (240)
T ss_pred             ---CCHHHHHHHHHHHHHHHHHHCC----CEEECCCCCCHHHHH-HHHCCCCCEEE
T ss_conf             ---5219999999999999999869----878537898877789-98448997488


No 328
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated
Probab=33.60  E-value=38  Score=15.25  Aligned_cols=62  Identities=15%  Similarity=0.254  Sum_probs=25.0

Q ss_pred             HHHHHHHHHHHHCCEEEE-ECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHH-CCCEEEEE
Q ss_conf             888999886652876885-22889999876-502157882-----2576289999999850-59779983
Q gi|254780669|r  103 GREIFRDLKKKYGFPILT-DVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQ-TGRVINVK  164 (301)
Q Consensus       103 gL~il~e~k~~~glpv~T-eV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~-t~kpV~iK  164 (301)
                      ...+|.+.-.++|+.+.- |..+++.++.+ .+...++++     |.+-+..-+-+.++|+ .|.++.+-
T Consensus       113 t~~l~~~~l~~~Gi~~~~vd~~d~~~~~~ai~~~T~lv~~EtpsNP~l~v~Di~~i~~iA~~~g~~~vVD  182 (391)
T PRK08133        113 TLSLFEKIFARFGIETTFVDLTDLDAWRAAVRPNTKLFFLETPSNPLTELADIAALAEIAHAAGALLVVD  182 (391)
T ss_pred             HHHHHHHHHHCCCEEEEECCCCCHHHHHHHCCCCCEEEEEECCCCCCCEEECCHHHHHHHHHCCCEEEEE
T ss_conf             8999998741078444467987999999745878459999789999866555399999987558759987


No 329
>PRK07503 methionine gamma-lyase; Provisional
Probab=33.42  E-value=36  Score=15.44  Aligned_cols=63  Identities=11%  Similarity=0.214  Sum_probs=35.1

Q ss_pred             HHHHHHHHHHHHCCEEE-EECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHHC-CCEEEEEC
Q ss_conf             88899988665287688-522889999876-502157882-----25762899999998505-97799836
Q gi|254780669|r  103 GREIFRDLKKKYGFPIL-TDVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQT-GRVINVKK  165 (301)
Q Consensus       103 gL~il~e~k~~~glpv~-TeV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~t-~kpV~iKk  165 (301)
                      ...++.+.-.+||+.+. .|..+++.++.. .+...++++     |.+-+..-.-+.++++. |.++.+-+
T Consensus       117 t~~l~~~~l~~~Gi~~~~vd~~d~~~~~~ai~~~Tkli~~Etp~NP~l~v~Di~~ia~iA~~~g~~~vVDN  187 (403)
T PRK07503        117 TFAFLHHGLGEFGVKVRHVDLTDAKALKAAISEKTRMIYFETPANPNMQLVDIAAVVEAARGHDALVVVDN  187 (403)
T ss_pred             HHHHHHHHHHHCCEEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCEEECHHHHHHHHHHCCCEEEEEC
T ss_conf             89999844631775999868989899997518673299995279998663057999999986588599836


No 330
>KOG0238 consensus
Probab=33.20  E-value=33  Score=15.70  Aligned_cols=187  Identities=19%  Similarity=0.179  Sum_probs=92.5

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEE-EEC---CCCCCCCC--------CCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             69995486349999999999999996553399706-601---55768866--------6322245671248889998866
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLV-YKS---SFDKANRS--------SLAGKRGVGLKKGREIFRDLKK  112 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~i-fK~---sfdKanRt--------S~~sfrG~Gle~gL~il~e~k~  112 (301)
                      -+-|.+|-+..||=-+-.|.+..+..+++...+|. |=+   -|--.++.        ++.+-|+.|.+-.-   +++-+
T Consensus        44 av~ig~a~~~~SYL~~~~I~~aa~~tgaqaihPGYGFLSEn~~Fae~c~~~Gi~FiGP~~~aIrdMG~K~~s---k~im~  120 (670)
T KOG0238          44 AVCIGPAPAAQSYLRMDKIIDAAKRTGAQAIHPGYGFLSENAEFAELCEDAGITFIGPPPSAIRDMGDKSTS---KQIMK  120 (670)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCCHHHHHHHHHCCCEEECCCHHHHHHHCCHHHH---HHHHH
T ss_conf             034288734443413789999998628846217855323553899999876986879887998873125778---99998


Q ss_pred             HHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEEC-------CCC--CCHHHHHHHHH----
Q ss_conf             52876885228899998765021578822576289999999850597799836-------777--89999999999----
Q gi|254780669|r  113 KYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK-------GQF--LSPWEMHNILQ----  179 (301)
Q Consensus       113 ~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKk-------gq~--~s~~e~~~a~e----  179 (301)
                      .-|+|++--.|-..|-+                  -.+.+.+.+.|-||+||-       |+-  -+++|+....+    
T Consensus       121 ~AgVp~vpG~~g~~qs~------------------e~~~~~a~eIgyPvMiKa~~GGGGkGMria~~~~ef~~~~~~ak~  182 (670)
T KOG0238         121 AAGVPLVPGYHGEDQSD------------------EEAKKVAREIGYPVMIKATAGGGGKGMRIAWSEEEFEEGLESAKQ  182 (670)
T ss_pred             HCCCCCCCCCCCCCCCH------------------HHHHHHHHHCCCCEEEEECCCCCCCCEEEECCHHHHHHHHHHHHH
T ss_conf             64996136856432667------------------999999986198579995157887631751486889999998888


Q ss_pred             -HHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHH-HHCCCE-EECHHHHHHHCCC--------CCCCCCCCHHHHHHH
Q ss_conf             -99725878089951465444010000000106888-518716-8711777421223--------453212638899999
Q gi|254780669|r  180 -KLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT-SMGVPV-IFDASHSVQQPGI--------HGNCSGGERQYIVPL  248 (301)
Q Consensus       180 -ki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk-~~~~PV-i~D~SHs~q~p~~--------~~~~~gG~r~~v~~l  248 (301)
                       --.++|+.. +|.||=+.   |-+.+.+.   ++- +++--| ...---|+|+..+        .+-..--||.+-+.-
T Consensus       183 Ea~~sFGdd~-~llEkfi~---npRHiEvQ---v~gD~hGnav~l~ERdCSvQRRnQKiiEEaPap~l~~e~R~~lgeaA  255 (670)
T KOG0238         183 EAAKSFGDDG-MLLEKFID---NPRHIEVQ---VFGDKHGNAVHLGERDCSVQRRNQKIIEEAPAPNLPEETRRALGEAA  255 (670)
T ss_pred             HHHHHCCCCH-HHHHHHCC---CCCEEEEE---EEECCCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             8876318641-10777636---87548999---97347776888504544242321156630899999989999999999


Q ss_pred             HHHHHHHCCCE
Q ss_conf             99999718988
Q gi|254780669|r  249 AKAAVAIGIAG  259 (301)
Q Consensus       249 a~aa~a~G~dG  259 (301)
                      -++|.+.|+.|
T Consensus       256 v~aa~avgY~~  266 (670)
T KOG0238         256 VRAAKAVGYVG  266 (670)
T ss_pred             HHHHHHHCCCC
T ss_conf             99988638764


No 331
>PRK13116 consensus
Probab=33.09  E-value=39  Score=15.20  Aligned_cols=220  Identities=17%  Similarity=0.261  Sum_probs=117.2

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCE
Q ss_conf             999548634999999999999999655339-9706601------55768866632224567124888999886652-876
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANRSSLAGKRGVGLKKGREIFRDLKKKY-GFP  117 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~-glp  117 (301)
                      ++.||   --+.+..+++.+.+.+.|++.. +|.-|--      ..-+|+--+  --.|..+++.+++++++|+++ .+|
T Consensus        22 yitaG---~P~~~~s~~~l~~l~~~GaDiiElGiPFSDP~ADGPvIQ~A~~rA--L~~G~~~~~~~~~v~~ir~~~~~~P   96 (278)
T PRK13116         22 FIMLS---DPSPEEAFQIISTAIEAGADALELGVPFSDPVADGPTVAESHLRA--LDGGATVDSALEQIKRVRAAYPEVP   96 (278)
T ss_pred             EECCC---CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHH--HHCCCCHHHHHHHHHHHCCCCCCCC
T ss_conf             85484---899899999999999669999997999888566689999999999--9769867899999998403589876


Q ss_pred             EEE-------ECC-CHHHHHHHHHH-CCEEEECHHHCCCH-HHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             885-------228-89999876502-15788225762899-99999850597-799836777899999999999972587
Q gi|254780669|r  118 ILT-------DVH-TEQQCEAIADS-VDILQIPALLCRQT-DLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       118 v~T-------eV~-~~~~~e~~~~~-vDilQIgA~~~rqt-dLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn  186 (301)
                      ++-       --. ...-++.+++. +|-+=||---...- ++..++.+.+. +|.+=-+  .+.++-+   +.+.+...
T Consensus        97 ivlM~Y~N~i~~~G~e~F~~~~~~aGvdGlIipDLP~eE~~~~~~~~~~~~i~~I~l~~p--tt~~~ri---~~I~~~s~  171 (278)
T PRK13116         97 IGMLIYGNVPFTRGLDRFYQEFAEAGADSILLPDVPVREGAPFSAAAAAAGIDPIYIAPA--NASEKTL---EGVSAASK  171 (278)
T ss_pred             EEEEECCCHHHHCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEECC--CCCHHHH---HHHHHHCC
T ss_conf             899805728877279999999977697589946999788899999998657666999379--9959999---99997189


Q ss_pred             C-CEEEEECCCCCCC-HHHCCC-C-CCCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEE
Q ss_conf             8-0899514654440-100000-0-010688851-871687117774212234532126388999999999971898899
Q gi|254780669|r  187 K-DVLFCERGTSFGY-NTLVTD-M-RSIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF  261 (301)
Q Consensus       187 ~-~i~lcERG~~fgy-~~lvvD-~-~~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlf  261 (301)
                      - =..+.-.|+| |. +....| + ..+..+|+. ..||++---=|             .++-+    +.++..++||+.
T Consensus       172 GFiY~VS~~GvT-G~~~~~~~~~l~~~i~~ik~~t~~Pv~vGFGIs-------------~~e~v----~~~~~~~aDGVI  233 (278)
T PRK13116        172 GYIYAISRDGVT-GTERESSTDGLSAVVDNIKKFDGAPILLGFGIS-------------SPQHV----ADAIAAGASGAI  233 (278)
T ss_pred             CEEEEEECCCCC-CCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCC-------------CHHHH----HHHHHCCCCEEE
T ss_conf             739998635222-688666678999999999845799879981679-------------89999----999866899999


Q ss_pred             EE--------ECCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             98--------36983347978201868899999999999999988
Q gi|254780669|r  262 LE--------THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKII  298 (301)
Q Consensus       262 iE--------~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~v  298 (301)
                      +=        -|-+.+++     +.-.+..++.++++|.+.=+..
T Consensus       234 VGSAiVk~Ie~~~~~~~~-----~~~~~~~~~~~~~~l~~~v~~~  273 (278)
T PRK13116        234 TGSAITKIIASHCEGEHP-----NPSTIRDMDGLKKDLTEFISAM  273 (278)
T ss_pred             ECHHHHHHHHHCCCCCCC-----CCHHHCCHHHHHHHHHHHHHHH
T ss_conf             877999999852765555-----5011236999999999999998


No 332
>PRK06767 methionine gamma-lyase; Provisional
Probab=33.09  E-value=19  Score=17.25  Aligned_cols=55  Identities=15%  Similarity=0.186  Sum_probs=29.3

Q ss_pred             HHHHHHHHHHHHCCEEEE-ECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHHC
Q ss_conf             888999886652876885-22889999876-502157882-----25762899999998505
Q gi|254780669|r  103 GREIFRDLKKKYGFPILT-DVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQT  157 (301)
Q Consensus       103 gL~il~e~k~~~glpv~T-eV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~t  157 (301)
                      ...++++.-.+||+.+.- |..+.+.++.. .+...++++     |.+-+..-+-+.++|+.
T Consensus       113 T~~l~~~~~~~~gI~~~~~d~~~~~~~~~~i~~~Tklv~~EspsNP~l~v~Di~~i~~~A~~  174 (386)
T PRK06767        113 TYGFLEVLEEKFMITHSFCDMETEADIENKIRPNTKLIFVETPINPTMKLIDLKQVIRVAKR  174 (386)
T ss_pred             HHHHHHHHHHHCCEEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHH
T ss_conf             46699998887375899968988899997568882599997799987671279999998600


No 333
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.
Probab=32.68  E-value=40  Score=15.15  Aligned_cols=12  Identities=8%  Similarity=0.047  Sum_probs=5.1

Q ss_pred             HHHHHHHHCCCC
Q ss_conf             999999725878
Q gi|254780669|r  176 NILQKLHAHGAK  187 (301)
Q Consensus       176 ~a~eki~~~Gn~  187 (301)
                      .||.+....|-+
T Consensus       156 ~aA~ra~~AGfD  167 (338)
T cd02933         156 QAARNAIEAGFD  167 (338)
T ss_pred             HHHHHHHHCCCC
T ss_conf             999999983999


No 334
>cd05802 GlmM GlmM is a bacterial phosphoglucosamine mutase (PNGM) that belongs to the alpha-D-phosphohexomutase superfamily. It is required for the interconversion of glucosamine-6-phosphate and glucosamine-1-phosphate in the biosynthetic pathway of UDP-N-acetylglucosamine, an essential precursor to components of the cell envelope.  In order to be active, GlmM must be phosphorylated, which can occur via autophosphorylation or by the Ser/Thr kinase StkP. GlmM functions in a classical ping-pong bi-bi mechanism with glucosamine-1,6-diphosphate as an intermediate.  Other members of the alpha-D-phosphohexomutase superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Probab=32.51  E-value=40  Score=15.13  Aligned_cols=28  Identities=29%  Similarity=0.412  Sum_probs=14.4

Q ss_pred             CCEEEE-ECCCCCCHHHHH-HHHHHHHHCC
Q ss_conf             977998-367778999999-9999997258
Q gi|254780669|r  158 GRVINV-KKGQFLSPWEMH-NILQKLHAHG  185 (301)
Q Consensus       158 ~kpV~i-Kkgq~~s~~e~~-~a~eki~~~G  185 (301)
                      ++.+.+ .+|.+++.++.. ..+.+++..+
T Consensus       240 DR~~~vd~~G~~i~~d~l~~l~a~~~l~~~  269 (434)
T cd05802         240 DRVIAVDEKGNIVDGDQILAICARDLKERG  269 (434)
T ss_pred             CEEEEECCCCCEECHHHHHHHHHHHHHHHC
T ss_conf             769999899978588999999999999850


No 335
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism. In bacteria, formation of pyridoxine 5'-phosphate is a step in the biosynthesis of vitamin B6. PNP synthase, a homooctameric enzyme, catalyzes the final step in PNP biosynthesis, the condensation of 1-amino-acetone 3-phosphate and 1-deoxy-D-xylulose 5-phosphate. PNP synthase adopts a TIM barrel topology, intersubunit contacts are mediated by three ''extra'' helices, generating a tetramer of symmetric dimers with shared active sites; the open state has been proposed to accept substrates and to release products, while most of the catalytic events are likely to occur in the closed state; a hydrophilic channel running through the center of the barrel was identified as the essential structural feature that enables PNP synthase to release water molecules produced during the reaction from the closed,
Probab=32.49  E-value=35  Score=15.55  Aligned_cols=107  Identities=17%  Similarity=0.213  Sum_probs=47.8

Q ss_pred             CCCCCCCCCCCCHHHH----HHHHHHHHHHCCEEEEECC--CHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEE
Q ss_conf             6663222456712488----8999886652876885228--89999876502-157882257628999999985059779
Q gi|254780669|r   89 RSSLAGKRGVGLKKGR----EIFRDLKKKYGFPILTDVH--TEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVI  161 (301)
Q Consensus        89 RtS~~sfrG~Gle~gL----~il~e~k~~~glpv~TeV~--~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV  161 (301)
                      |.-..|..|+-+..-.    ++.+++++ .|+.| +=+.  +++|++.+++. +|.+-+=+-   .|  ..+-.      
T Consensus        94 r~elTTegGld~~~~~~~L~~~i~~lk~-~~Irv-SLFIDPd~~qi~~a~~~Gad~VElhTG---~Y--a~a~~------  160 (234)
T cd00003          94 REELTTEGGLDVAGQAEKLKPIIERLKD-AGIRV-SLFIDPDPEQIEAAKEVGADRVELHTG---PY--ANAYD------  160 (234)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCCEE-EEEECCCHHHHHHHHHHCCCEEEEECH---HH--HHHCC------
T ss_conf             7864178892665478899999999986-59827-997279878999999849399998247---87--86348------


Q ss_pred             EEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHH
Q ss_conf             983677789999999999997258780899514654440100000001068885
Q gi|254780669|r  162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS  215 (301)
Q Consensus       162 ~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~  215 (301)
                        ++.+-........++++..+.|-.    |.-|---.|.|+ ..+..+|.+++
T Consensus       161 --~~~~~~el~~i~~aa~~A~~lGL~----VnAGHgLn~~Nl-~~i~~ip~i~E  207 (234)
T cd00003         161 --KAEREAELERIAKAAKLARELGLG----VNAGHGLNYENV-KPIAKIPGIAE  207 (234)
T ss_pred             --CHHHHHHHHHHHHHHHHHHHCCCE----EECCCCCCHHHH-HHHHCCCCCEE
T ss_conf             --103999999999999999985987----854789887679-99855899728


No 336
>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed
Probab=32.48  E-value=40  Score=15.13  Aligned_cols=90  Identities=18%  Similarity=0.199  Sum_probs=53.1

Q ss_pred             HHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCH-HHCCCCCCCHHHHH-HCCCEEECHHH
Q ss_conf             99999850597799836777899999999999972587808995146544401-00000001068885-18716871177
Q gi|254780669|r  149 DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN-TLVTDMRSIPIMTS-MGVPVIFDASH  226 (301)
Q Consensus       149 dLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~-~lvvD~~~i~~lk~-~~~PVi~D~SH  226 (301)
                      +-++.+-+.|+.|-+=|.....|.-.....+.+  .+.+.|.+.||-.++|+. -|..|.++--.-.. ..-|+|+.--.
T Consensus       284 ~AVd~lR~~G~KVGlir~r~~rPFP~~~l~~al--~~~K~V~Vldr~~~~g~~g~l~~~v~~al~~~~~~~~p~v~~~~~  361 (407)
T PRK09622        284 VAAKEMRKKGIKAGVATIRVLRPFPYERLGQAL--KNLKALAILDRSSPAGAMGALFNEVTSAVYQTQGTKHPVVSNYIY  361 (407)
T ss_pred             HHHHHHHHCCCEEEEEEEEEECCCCHHHHHHHH--CCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCEEECEEC
T ss_conf             999999974986758999985899999999987--579989999788998887737999999998527778987956565


Q ss_pred             HHHHCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             7421223453212638899999999
Q gi|254780669|r  227 SVQQPGIHGNCSGGERQYIVPLAKA  251 (301)
Q Consensus       227 s~q~p~~~~~~~gG~r~~v~~la~a  251 (301)
                      .+           |.|++-|...++
T Consensus       362 GL-----------gg~d~t~~~~~~  375 (407)
T PRK09622        362 GL-----------GGRDMTIAHLCE  375 (407)
T ss_pred             CC-----------CCCCCCHHHHHH
T ss_conf             78-----------878899999999


No 337
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family; InterPro: IPR004753   Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes. In addition to individual cell shape, the way in which groups of cells are arranged is also typical of some bacterial species, especially Gram-positive coccoids. For many years, it was believed that micro-organisms with other than spheroidal cell shapes maintained morphology by means of their external cell walls. Recently, however, studies of the Gram-positive rod Bacillus subtilis have revealed two related genes that are essential for the integrity of cell morphogenesis . Termed mreB and mbl, the gene products localise close to the cell surface, forming filamentous helical structures. Many homologues have been found in diverse bacterial groups, suggesting a common ancestor .    The crystal structure of MreB from Thermotoga maritima has been resolved using X-ray crystallography . It consists of 19 beta-strands and 15 alpha- helices, and shows remarkable structural similarity to eukaryotic actin. MreB crystals also contain proto-filaments, with individual proteins assembling into polymers like F-actin, in the same orientation. It is hypothesised therefore, that MreB was the forerunner of actin in early eukaryotes .; GO: 0000902 cell morphogenesis.
Probab=32.47  E-value=19  Score=17.27  Aligned_cols=54  Identities=22%  Similarity=0.365  Sum_probs=35.9

Q ss_pred             HHHHHHHHHHHHCCCCCEE--EEECCC-CCCCHHHCCCCCCCHHH--HHHCCCEEE--CHHHHH
Q ss_conf             9999999999725878089--951465-44401000000010688--851871687--117774
Q gi|254780669|r  172 WEMHNILQKLHAHGAKDVL--FCERGT-SFGYNTLVTDMRSIPIM--TSMGVPVIF--DASHSV  228 (301)
Q Consensus       172 ~e~~~a~eki~~~Gn~~i~--lcERG~-~fgy~~lvvD~~~i~~l--k~~~~PVi~--D~SHs~  228 (301)
                      .....|+...++.--+++.  +.|||+ ..|=+-|   +||++.+  |++++||++  ||=.||
T Consensus       261 ~~IV~aVk~tLE~tPPELA~DIveRGiVLTGGGaL---LrnLDk~lS~eTg~PV~~Ad~PL~cV  321 (337)
T TIGR00904       261 NQIVEAVKSTLEKTPPELAADIVERGIVLTGGGAL---LRNLDKLLSKETGLPVIVADDPLLCV  321 (337)
T ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHCCEEEECCHHH---HHCCCHHHHHHCCCCEEECCCCHHHH
T ss_conf             89999999875168870465776469376263054---52101587773486368868713358


No 338
>pfam00697 PRAI N-(5'phosphoribosyl)anthranilate (PRA) isomerase.
Probab=32.21  E-value=40  Score=15.10  Aligned_cols=90  Identities=14%  Similarity=0.257  Sum_probs=49.1

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHH
Q ss_conf             63499999999999999965533997066015576886663222456712488899988665287688522889999876
Q gi|254780669|r   52 CQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAI  131 (301)
Q Consensus        52 CsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~  131 (301)
                      |.+-+.+.+    +.+.+.+.+ .+|++|=+          .|-|-.-.+++.++.+.+..++ +-|..+ .+.+.+..+
T Consensus         4 CGit~~ed~----~~~~~~gad-~iGfif~~----------~SpR~i~~~~a~~i~~~~~~~~-VgVfv~-~~~~~i~~~   66 (195)
T pfam00697         4 CGLTRIEDV----VAAVPAGAD-YLGLIFAP----------SSKRQVFPEQAQELRSAVPLLL-VGVFVN-QPIEEVLRI   66 (195)
T ss_pred             CCCCCHHHH----HHHHHCCCC-EEEEECCC----------CCCCCCCHHHHHHHHHHCCCCE-EEEECC-CCHHHHHHH
T ss_conf             888979999----999958999-99883579----------9998879999999997589865-999847-868999999


Q ss_pred             HH--HCCEEEECHHHCCCHHHHHHHHHCCCEE
Q ss_conf             50--2157882257628999999985059779
Q gi|254780669|r  132 AD--SVDILQIPALLCRQTDLLTAAAQTGRVI  161 (301)
Q Consensus       132 ~~--~vDilQIgA~~~rqtdLl~a~a~t~kpV  161 (301)
                      .+  ..|++|+=--  ...+....+. .+.|+
T Consensus        67 ~~~~~~d~vQlHG~--e~~~~~~~~~-~~~~~   95 (195)
T pfam00697        67 AQVLGLDVVQLHGD--EPQEYANLLP-TGVPV   95 (195)
T ss_pred             HHHCCCCEEEECCC--CCHHHHHHHH-HCCCC
T ss_conf             98379987998899--9989999998-46883


No 339
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated
Probab=32.18  E-value=40  Score=15.10  Aligned_cols=69  Identities=19%  Similarity=0.291  Sum_probs=36.3

Q ss_pred             HHHHHHHHHHHHCCEEEE-ECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHH-CCCEEEEECCCCCCHH
Q ss_conf             888999886652876885-22889999876-502157882-----2576289999999850-5977998367778999
Q gi|254780669|r  103 GREIFRDLKKKYGFPILT-DVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQ-TGRVINVKKGQFLSPW  172 (301)
Q Consensus       103 gL~il~e~k~~~glpv~T-eV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~-t~kpV~iKkgq~~s~~  172 (301)
                      ...++.+.-.+||+.+.- |..+++.++.+ .+...++++     |..-+.+-.-+.++++ .|.++.+-+ -|+||.
T Consensus       115 t~~~~~~~l~~~Gi~v~~~d~~d~~~~~~~i~~~T~lv~~EspsNP~l~v~Di~~ia~iA~~~g~~~vVDN-T~atP~  191 (426)
T PRK05994        115 SINQFGHAFKSFGWQVRWADADDPASFEAAITPRTKAIFIESIANPGGTITDIEAIAEVAHRAGLPLIVDN-TLASPY  191 (426)
T ss_pred             HHHHHHHHHHHCCEEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEEC-CCCHHH
T ss_conf             99999999860886999978998388997368875499998789988723478999999997199178635-652043


No 340
>PRK02412 aroD 3-dehydroquinate dehydratase; Provisional
Probab=32.11  E-value=41  Score=15.09  Aligned_cols=224  Identities=17%  Similarity=0.209  Sum_probs=134.2

Q ss_pred             CEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCC-CHHHH
Q ss_conf             70683578772797699706999548634999999999999999655339970660155768866632224567-12488
Q gi|254780669|r   26 AAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVG-LKKGR  104 (301)
Q Consensus        26 ~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~G-le~gL  104 (301)
                      +.+.+    .++.+|++.|  .|.-|-.-.+.+.+.+-++.++..+.++.   =|+-          +.|.... .++-+
T Consensus         2 k~~~v----~~~~~g~g~p--kIcvpi~~~t~~e~~~~~~~~~~~~aDlv---E~Rl----------D~l~~~~~~~~~~   62 (253)
T PRK02412          2 KTVTV----KNLVIGEGAP--KIVVPIMAKTIEEVAQEAEAIKYADADII---EWRA----------DFLEKVSDVEEVL   62 (253)
T ss_pred             CEEEE----CCEEECCCCC--EEEEEECCCCHHHHHHHHHHHHHCCCCEE---EEEC----------CCCCCCCCHHHHH
T ss_conf             74898----9889659997--89999678999999999999844699989---9960----------3134569999999


Q ss_pred             HHHHHHHHHH-CCEEEEECCCH-----------HHHH---HHHH--HCCEEEECHHHCCC--HHHHHHHHHCCCEEEEEC
Q ss_conf             8999886652-87688522889-----------9998---7650--21578822576289--999999850597799836
Q gi|254780669|r  105 EIFRDLKKKY-GFPILTDVHTE-----------QQCE---AIAD--SVDILQIPALLCRQ--TDLLTAAAQTGRVINVKK  165 (301)
Q Consensus       105 ~il~e~k~~~-glpv~TeV~~~-----------~~~e---~~~~--~vDilQIgA~~~rq--tdLl~a~a~t~kpV~iKk  165 (301)
                      +.++++++.+ ++|++--+...           +.++   .+.+  .+|.+-|-.+...+  .+|+..+.+.+..|.+=.
T Consensus        63 ~~~~~i~~~~~~~PlI~T~R~~~EGG~~~~~e~~~~~il~~~~~~~~~d~iDiEl~~~~~~~~~l~~~a~~~~~~vI~S~  142 (253)
T PRK02412         63 AAAPAIREKFPGKPLLFTFRTAKEGGEIELSDEEYLALYKAVIESGLPDYIDVELFSGKDVVKEMVAFAHEHGVKVVLSY  142 (253)
T ss_pred             HHHHHHHHHCCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             99999998468997899924744389866999999999999997599857975313777899999998886699899985


Q ss_pred             CCC---CCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHHH--CCCEEECHHHHHHHCCCCCCCCCC
Q ss_conf             777---899999999999972587808995146544401000000010688851--871687117774212234532126
Q gi|254780669|r  166 GQF---LSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGG  240 (301)
Q Consensus       166 gq~---~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~~--~~PVi~D~SHs~q~p~~~~~~~gG  240 (301)
                      +.|   .+.+++....+.+.+.|.+=+-++=-..+  ..+...-+.....+++.  ..|+|.=+--      .     .|
T Consensus       143 HdF~~TP~~~~l~~~~~~m~~~gADIvKia~~~~~--~~Dvl~ll~~t~~~~~~~~~~Pli~~~MG------~-----~G  209 (253)
T PRK02412        143 HDFHKTPSAEEIVERLRKMEELGADIVKIAVMPQS--EQDVLTLLNATREMKELYADQPIITMSMG------K-----LG  209 (253)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCC--HHHHHHHHHHHHHHHHHCCCCCEEEEECC------C-----CC
T ss_conf             48988979999999999999709998999985698--88999999999999960799988999679------8-----64


Q ss_pred             CHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             3889999999999718988999836983347978201868899999999999
Q gi|254780669|r  241 ERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLL  292 (301)
Q Consensus       241 ~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~  292 (301)
                      .-.=+     .+-.+|-.=-|.=. ..     .-+|-|++.+++.++++-|.
T Consensus       210 ~~sRi-----~~~~~GS~~Tfa~~-~~-----~sAPGQ~~v~~lr~il~~l~  250 (253)
T PRK02412        210 RISRL-----AGEVFGSAWTFGSL-DQ-----ASAPGQISVNDLRTILEILH  250 (253)
T ss_pred             HHHHH-----HHHHHCCCEEEEEC-CC-----CCCCCCCCHHHHHHHHHHHH
T ss_conf             89999-----89987997186127-99-----99899977999999999987


No 341
>PRK04183 glutamyl-tRNA(Gln) amidotransferase subunit D; Validated
Probab=31.63  E-value=41  Score=15.04  Aligned_cols=95  Identities=18%  Similarity=0.099  Sum_probs=48.0

Q ss_pred             HHHHHHHHHHHHHHCCE------EEEECCCHHHHHHHHHHC--------C--EEEECHHHCCCHH--HHHHHHHCCCEEE
Q ss_conf             24888999886652876------885228899998765021--------5--7882257628999--9999850597799
Q gi|254780669|r  101 KKGREIFRDLKKKYGFP------ILTDVHTEQQCEAIADSV--------D--ILQIPALLCRQTD--LLTAAAQTGRVIN  162 (301)
Q Consensus       101 e~gL~il~e~k~~~glp------v~TeV~~~~~~e~~~~~v--------D--ilQIgA~~~rqtd--Ll~a~a~t~kpV~  162 (301)
                      ++-++..-|+++--.+.      +.+|-|.|++-..+++.+        |  |+-=|.=.|.-|.  |--.+..+.|||.
T Consensus       104 ~~l~~~vPeL~~ia~i~~~~l~ni~S~nM~P~~W~~iA~~i~~~~~~g~DG~VItHGTDTMayTAsALSFml~~~~KPVV  183 (421)
T PRK04183        104 EDLLRAVPELADIANIKAEVLFNILSENMTPEYWQEIAEAVAEEIENGADGVVVAHGTDTMHYTAAALSFMLRKTPVPIV  183 (421)
T ss_pred             HHHHHHCCCHHHEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99987480444368899999714654537989999999999998666898799921675299999999999638999889


Q ss_pred             EECCCC-------CCHHHHHHHHHHHHHCCCCCE------------EEEECCC
Q ss_conf             836777-------899999999999972587808------------9951465
Q gi|254780669|r  163 VKKGQF-------LSPWEMHNILQKLHAHGAKDV------------LFCERGT  196 (301)
Q Consensus       163 iKkgq~-------~s~~e~~~a~eki~~~Gn~~i------------~lcERG~  196 (301)
                      +-=.|-       =.+...+.|+. +.......|            .+..||+
T Consensus       184 lTGSQrp~~~~sSDa~~NL~~Av~-~A~s~~~eV~Vvfh~~~~D~~~~l~rG~  235 (421)
T PRK04183        184 FVGAQRSSDRPSSDAAMNLIAAVL-AATSDIAEVVVVMHGETSDTYCALHRGT  235 (421)
T ss_pred             EECCCCCCCCCCCCHHHHHHHHHH-HHCCCCCCCEEEECCCCCCCEEEEEECC
T ss_conf             968777888868607999999999-8647999877997231477636888615


No 342
>pfam10421 OAS1_C 2'-5'-oligoadenylate synthetase 1, domain 2, C-terminus. This is the largely alpha-helical, C-terminal half of 2'-5'-oligoadenylate synthetase 1, being described as domain 2 of the enzyme and homologous to a tandem ubiquitin repeat. It carries the region of enzymic activity between 320 and 344 at the extreme C-terminal end. Oligoadenylate synthetases are antiviral enzymes that counteract vial attack by degrading viral RNA. The enzyme uses ATP in 2'-specific nucleotidyl transfer reactions to synthesize 2'.5'-oligoadenylates, which activate latent ribonuclease, resulting in degradation of viral RNA and inhibition of virus replication. This domain is often associated with NTP_transf_2 pfam01909.
Probab=31.62  E-value=32  Score=15.78  Aligned_cols=39  Identities=36%  Similarity=0.334  Sum_probs=26.2

Q ss_pred             CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEE
Q ss_conf             871687117774212234532126388999999999971898899
Q gi|254780669|r  217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF  261 (301)
Q Consensus       217 ~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlf  261 (301)
                      .-|||.||.--+      ++..+|.+.-=..+|++|..+--.--|
T Consensus       136 ~RPvILDPADPT------~NV~~~~~~~W~~la~eA~~wl~~~c~  174 (191)
T pfam10421       136 PRPVILDPADPT------NNVAGGNIQGWDLLAKEAAAWLDSPCF  174 (191)
T ss_pred             CCCEEECCCCCC------CCCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             898114899975------441247510689999999999848121


No 343
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990    Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase     IMP dehydrogenase (1.1.1.205 from EC,IMPDH) catalyzes the rate-limiting reaction of de novo GTP biosynthesis, the NAD-dependent reduction of IMP into XMP .  Inosine 5-phosphate + NAD+ + H2O = xanthosine 5-phosphate + NADH     IMP dehydrogenase is associated with cell proliferation and is a possible target for cancer chemotherapy. Mammalian and bacterial IMPDHs are tetramers of identical chains. There are two IMP dehydrogenase isozymes in humans . IMP dehydrogenase nearly always contains a long insertion that has two CBS domains within it and adopts a TIM barrel structure.; GO: 0003938 IMP dehydrogenase activity, 0006177 GMP biosynthetic process.
Probab=31.47  E-value=42  Score=15.02  Aligned_cols=48  Identities=25%  Similarity=0.433  Sum_probs=22.4

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHH-CCEEEE-ECCCHHHHHHHHH-HCCEEEEC
Q ss_conf             2224567124888999886652-876885-2288999987650-21578822
Q gi|254780669|r   93 AGKRGVGLKKGREIFRDLKKKY-GFPILT-DVHTEQQCEAIAD-SVDILQIP  141 (301)
Q Consensus        93 ~sfrG~Gle~gL~il~e~k~~~-glpv~T-eV~~~~~~e~~~~-~vDilQIg  141 (301)
                      +|=||.-+ .-|+.++++|+.| .+.|+- =|-..+|++.+-+ .+|.|.||
T Consensus       258 DsshGhs~-~vl~~ik~~k~~Yp~~~iiaGNVaT~~~a~~LI~AgADg~rVG  308 (476)
T TIGR01302       258 DSSHGHSI-YVLDSIKKIKKTYPDLDIIAGNVATAEQAKALIDAGADGLRVG  308 (476)
T ss_pred             ECCCCCCH-HHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHCCCCEEEEC
T ss_conf             16654537-8999999998638805799434411788988985288878983


No 344
>cd03313 enolase Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways. The reaction is facilitated by the presence of metal ions.
Probab=30.89  E-value=42  Score=14.96  Aligned_cols=93  Identities=20%  Similarity=0.260  Sum_probs=39.6

Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHH----HCCEEEECH--HHCCCHHHHHHHHHC--CCEEEEECCCCCCHH
Q ss_conf             248889998866528768852288999987650----215788225--762899999998505--977998367778999
Q gi|254780669|r  101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIAD----SVDILQIPA--LLCRQTDLLTAAAQT--GRVINVKKGQFLSPW  172 (301)
Q Consensus       101 e~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~----~vDilQIgA--~~~rqtdLl~a~a~t--~kpV~iKkgq~~s~~  172 (301)
                      ++=.+++.+.-++|-+--+-|=.+.++-+--.+    .-+-+||=.  ..+.|.+.|+..-+.  -.-|+||=.|-.|+.
T Consensus       264 ~e~i~~y~~l~~kYPIisIEDp~~E~D~~gw~~lt~~lg~~~qiVGDDL~vTn~~rl~~gi~~~~~naiLiK~NQiGTvs  343 (408)
T cd03313         264 EELIDYYKELVKKYPIVSIEDPFDEDDWEGWAKLTAKLGDKIQIVGDDLFVTNPERLKKGIEKKAANALLIKVNQIGTLT  343 (408)
T ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHCCCCCEEEEECCCCCCHH
T ss_conf             99999999999759877885688721278999999865980799887424478899860565176637998054577299


Q ss_pred             HHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             9999999997258780899514
Q gi|254780669|r  173 EMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       173 e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      |.+.+++-....|- .+++.+|
T Consensus       344 et~ea~~la~~~g~-~~ivShR  364 (408)
T cd03313         344 ETIEAIKLAKKNGY-GVVVSHR  364 (408)
T ss_pred             HHHHHHHHHHHCCC-EEEEECC
T ss_conf             99999999998698-7999789


No 345
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase; InterPro: IPR004393   Nicotinate-nucleotide pyrophosphorylase (2.4.2.19 from EC), also known as quinolinate phosphoribosyltransferase (decarboxylating), catalyses the conversion of nicotinate D-ribonucleotide, pyrophosphate and carbon dioxide into pyridine-2,3-dicarboxylate and 5-phospho-alpha-D-ribose 1-diphosphate. This enzyme is a type II phosphoribosyltransferase which provides the de novo source of nicotinate mononucleotide (NAMN) for NAD biosynthesis in both prokaryotes and eukaryotes , .   Structural studies have shown that the active form of this enzyme is a homodimer with an unsual fold , , . The N-terminal forms a mixed alpha/beta domain, while the C-terminal region forms a multi-stranded, open alpha/beta barrel. The active site is found at the C-terminal ends of the beta strands of the alpha/beta barrel, and is bordered by the N-terminal domain of the second subunit of the dimer. It contains several conserved charged residues thought to be important determinants of substrate binding and catalysis. ; GO: 0004514 nicotinate-nucleotide diphosphorylase (carboxylating) activity, 0019363 pyridine nucleotide biosynthetic process.
Probab=30.82  E-value=43  Score=14.95  Aligned_cols=69  Identities=20%  Similarity=0.343  Sum_probs=51.6

Q ss_pred             CCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHH
Q ss_conf             712488899988665287688522889999876502-1578822576289999999850597799836777899999999
Q gi|254780669|r   99 GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNI  177 (301)
Q Consensus        99 Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a  177 (301)
                      |++++++=.++. --|-.+|--||-..+|++.+++. +||+=                       |=|   |+|+++..+
T Consensus       171 s~~~Av~~aR~~-~~~~~kiEVEVenlE~a~eA~~AGADiIm-----------------------LDN---m~p~~~~~a  223 (276)
T TIGR00078       171 SIEKAVKRARAA-LPFAKKIEVEVENLEEAEEAAEAGADIIM-----------------------LDN---MKPEEIKEA  223 (276)
T ss_pred             CHHHHHHHHHHH-CCCCCEEEEEECCHHHHHHHHHCCCCEEE-----------------------CCC---CCHHHHHHH
T ss_conf             989999999984-89980799862898999999970995998-----------------------069---894799999


Q ss_pred             HHHHHHCCCCCEEEEECC
Q ss_conf             999972587808995146
Q gi|254780669|r  178 LQKLHAHGAKDVLFCERG  195 (301)
Q Consensus       178 ~eki~~~Gn~~i~lcERG  195 (301)
                      ++.+...++ ++++==-|
T Consensus       224 v~~~~~~~p-~~~~EaSG  240 (276)
T TIGR00078       224 VELLKGRNP-NVLVEASG  240 (276)
T ss_pred             HHHHHHCCC-EEEEEEEC
T ss_conf             999970299-08999836


No 346
>PRK03991 threonyl-tRNA synthetase; Validated
Probab=30.80  E-value=43  Score=14.95  Aligned_cols=154  Identities=12%  Similarity=0.065  Sum_probs=80.5

Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCE---
Q ss_conf             99999999965533997066015576886663222456712488899988665287688522889999876502157---
Q gi|254780669|r   61 FMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDI---  137 (301)
Q Consensus        61 ~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDi---  137 (301)
                      ....+.+.+....+++.+...      -|++..     =+++.-.||.++-++.|.|+.-|+-...-.=. .--+|+   
T Consensus       356 ~~~~~li~~v~~~fG~~y~~~------~r~t~e-----~w~~ae~~l~~~~~~~g~~~~~e~~~g~~~fy-GPKIDf~v~  423 (613)
T PRK03991        356 EKQHKLILETGRDLGRDYEVA------FRFTED-----FYEENKDWIVELAKREGKPVLVEILPERKHYW-VLKVEFAII  423 (613)
T ss_pred             HHHHHHHHHHHHHCCCCEEEE------ECCCHH-----HHHHHHHHHHHHHHHCCCCCEEEECCCCCCEE-CCCEEEEEE
T ss_conf             999999999998639763799------707888-----88899999999999729971476658763143-141689998


Q ss_pred             -----------EEECHHHCCCHHH--HHHHHHCCCEEEEECCCCCCHHHHHHH-HHHHH---HCCC---CCEEEEECCCC
Q ss_conf             -----------8822576289999--999850597799836777899999999-99997---2587---80899514654
Q gi|254780669|r  138 -----------LQIPALLCRQTDL--LTAAAQTGRVINVKKGQFLSPWEMHNI-LQKLH---AHGA---KDVLFCERGTS  197 (301)
Q Consensus       138 -----------lQIgA~~~rqtdL--l~a~a~t~kpV~iKkgq~~s~~e~~~a-~eki~---~~Gn---~~i~lcERG~~  197 (301)
                                 +|+---+-..++|  +.+-++...||+|-|..+.|.+-++++ .|+..   ..|+   --+||.-+-..
T Consensus       424 DalGR~wq~~TiQlDf~lp~RF~l~Yv~edg~~~~PvmiHrAi~GS~ERfi~~LiE~~ag~~~~Gk~p~~P~WLaP~Qv~  503 (613)
T PRK03991        424 DSLGRPIENPTVQIDVENAERFGIKYVDENGKEKYPVILHCSPTGSIERVIYALLEKAAKEEKEGKVPMLPTWLSPVQVR  503 (613)
T ss_pred             ECCCCCEEEEEEEEECCCHHHCCCEEECCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEE
T ss_conf             46897245015898327832268789989998958858972665639999999999850101247878888787860379


Q ss_pred             C-CCHHHCCCCC--CCHHHHHHCCCEEECHHH
Q ss_conf             4-4010000000--106888518716871177
Q gi|254780669|r  198 F-GYNTLVTDMR--SIPIMTSMGVPVIFDASH  226 (301)
Q Consensus       198 f-gy~~lvvD~~--~i~~lk~~~~PVi~D~SH  226 (301)
                      . .-++-..|+.  -...|++.++-|-+|-+-
T Consensus       504 iiPVs~~~~~ya~~v~~~L~~~giRv~vD~r~  535 (613)
T PRK03991        504 VIPVSEEHLDYAEEVADKLEAAGIRVDVDDRD  535 (613)
T ss_pred             EEEECHHHHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             99707368999999999999779889987788


No 347
>cd03085 PGM1 Phosphoglucomutase 1 (PGM1) catalyzes the bidirectional interconversion of glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P) via a glucose 1,6-diphosphate intermediate, an important metabolic step in prokaryotes and eukaryotes. In one direction, G-1-P produced from sucrose catabolism is converted to G-6-P, the first intermediate in glycolysis. In the other direction, conversion of G-6-P to G-1-P generates a substrate for synthesis of UDP-glucose which is required for synthesis of a variety of cellular constituents including cell wall polymers and glycoproteins. The PGM1 family also includes a non-enzymatic PGM-related protein (PGM-RP) thought to play a structural role in eukaryotes, as well as pp63/parafusin, a phosphoglycoprotein that plays an important role in calcium-regulated exocytosis in ciliated protozoans. PGM1 belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl t
Probab=30.75  E-value=43  Score=14.95  Aligned_cols=25  Identities=12%  Similarity=0.088  Sum_probs=9.7

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             9954863499999999999999965
Q gi|254780669|r   47 LIAGPCQIESHDHAFMIAEKLYAIC   71 (301)
Q Consensus        47 iIAGPCsiES~e~~~~~A~~lk~~~   71 (301)
                      +|+.=+=.-|++-+..+|+-+...|
T Consensus        53 vIGyD~R~~S~~fA~~~A~VlaanG   77 (548)
T cd03085          53 VVGGDGRYYNKEAIQIIIKIAAANG   77 (548)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCC
T ss_conf             9985788678999999999998789


No 348
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed
Probab=30.71  E-value=43  Score=14.94  Aligned_cols=63  Identities=17%  Similarity=0.234  Sum_probs=29.9

Q ss_pred             HHHHHHHHHHHHCCEEEE-ECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHH-CCCEEEEEC
Q ss_conf             888999886652876885-22889999876-502157882-----2576289999999850-597799836
Q gi|254780669|r  103 GREIFRDLKKKYGFPILT-DVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQ-TGRVINVKK  165 (301)
Q Consensus       103 gL~il~e~k~~~glpv~T-eV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~-t~kpV~iKk  165 (301)
                      ...++++.-.+||+.+.- |..+.+.++.+ .+...++++     |..-+.+-+-+.++|+ .|.++.+-+
T Consensus       117 t~~l~~~~l~~~Gi~~~~vd~~d~~~~~~ai~~~Tklv~~EspsNP~l~v~Di~~ia~iA~~~g~~~vVDN  187 (397)
T PRK07504        117 CRYVVETLLPRYGIESTLVDGLDLDNWEKAVRPNTKVFFLESPTNPTLEVIDIAAVAEIANQAGAKLVVDN  187 (397)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCEECCCHHHHHHHHHCCCEEEEEC
T ss_conf             99999999860785899878988588997458775399985489997451371999999998299599736


No 349
>cd05801 PGM_like3 This bacterial PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Probab=30.69  E-value=43  Score=14.94  Aligned_cols=43  Identities=19%  Similarity=0.320  Sum_probs=21.2

Q ss_pred             HHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHH
Q ss_conf             8885187168711777421223453212638899999999997189889998369833
Q gi|254780669|r  212 IMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD  269 (301)
Q Consensus       212 ~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~  269 (301)
                      .+++.++.|++||-|.+           | ..+++.+.+   .+|++-..+..++||+
T Consensus       205 ~i~~~~lkIv~d~~~Ga-----------g-~~~~~~ll~---~~g~~v~~v~~~~dp~  247 (522)
T cd05801         205 AIRKSGLRLGVDPLGGA-----------S-VPYWQPIAE---KYGLNLTVVNPKVDPT  247 (522)
T ss_pred             HHCCCCCEEEEECCCCC-----------C-CHHHHHHHH---HCCCCEEEECCCCCCC
T ss_conf             55016976999668987-----------4-115899998---8299879989825799


No 350
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=30.63  E-value=43  Score=14.93  Aligned_cols=67  Identities=16%  Similarity=0.219  Sum_probs=34.2

Q ss_pred             CCHHHHHHHHHH-HHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEE---EC--CCCCCHH
Q ss_conf             712488899988-66528768852288999987650215788225762899999998505977998---36--7778999
Q gi|254780669|r   99 GLKKGREIFRDL-KKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV---KK--GQFLSPW  172 (301)
Q Consensus        99 Gle~gL~il~e~-k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~i---Kk--gq~~s~~  172 (301)
                      |-+.-..+++.. +..-++-.+-|..+.++.+.+.+..            .++|......+.|++|   |.  ...++++
T Consensus        67 G~~~~~~~~~~y~~~a~~iI~VvD~td~~~~~~~~~~l------------~~~l~~~~~~~~PiLiv~NK~Dl~~a~~~~  134 (173)
T cd04155          67 GQRAIRPYWRNYFENTDCLIYVIDSADKKRLEEAGAEL------------VELLEEEKLAGVPVLVFANKQDLATAAPAE  134 (173)
T ss_pred             CCHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHH------------HHHHHHHHCCCCCEEEEEECCCCCCCCCHH
T ss_conf             75101268997655563799999667568899999999------------999741300698389999766677789999


Q ss_pred             HHHHH
Q ss_conf             99999
Q gi|254780669|r  173 EMHNI  177 (301)
Q Consensus       173 e~~~a  177 (301)
                      +....
T Consensus       135 eI~~~  139 (173)
T cd04155         135 EIAEA  139 (173)
T ss_pred             HHHHH
T ss_conf             99998


No 351
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR010210   This entry represents a clade of primarily archaeal sequences related to fructose-bisphosphate aldolase. The members appear to be phospho-2-dehydro-3-deoxyheptonate aldolases. This enzyme is the first step of the chorismate biosynthesis pathway. Evidence for this assignment is based on gene clustering and phylogenetic profiling. A group of species lack members of the three other types of phospho-2-dehydro-3-deoxyheptonate aldolase (represented by IPR006219 from INTERPRO, IPR002480 from INTERPRO and IPR006268 from INTERPRO), and also apparently lack the well-known forms of step 2 (3-dehydroquinate synthase), but contain all other steps of the pathway: Aquifex, Archaeoglobus, Halobacterium, Methanococcus, Methanopyrus and Methanobacterium. In Aquifex, Archaeoglobus, Halobacterium, Methanopyrus and Methanosarcina the genes are clustered with other genes from the chorismate, phenylalanine, tyrosine and tryptophan biosynthesis pathways. In addition, these genes in Archaeoglobus, Halobacterium, and Methanosarcina are adjacent to 3-dehydroquinate synthase (IPR002812 from INTERPRO) which also has the property of having members only in those species which lack steps 1 and 2. Together these two genes appear to perform the synthesis of 3-dehydroquinate. It is presumed that the substrates and the chemical transformations involved are identical, but this has not yet been proven experimentally..
Probab=30.59  E-value=43  Score=14.93  Aligned_cols=50  Identities=16%  Similarity=0.195  Sum_probs=24.4

Q ss_pred             CCEEEECHH-HCCCHHHHHHHHHCCCEEEEECCCC-CCHHHHHHHHHHHHHCCC
Q ss_conf             157882257-6289999999850597799836777-899999999999972587
Q gi|254780669|r  135 VDILQIPAL-LCRQTDLLTAAAQTGRVINVKKGQF-LSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       135 vDilQIgA~-~~rqtdLl~a~a~t~kpV~iKkgq~-~s~~e~~~a~eki~~~Gn  186 (301)
                      +||+-+|.- -++  ..-.-+.-+.+||.|==|.= .|-.|+|.-++=-...|.
T Consensus       171 ADvvK~~Y~Gd~~--SF~~VV~~c~~PVvvAGG~k~~s~~efLq~v~DA~~aGA  222 (259)
T TIGR01949       171 ADVVKVPYTGDID--SFEEVVKACAVPVVVAGGPKLASDREFLQMVKDAMEAGA  222 (259)
T ss_pred             CCEEEECCCCCHH--HHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             7766514317746--799996217877787377798874677788999998187


No 352
>cd00280 TRFH Telomeric Repeat binding Factor or TTAGGG Repeat binding Factor, central (dimerization) domain Homology; TRFH. Telomeres are protein/DNA complexes that make up the physical ends of eukaryotic linear chromosomes and are essential for chromosome stability, protecting the chromosome ends from degradation and end-to-end fusion. Proteins TRF1, TRF2 and Taz1 bind telomeric DNA and are also involved in recruiting interacting proteins, TIN2, and Rap1, to the telomeres. It has also been demonstrated that PARP1 associates with TRF2 and is capable of poly(ADP-ribosyl)ation of TRF2, which affects binding of TRF2 to telomeric DNA. TRF1, TRF2 and Taz1 proteins contain three functional domains: an N-terminal acidic domain, a central TRF-specific/dimerization domain, and a C-terminal DNA binding domain with a single Myb-like repeat. Homodimerization, a prerequisite to DNA binding, results in the juxtaposition of two Myb DNA binding domains.
Probab=30.58  E-value=43  Score=14.93  Aligned_cols=60  Identities=18%  Similarity=0.422  Sum_probs=44.8

Q ss_pred             EEECCCCCCC-HHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCE
Q ss_conf             9954863499-9999999999999655339970660155768866632224567124888999886652876
Q gi|254780669|r   47 LIAGPCQIES-HDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFP  117 (301)
Q Consensus        47 iIAGPCsiES-~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glp  117 (301)
                      ++-||--++. -.....++..|..+..    |--.-.+||..+|-+|       ||-+|.+|.-+++++.+|
T Consensus        42 ll~g~~~~~~~~~k~~~i~QfL~RI~e----G~~LD~~Fd~~~~lTP-------LESAl~v~~~I~kE~~~~  102 (200)
T cd00280          42 LLVGPLKLTATQLKTLRIMQFLSRIAE----GKNLDCQFENDEELTP-------LESALMVLESIEKEFSLP  102 (200)
T ss_pred             HHHCCCCCCCCCHHHHHHHHHHHHHHC----CCCCCCCCCCCCCCCC-------HHHHHHHHHHHHHHCCCC
T ss_conf             982633577421137499999999961----7887871688777680-------899999999999851770


No 353
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed
Probab=30.31  E-value=43  Score=14.90  Aligned_cols=97  Identities=15%  Similarity=0.133  Sum_probs=55.2

Q ss_pred             CCCCCCCHHHHHHHHHHHHHH-CCEEEEEC---CCHHH---HHHH--HHHCCEEEE--------CHH-HCCCH----HHH
Q ss_conf             224567124888999886652-87688522---88999---9876--502157882--------257-62899----999
Q gi|254780669|r   94 GKRGVGLKKGREIFRDLKKKY-GFPILTDV---HTEQQ---CEAI--ADSVDILQI--------PAL-LCRQT----DLL  151 (301)
Q Consensus        94 sfrG~Gle~gL~il~e~k~~~-glpv~TeV---~~~~~---~e~~--~~~vDilQI--------gA~-~~rqt----dLl  151 (301)
                      +|.-.|++.-++.+.+.+++. +.|++--+   ...+.   ++.+  +++.|++-|        |-+ +.++.    +++
T Consensus        70 G~~n~G~~~~~~~l~~~~~~~~~~~vi~si~g~~~~e~~~~~~~~~~~~~~~~ielNiScPNt~g~~~~~~d~~~~~~il  149 (308)
T PRK02506         70 GLPNNGFDYYLDYVLDLQKTGPHKPHFLSVVGLSPEETHTILKKIQASDFEGLVELNLSCPNVPGKPQIAYDFETTDQIL  149 (308)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHH
T ss_conf             47856389999988999962799975888850775377888999875475425546333788510555522899999999


Q ss_pred             HHHHH-CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             99850-5977998367778999999999999725878089
Q gi|254780669|r  152 TAAAQ-TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVL  190 (301)
Q Consensus       152 ~a~a~-t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~  190 (301)
                      .++.+ ..+||.+|=..++++.+...+++-+...|-.-+.
T Consensus       150 ~~v~~~~~~Pi~vKlsP~~~~~~~~~~a~~~~~~~~~~i~  189 (308)
T PRK02506        150 TEVFTYFTKPLGVKLPPYFDIVHFDQAAAIFNKYPLAFVN  189 (308)
T ss_pred             HHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEE
T ss_conf             9999875033345589877767699999985615653798


No 354
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]
Probab=30.31  E-value=43  Score=14.90  Aligned_cols=48  Identities=17%  Similarity=0.181  Sum_probs=33.0

Q ss_pred             HHHHHHHH---CCCEEEEECC-------CCCCHHHHHHHHHHHHHCCC-CCEEEEECCC
Q ss_conf             99999850---5977998367-------77899999999999972587-8089951465
Q gi|254780669|r  149 DLLTAAAQ---TGRVINVKKG-------QFLSPWEMHNILQKLHAHGA-KDVLFCERGT  196 (301)
Q Consensus       149 dLl~a~a~---t~kpV~iKkg-------q~~s~~e~~~a~eki~~~Gn-~~i~lcERG~  196 (301)
                      ++++++-+   -+.||.++=.       ...+++|....++.+...|. .-+.+.+=+.
T Consensus       204 EVv~aVr~~vg~~~~vg~Rls~~d~~~~~g~~~~e~~~la~~L~~~G~~d~i~vs~~~~  262 (363)
T COG1902         204 EVVDAVREAVGADFPVGVRLSPDDFFDGGGLTIEEAVELAKALEEAGLVDYIHVSEGGY  262 (363)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             99999999729886699997745467788888999999999998558844799603644


No 355
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR; InterPro: IPR014075   Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] . FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems.   The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins , . It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly .   The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA . SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA , acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets.   In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins . Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen .   This entry represents members of the SufR cyanobacterial protein family of transcriptional regulators that control the SUF system. In all cases, the sufR gene is encoded near SUF system genes but in the opposite direction. This DNA-binding protein belongs to the DeoR family of helix-loop-helix proteins. All members also have a probable metal-binding motif C-X(12)-C-X(13)-C-X(14)-C near the C-terminus..
Probab=30.20  E-value=37  Score=15.36  Aligned_cols=29  Identities=24%  Similarity=0.223  Sum_probs=24.1

Q ss_pred             CCHHHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             63889999999999718988999836983
Q gi|254780669|r  240 GERQYIVPLAKAAVAIGIAGIFLETHQDP  268 (301)
Q Consensus       240 G~r~~v~~la~aa~a~G~dGlfiE~Hp~P  268 (301)
                      |.-.+...+++=+--=-..|+|.|+||-|
T Consensus       124 G~G~L~~Rl~~Lv~LR~~EGyMAE~hP~~  152 (215)
T TIGR02702       124 GQGSLAERLAKLVALRQQEGYMAEVHPVS  152 (215)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             89977899999999974068725530588


No 356
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=30.08  E-value=44  Score=14.87  Aligned_cols=102  Identities=14%  Similarity=0.145  Sum_probs=43.7

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHH-HHHHHHHCCEEEEECCC
Q ss_conf             99954863499999999999999965533997066015576886663222456712488899-98866528768852288
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIF-RDLKKKYGFPILTDVHT  124 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il-~e~k~~~glpv~TeV~~  124 (301)
                      ++|.|++.+=--..+......- .....-.+|+-++. +.. +..+..-|--.|-+.-..++ .-.+...++-.|-|..+
T Consensus        16 ililG~~~~GKTsil~~l~~~~-~~~~~pTvg~~~~~-~~~-~~~~l~iwD~~Gqe~~r~l~~~Yy~~a~~iIfVvD~sd   92 (175)
T smart00177       16 ILMVGLDAAGKTTILYKLKLGE-SVTTIPTIGFNVET-VTY-KNISFTVWDVGGQDKIRPLWRHYYTNTQGLIFVVDSND   92 (175)
T ss_pred             EEEECCCCCCHHHHHHHHHCCC-CCCCCCCCCCEEEE-EEE-CCEEEEEEECCCCCCCCHHHHHHCCCCCEEEEEEECCC
T ss_conf             9999889999899999996599-77757978810799-998-98999999899985455367775577618999986687


Q ss_pred             HHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEE
Q ss_conf             9999876502-15788225762899999998505977998
Q gi|254780669|r  125 EQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINV  163 (301)
Q Consensus       125 ~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~i  163 (301)
                      ....+.+.+. -++++-+             .-.+.|++|
T Consensus        93 ~~~~~~~~~~l~~~l~~~-------------~~~~~piLi  119 (175)
T smart00177       93 RDRIDEAREELHRMLNED-------------ELRDAVILV  119 (175)
T ss_pred             HHHHHHHHHHHHHHHCCH-------------HHCCCEEEE
T ss_conf             789999999999996315-------------316986999


No 357
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion]
Probab=30.04  E-value=44  Score=14.87  Aligned_cols=164  Identities=18%  Similarity=0.240  Sum_probs=89.2

Q ss_pred             CCEEEEECCCHH-----HHHHHHHH-CCEEEECHHH--CCCH-HHHHHHHHCCCE----EEEECCCCCCHHHHHHHHHHH
Q ss_conf             876885228899-----99876502-1578822576--2899-999998505977----998367778999999999999
Q gi|254780669|r  115 GFPILTDVHTEQ-----QCEAIADS-VDILQIPALL--CRQT-DLLTAAAQTGRV----INVKKGQFLSPWEMHNILQKL  181 (301)
Q Consensus       115 glpv~TeV~~~~-----~~e~~~~~-vDilQIgA~~--~rqt-dLl~a~a~t~kp----V~iKkgq~~s~~e~~~a~eki  181 (301)
                      |...+.==|.++     .++.+++. +||+.|=--+  .||. .-++++.+.|.-    +..-...-.+.+-|...++.+
T Consensus        86 GQNlvGYrhyaDDvVe~Fv~ka~~nGidvfRiFDAlND~RNl~~ai~a~kk~G~h~q~~i~YT~sPvHt~e~yv~~akel  165 (472)
T COG5016          86 GQNLVGYRHYADDVVEKFVEKAAENGIDVFRIFDALNDVRNLKTAIKAAKKHGAHVQGTISYTTSPVHTLEYYVELAKEL  165 (472)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECHHCCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             37513656784589999999998648757972111046467999999999618636899874268865289999999999


Q ss_pred             HHCCCCCEEEEEC-CCCCCCHHHCCCCCCCHHHHH-HCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCE
Q ss_conf             7258780899514-654440100000001068885-18716871177742122345321263889999999999718988
Q gi|254780669|r  182 HAHGAKDVLFCER-GTSFGYNTLVTDMRSIPIMTS-MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG  259 (301)
Q Consensus       182 ~~~Gn~~i~lcER-G~~fgy~~lvvD~~~i~~lk~-~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dG  259 (301)
                      .+.|.+.|.+-.- |+...|.-    .--+-.+|+ +++||.+- ||++          .|-..   ..-.+|+-+|+|+
T Consensus       166 ~~~g~DSIciKDmaGlltP~~a----yelVk~iK~~~~~pv~lH-tH~T----------sG~a~---m~ylkAvEAGvD~  227 (472)
T COG5016         166 LEMGVDSICIKDMAGLLTPYEA----YELVKAIKKELPVPVELH-THAT----------SGMAE---MTYLKAVEAGVDG  227 (472)
T ss_pred             HHCCCCEEEEECCCCCCCHHHH----HHHHHHHHHHCCCEEEEE-CCCC----------CCHHH---HHHHHHHHHCCCH
T ss_conf             9727987884000026986889----999999997459706985-0455----------56179---9999999817642


Q ss_pred             EEE--------EECCCHHH---CCC--CCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             999--------83698334---797--82018688999999999999999
Q gi|254780669|r  260 IFL--------ETHQDPDN---APS--DGPNMINIKDLPKLLSQLLAIDK  296 (301)
Q Consensus       260 lfi--------E~Hp~P~~---Als--D~~q~l~l~~l~~ll~~l~~i~~  296 (301)
                      +=.        -.||.-+.   |+-  +-.+-++++.++.+-.-.+.+++
T Consensus       228 iDTAisp~S~gtsqP~tEtmv~aL~gt~yDtgld~~~l~~~~~yf~~vrk  277 (472)
T COG5016         228 IDTAISPLSGGTSQPATETMVAALRGTGYDTGLDLELLEEIAEYFREVRK  277 (472)
T ss_pred             HHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             22100455578889958999999627998765369999999999999999


No 358
>PRK07564 phosphoglucomutase; Validated
Probab=30.04  E-value=44  Score=14.87  Aligned_cols=25  Identities=20%  Similarity=0.058  Sum_probs=9.3

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             9954863499999999999999965
Q gi|254780669|r   47 LIAGPCQIESHDHAFMIAEKLYAIC   71 (301)
Q Consensus        47 iIAGPCsiES~e~~~~~A~~lk~~~   71 (301)
                      +|+.=+=.-|++-+..+|+-+...|
T Consensus        82 vIg~D~R~~S~~fa~~aa~VlaanG  106 (544)
T PRK07564         82 FVGGDTHALSEPAIQSALEVLAANG  106 (544)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCC
T ss_conf             9984788679999999999998789


No 359
>PRK00843 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenase; Reviewed
Probab=29.96  E-value=44  Score=14.86  Aligned_cols=54  Identities=13%  Similarity=0.261  Sum_probs=29.2

Q ss_pred             CCCEEEECCCEEEECCCC-C---C-E-EECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             876178317706835787-7---2-7-97699706999548634999999999999999655
Q gi|254780669|r   17 DKNHMIHTNAAIHLGSGK-N---Q-V-TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQ   72 (301)
Q Consensus        17 ~~~~~~~~~~~~~ig~~~-~---~-i-~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~   72 (301)
                      ++.+++...+.+.+|.+. .   . + .++-+++.++|+||.+.+-...  .+.+.|++.+.
T Consensus         3 ~~~r~i~~P~~iiiG~Gal~~lg~~l~~l~~~~k~lII~d~~v~~~~g~--~v~~sL~~~g~   62 (351)
T PRK00843          3 NKARWMQLPREVYIGHGVIEEIGDVCRDLKLKGNALIVTGPTTKEIAGK--KVEDSLKDAGF   62 (351)
T ss_pred             CCCCEEECCCEEEECCCHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHH--HHHHHHHHCCC
T ss_conf             5452621896589897979999999997089995899989527899999--99999986698


No 360
>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129   Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components. In Escherichia coli K-12, the arginine-ornithine transport system requires an arginine-ornithine-binding protein and the lysine-arginine-ornithine (LAO) transport system includes a LAO-binding protein. Both periplasmic proteins can be phosphorylated by a single kinase, ArgK  resulting in reduced levels of transport activity of the periplasmic transport systems that include each of the binding proteins. The ArgK protein acts as an ATPase enzyme and as a kinase..
Probab=29.74  E-value=44  Score=14.84  Aligned_cols=33  Identities=27%  Similarity=0.176  Sum_probs=24.6

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             234532126388999999999971898899983
Q gi|254780669|r  232 GIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       232 ~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      -+..|..||-..-.-.+-+---|+|+|=+||||
T Consensus       112 ~ptrG~lGGls~at~~~~~lldA~G~DVI~vET  144 (333)
T TIGR00750       112 MPTRGSLGGLSKATRELVKLLDAAGYDVILVET  144 (333)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             766675257879999999999863898799984


No 361
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB d
Probab=29.72  E-value=44  Score=14.83  Aligned_cols=62  Identities=16%  Similarity=0.174  Sum_probs=48.6

Q ss_pred             HHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHH-HHCCCEEEEECC
Q ss_conf             89998866528768852288999987650215788225762899999998-505977998367
Q gi|254780669|r  105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA-AQTGRVINVKKG  166 (301)
Q Consensus       105 ~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~-a~t~kpV~iKkg  166 (301)
                      +-+++.-++.|+++.-+-....+++...+..|++=++--.....+-+++. +..++||-+=-.
T Consensus        17 ~km~~~a~~~~~~~~i~A~~~~~~~~~~~~~DviLl~PQv~y~~~~i~~~~~~~~ipV~vI~~   79 (96)
T cd05564          17 KKMKKAAEKRGIDAEIEAVPESELEEYIDDADVVLLGPQVRYMLDEVKKKAAEYGIPVAVIDM   79 (96)
T ss_pred             HHHHHHHHHCCCCEEEEEEEHHHHHHHHHCCCEEEECCHHHHHHHHHHHHHHHCCCCEEEECH
T ss_conf             999999997499779999648999977415999997727999999999986104992796073


No 362
>pfam03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ. Members of this family belong to the PdxJ family that catalyses the condensation of 1-deoxy-d-xylulose-5-phosphate (DXP) and 1-amino-3-oxo-4-(phosphohydroxy)propan-2-one to form pyridoxine 5'-phosphate (PNP). This reaction is involved in de novo synthesis of pyridoxine (vitamin B6) and pyridoxal phosphate.
Probab=29.71  E-value=41  Score=15.07  Aligned_cols=35  Identities=23%  Similarity=0.264  Sum_probs=16.3

Q ss_pred             HHHHHHHHHCCEEEEEC-CCHHHHHHHHHH-CCEEEEC
Q ss_conf             99988665287688522-889999876502-1578822
Q gi|254780669|r  106 IFRDLKKKYGFPILTDV-HTEQQCEAIADS-VDILQIP  141 (301)
Q Consensus       106 il~e~k~~~glpv~TeV-~~~~~~e~~~~~-vDilQIg  141 (301)
                      +.+++++. |+.|--=| -+++|++.+++. +|.+-+=
T Consensus       116 ~i~~lk~~-girvSlFIDpd~~~i~~a~~~Gad~VElh  152 (239)
T pfam03740       116 AIRRLKNA-GIRVSLFIDPDPEQIEAAKIVGADRIELH  152 (239)
T ss_pred             HHHHHHCC-CCEEEEEECCCHHHHHHHHHCCCCEEEEE
T ss_conf             99998607-85389970799899999998092999850


No 363
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II; InterPro: IPR011289   Fructose-1,6-bisphosphate (FBP) aldolases reversibly cleave FBP to two triose phosphates, glycerone phophate and D-glyceraldehyde 3-phosphate. They play a key role in both glycolysis (FBP cleavage) and gluconeogenesis (FBP synthesis). These enzymes can be divide into two classes based on their mode of catalysis. Class I FBP aldolases form a Schiff-base intermediate between glycerone phophate and an active site lysine residue, while the class II enzymes use a divalent cation such as Zn(2+) for catalysis .   This entry represents class II FBP aldolases found in Gram-positive bacteria, a variety of Gram-negative baceria, and amitochondriate protists. These enzymes are homotetramers where each momomer forms a TIM barrel fold .; GO: 0004332 fructose-bisphosphate aldolase activity, 0008270 zinc ion binding, 0006096 glycolysis, 0030388 fructose 16-bisphosphate metabolic process.
Probab=29.71  E-value=44  Score=14.83  Aligned_cols=111  Identities=17%  Similarity=0.298  Sum_probs=63.7

Q ss_pred             EEEECHHHCCCHHHHH----HHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHH
Q ss_conf             7882257628999999----985059779983677789999999999997258780899514654440100000001068
Q gi|254780669|r  137 ILQIPALLCRQTDLLT----AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI  212 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~----a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~  212 (301)
                      =+=|||||.=|.+.++    |+-+++-||+|==.        .+|+.|+-   .-+       .+.||.+.+   .-|-.
T Consensus        15 gYAvGaFN~NNlE~~qAIl~AAee~~SPVI~q~S--------eGA~KY~G---kGd-------~~~G~~~~~---~mV~~   73 (339)
T TIGR01859        15 GYAVGAFNINNLEWTQAILQAAEEERSPVIVQVS--------EGAIKYMG---KGD-------ATLGYKVAV---AMVKT   73 (339)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEHH--------HHHHHCCC---CCH-------HHHHHHHHH---HHHHH
T ss_conf             8311420121689999999999873687553120--------27874048---531-------778899999---99999


Q ss_pred             H-HHH--CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             8-851--8716871177742122345321263889999999999718988999836983347978201868899999999
Q gi|254780669|r  213 M-TSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLS  289 (301)
Q Consensus       213 l-k~~--~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~  289 (301)
                      | .+.  ..||.+--=|             |..   ...+..|+-+|+.-+||-            .+.+|+++=-.+=+
T Consensus        74 L~E~~~~tVPVaLHLDH-------------G~s---~E~c~~AI~aGfsSVMID------------gShlP~EEN~~~Tk  125 (339)
T TIGR01859        74 LIESMSITVPVALHLDH-------------GSS---YESCIKAIKAGFSSVMID------------GSHLPFEENVALTK  125 (339)
T ss_pred             HHHHCCCCEEEEEECCC-------------CCC---HHHHHHHHHCCCCEEECC------------CCCCCHHHHHHHHH
T ss_conf             99867993206864688-------------764---899999996498167202------------42687888888889


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254780669|r  290 QLLAIDK  296 (301)
Q Consensus       290 ~l~~i~~  296 (301)
                      ++.++..
T Consensus       126 kvve~Ah  132 (339)
T TIGR01859       126 KVVEIAH  132 (339)
T ss_pred             HHHHHHH
T ss_conf             9999998


No 364
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed
Probab=29.67  E-value=44  Score=14.83  Aligned_cols=105  Identities=12%  Similarity=0.101  Sum_probs=45.2

Q ss_pred             HHHHHHHHCCCEEEEEC---CCCCCHHHHHHHHHHHHHCCCCCEEEE-ECCCCCCCHHHCCCC-CCCHHHHHH-CCCEEE
Q ss_conf             99999850597799836---777899999999999972587808995-146544401000000-010688851-871687
Q gi|254780669|r  149 DLLTAAAQTGRVINVKK---GQFLSPWEMHNILQKLHAHGAKDVLFC-ERGTSFGYNTLVTDM-RSIPIMTSM-GVPVIF  222 (301)
Q Consensus       149 dLl~a~a~t~kpV~iKk---gq~~s~~e~~~a~eki~~~Gn~~i~lc-ERG~~fgy~~lvvD~-~~i~~lk~~-~~PVi~  222 (301)
                      +++.-+++.+..+-+-.   .+..|+.+++..++.   .|.+++-+. .=|.+.-...   |+ ..+...+.. ..==+-
T Consensus       142 ~~~~~A~~~gV~L~iE~~~~~f~~t~~~~~~~i~~---v~sP~l~v~~D~gn~~~~~~---d~~~~i~~~~~~I~~vH~k  215 (283)
T PRK13209        142 ESVEMASRYSVTLAFEIMDTPFMGSISKALGYAHY---LNSPWFQLYPDIGNLSAWDN---DVQMELQAGIGHIVAFHVK  215 (283)
T ss_pred             HHHHHHHHHCCEEEEEECCHHHHCCHHHHHHHHHH---CCCCCEEEEECHHHHHHCCC---CHHHHHHHHHHHEEEEEEC
T ss_conf             99999998599899942553432159999999996---69972899944577987569---9999999724456898531


Q ss_pred             CHHHHHHHCCCCCCCC--CCCHHHHHHHHHHHHHHCCCE-EEEEEC
Q ss_conf             1177742122345321--263889999999999718988-999836
Q gi|254780669|r  223 DASHSVQQPGIHGNCS--GGERQYIVPLAKAAVAIGIAG-IFLETH  265 (301)
Q Consensus       223 D~SHs~q~p~~~~~~~--gG~r~~v~~la~aa~a~G~dG-lfiE~H  265 (301)
                      |..     ||......  .|.-+|. .+.++-...|++| +.+|.-
T Consensus       216 D~~-----~g~~~~vp~G~G~vdf~-~vf~aLk~~gY~G~~~iE~w  255 (283)
T PRK13209        216 DTK-----PGVFKNVPFGEGVVDFE-RAFKTLKQSGYCGPYLIEMW  255 (283)
T ss_pred             CCC-----CCCCCCCCCCCCCCCHH-HHHHHHHHHCCCCCEEEEEE
T ss_conf             477-----99767578988850889-99999999799762899984


No 365
>PRK07328 histidinol-phosphatase; Provisional
Probab=29.39  E-value=45  Score=14.80  Aligned_cols=19  Identities=21%  Similarity=0.524  Sum_probs=9.5

Q ss_pred             CHHHHHHCCCEEE-CHHHHH
Q ss_conf             0688851871687-117774
Q gi|254780669|r  210 IPIMTSMGVPVIF-DASHSV  228 (301)
Q Consensus       210 i~~lk~~~~PVi~-D~SHs~  228 (301)
                      +...++.+.||++ .=+|..
T Consensus       213 l~~~~~~G~~it~gSDAH~~  232 (268)
T PRK07328        213 LRAARERGIPVVLGSDAHRP  232 (268)
T ss_pred             HHHHHHCCCEEEEECCCCCH
T ss_conf             99999879979990598988


No 366
>PRK00207 hypothetical protein; Validated
Probab=29.36  E-value=45  Score=14.79  Aligned_cols=114  Identities=18%  Similarity=0.158  Sum_probs=71.0

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCC-CCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECC
Q ss_conf             699954863499999999999999965533997066015576886-6632224567124888999886652876885228
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR-SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVH  123 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanR-tS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~  123 (301)
                      +++.++|-+-++-..++..|+.+-+.|-++.+-+-|--.---||+ .+|-+..    -.-..-|+++.++++++.+.=|.
T Consensus         5 l~V~~~py~~q~a~~A~~FA~A~l~~GH~I~~VFFY~dGV~nan~~~~p~~DE----~nl~~~W~~La~~~~~~L~vCva   80 (128)
T PRK00207          5 IAVTGPAYGTQQASSAYQFAQALLAEGHEIVSVFFYQDGVYNANALTVPASDE----FDLVRAWQQLAAEHGVALNVCVA   80 (128)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHCCCCCCCC----HHHHHHHHHHHHHCCCEEEEEHH
T ss_conf             99956998765299999999999988997989996058888887066876530----37999999999853981897478


Q ss_pred             --------CHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEE
Q ss_conf             --------899998765021578822576289999999850597799
Q gi|254780669|r  124 --------TEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN  162 (301)
Q Consensus       124 --------~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~  162 (301)
                              +..+.+.-..-.+=|.=|-.++==-+|.++...++|.|.
T Consensus        81 AA~rRGi~d~~ea~~~~~~~~nl~~~F~l~GLGel~~a~~~aDRvI~  127 (128)
T PRK00207         81 AALRRGVVDETEAERLGLASANLQPGFELSGLGALAEASLTADRVVQ  127 (128)
T ss_pred             HHHHHCCCCHHHHHHHCCCCCCCCCCCEECCHHHHHHHHHHCCEEEE
T ss_conf             78870777688898835454446788586069999999981694761


No 367
>PRK13140 consensus
Probab=29.33  E-value=45  Score=14.79  Aligned_cols=215  Identities=17%  Similarity=0.212  Sum_probs=109.2

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCC-----CCCCCC-CCCCCCHHHHHHHHHHHHHHCCEE
Q ss_conf             999548634999999999999999655339-9706601557688-----666322-245671248889998866528768
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKAN-----RSSLAG-KRGVGLKKGREIFRDLKKKYGFPI  118 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKan-----RtS~~s-frG~Gle~gL~il~e~k~~~glpv  118 (301)
                      ++.||   --+.+...++++.+.+.|+++. +|.=|.-  +.|-     +++..+ -.|..+++.+++++++|++.++|+
T Consensus        19 y~taG---~P~~~~s~~~~~~l~~~GaDiiElGiPfSD--P~ADGpvIq~A~~rAL~~G~~~~~~~~~~~~~r~~~~~pi   93 (257)
T PRK13140         19 YFTAG---YPTLEDTVSIIKDLEKHGVDMIEIGIPFSD--PLADGPVIQKSATQALKNGMTLKLLFEQLKDIRKEVQIPL   93 (257)
T ss_pred             EEECC---CCCHHHHHHHHHHHHHCCCCEEEECCCCCC--CCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             88182---898799999999999759999997898898--7765899999999999869989999999999743689888


Q ss_pred             EE-----ECC---CHHHHHHHHHH-CCEEEECHHHCCC-HH-HHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             85-----228---89999876502-1578822576289-99-9999850597-799836777899999999999972587
Q gi|254780669|r  119 LT-----DVH---TEQQCEAIADS-VDILQIPALLCRQ-TD-LLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       119 ~T-----eV~---~~~~~e~~~~~-vDilQIgA~~~rq-td-Ll~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn  186 (301)
                      +-     .|.   ..+-++.+++. +|-+=||---... .+ +..++.+.+. +|.+=-+ ..+.+    -++++.+...
T Consensus        94 vlM~Y~N~i~~~G~e~F~~~~~~~GvdGlIipDLP~ee~~~~~~~~~~~~~i~~I~lvaP-tt~~~----Ri~~i~~~a~  168 (257)
T PRK13140         94 ILMGYLNPIMQYGFEKFCKKCAETGIDGVIIPDLPFDDYQEHYKEIFEKYGLKNIMLITP-QTSEE----RIREIDSHTD  168 (257)
T ss_pred             EEEECHHHHHHHCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECC-CCCHH----HHHHHHHHCC
T ss_conf             999055999851799999999984998698359985675899999999869977998689-99899----9999997399


Q ss_pred             CCEEE-EECCCCCCCHHHCCCCCC-CHHHHHH--CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             80899-514654440100000001-0688851--8716871177742122345321263889999999999718988999
Q gi|254780669|r  187 KDVLF-CERGTSFGYNTLVTDMRS-IPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       187 ~~i~l-cERG~~fgy~~lvvD~~~-i~~lk~~--~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                      .=|.+ .-+|+|-....+-.+... +..+|+.  ..||++---=|             .++-+    + .+...+||+.+
T Consensus       169 gFiY~vs~~GvTG~~~~~~~~~~~~i~~ik~~~~~~Pv~vGFGIs-------------~~e~v----~-~~~~~aDGvIV  230 (257)
T PRK13140        169 GFIYMVSSASTTGAQQDFNNQKRAYFKRIKDMNLKNPRMVGFGIS-------------NKATF----N-AACEYASGAII  230 (257)
T ss_pred             CCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCC-------------CHHHH----H-HHHHCCCEEEE
T ss_conf             966870365666887665156899999999827899869980579-------------89999----9-99831999998


Q ss_pred             EECCCHHHCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             836983347978201868899999999999
Q gi|254780669|r  263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLL  292 (301)
Q Consensus       263 E~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~  292 (301)
                      =++--  +.+.++.  =+.+.+.+++++|+
T Consensus       231 GSaiv--k~i~e~~--~~~~~v~~fv~~lk  256 (257)
T PRK13140        231 GSAFV--KLLKEEK--NPEKAILKFVKEIK  256 (257)
T ss_pred             CHHHH--HHHHHCC--CHHHHHHHHHHHHC
T ss_conf             79999--9998779--87899999999962


No 368
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional
Probab=28.25  E-value=43  Score=14.94  Aligned_cols=25  Identities=16%  Similarity=0.268  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHCCEEEE-ECCCHHHHH
Q ss_conf             8999886652876885-228899998
Q gi|254780669|r  105 EIFRDLKKKYGFPILT-DVHTEQQCE  129 (301)
Q Consensus       105 ~il~e~k~~~glpv~T-eV~~~~~~e  129 (301)
                      .+|.+.-.+||+.+.- |..+.++++
T Consensus       127 ~l~~~~l~~~GI~~~~vd~~d~~~~~  152 (406)
T PRK07810        127 VVCNEILPRWGVETVFVDGDDLSQWE  152 (406)
T ss_pred             HHHHHHHHCCCEEEEEECCCCHHHHH
T ss_conf             99997764487499996898859999


No 369
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=28.02  E-value=47  Score=14.64  Aligned_cols=127  Identities=10%  Similarity=-0.015  Sum_probs=84.1

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHH-HHHHH-CCEEEE-ECCCHHHHH
Q ss_conf             349999999999999996553399706601557688666322245671248889998-86652-876885-228899998
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRD-LKKKY-GFPILT-DVHTEQQCE  129 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e-~k~~~-glpv~T-eV~~~~~~e  129 (301)
                      ..++.|++..+|+.|.+-|.+..         .       -.+|+++..+.+.-+.+ .++++ ++-+-. .|.+.+|++
T Consensus        23 r~~~~e~a~~~a~aL~~gGi~~i---------E-------iTlrt~~a~~~i~~l~~~~~~~~p~~~iGaGTVl~~~~~~   86 (223)
T PRK07114         23 YHSDIEVAKKVVKACYDGGVRAF---------E-------FTNRGDFAHEVFGELVKYAAKECPEMILGVGSIVDAATAA   86 (223)
T ss_pred             EECCHHHHHHHHHHHHHCCCCEE---------E-------EECCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHH
T ss_conf             82899999999999998899889---------9-------9588965899999999999866898089655188999999


Q ss_pred             HHHH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCC
Q ss_conf             7650-215788225762899999998505977998367778999999999999725878089951465444010000000
Q gi|254780669|r  130 AIAD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMR  208 (301)
Q Consensus       130 ~~~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~  208 (301)
                      .+.+ .++.+=-|.   .+.++++++.+.+.|..   +=-+||.|...|.++    |.+-+-+      |.-     ++-
T Consensus        87 ~a~~aGA~FiVSP~---~~~~v~~~~~~~~~~~i---PGv~TptEi~~A~~~----G~~~vK~------FPa-----~~~  145 (223)
T PRK07114         87 LYIQLGANFVVGPL---FNEDIAKVCNRRKIPYS---PGCGSVSEIGFAEEL----GCEIVKI------FPG-----DVY  145 (223)
T ss_pred             HHHHCCCCEEECCC---CCHHHHHHHHHCCCCCC---CCCCCHHHHHHHHHC----CCCEEEE------CCC-----CCC
T ss_conf             99985998999999---99999999998399753---731999999999987----9997988------973-----235


Q ss_pred             CCHHHHHH
Q ss_conf             10688851
Q gi|254780669|r  209 SIPIMTSM  216 (301)
Q Consensus       209 ~i~~lk~~  216 (301)
                      +..++|..
T Consensus       146 G~~~lkal  153 (223)
T PRK07114        146 GPEFVKAI  153 (223)
T ss_pred             CHHHHHHH
T ss_conf             99999998


No 370
>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.
Probab=27.93  E-value=48  Score=14.63  Aligned_cols=15  Identities=7%  Similarity=0.304  Sum_probs=5.3

Q ss_pred             HHHHHHHHHHHCCCC
Q ss_conf             999999999725878
Q gi|254780669|r  173 EMHNILQKLHAHGAK  187 (301)
Q Consensus       173 e~~~a~eki~~~Gn~  187 (301)
                      |+-..+.++.+.|.+
T Consensus       178 d~s~~v~~l~~~~~d  192 (340)
T cd06349         178 DFRPTITRLRDANPD  192 (340)
T ss_pred             CHHHHHHHHHHCCCC
T ss_conf             579999999866999


No 371
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein; InterPro: IPR005670   This is a family of phosphate transport system permease proteins.; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0015114 phosphate transmembrane transporter activity, 0006817 phosphate transport, 0016020 membrane.
Probab=27.85  E-value=38  Score=15.30  Aligned_cols=26  Identities=8%  Similarity=0.207  Sum_probs=12.3

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             699954863499999999999999965
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAIC   71 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~   71 (301)
                      .+-|-||=- =.+...+++--.+.+.-
T Consensus        29 vTAlIGPSG-CGKSTlLR~lNRMnDl~   54 (248)
T TIGR00972        29 VTALIGPSG-CGKSTLLRSLNRMNDLV   54 (248)
T ss_pred             EEEEECCCC-CCHHHHHHHHHHHHHHC
T ss_conf             589877889-86789999988776407


No 372
>KOG0657 consensus
Probab=27.36  E-value=45  Score=14.77  Aligned_cols=97  Identities=18%  Similarity=0.263  Sum_probs=50.9

Q ss_pred             HHHCC--EEEEECCCHHHHHHHHHH--CCEEEECHHHCCC-----HHHHHHHHHC-----CC----------EEEE----
Q ss_conf             65287--688522889999876502--1578822576289-----9999998505-----97----------7998----
Q gi|254780669|r  112 KKYGF--PILTDVHTEQQCEAIADS--VDILQIPALLCRQ-----TDLLTAAAQT-----GR----------VINV----  163 (301)
Q Consensus       112 ~~~gl--pv~TeV~~~~~~e~~~~~--vDilQIgA~~~rq-----tdLl~a~a~t-----~k----------pV~i----  163 (301)
                      ++||+  +.+|-||....-+..-+.  .-.+..|-+-.||     |+-.+|+++.     ||          ||.+    
T Consensus       149 d~fgI~EgLMtTvha~tatQktvdgps~k~wr~g~~a~qNIiPASTgAakAVgKvipeLngKLtGMAf~Vpt~vsVvdl~  228 (285)
T KOG0657         149 DNFGIMEGLMTTVHAITATQKTVDGPSGKLWRDGRRALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPVSVVDLT  228 (285)
T ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCEECCCCCEEEEEEE
T ss_conf             03441134334202202555435686533001463112043455561778887776876175446412378546755310


Q ss_pred             -ECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCC------CCCCHHHCCCCCC
Q ss_conf             -367778999999999999725878089951465------4440100000001
Q gi|254780669|r  164 -KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGT------SFGYNTLVTDMRS  209 (301)
Q Consensus       164 -Kkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~------~fgy~~lvvD~~~  209 (301)
                       ....-+..++...+++.....+-+.|+ ||--+      -|||.++|+|+..
T Consensus       229 ~~~~k~a~~ddikkvvk~~~~~~lkGIL-te~~fISWYDNE~GYS~rVvDl~~  280 (285)
T KOG0657         229 CHLEKPAKYDDIKKVVKLASEIPLKGIL-TEHHFISWYDNEFGYSNRVVDLME  280 (285)
T ss_pred             CCCCCCCCHHHHHHHHHHHHCCCCCCCC-CCCCEEEEECCCCCCCHHHHHHHH
T ss_conf             0233433257899999874036534410-000000231144565147788999


No 373
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative; InterPro: IPR005270    The function of this family is unknown, but it may include TIM-barrel proteins..
Probab=27.17  E-value=49  Score=14.55  Aligned_cols=109  Identities=18%  Similarity=0.327  Sum_probs=64.4

Q ss_pred             HHHHH-HHCCEEEE---ECCCHHHHH-HHHHHCCEEEECHHHCCCH-------------------HHHHHHH-HCCCEEE
Q ss_conf             98866-52876885---228899998-7650215788225762899-------------------9999985-0597799
Q gi|254780669|r  108 RDLKK-KYGFPILT---DVHTEQQCE-AIADSVDILQIPALLCRQT-------------------DLLTAAA-QTGRVIN  162 (301)
Q Consensus       108 ~e~k~-~~glpv~T---eV~~~~~~e-~~~~~vDilQIgA~~~rqt-------------------dLl~a~a-~t~kpV~  162 (301)
                      +++|+ .+.+.|-.   ++-+...++ .+++.+||+-|=| .|||.                   |++.+.. +..+||.
T Consensus        63 ~~~~Esr~~v~VnVr~~~le~~~~v~~~~ae~~diiEiNa-HCRQPEiteiG~Gq~ll~n~e~L~ef~~k~~G~~~~p~f  141 (234)
T TIGR00736        63 KKIKESRAKVAVNVRISDLEEELDVELLVAEFADIIEINA-HCRQPEITEIGIGQELLKNKELLKEFVAKVKGKLRKPVF  141 (234)
T ss_pred             HHHHHCCCEEEEEEEEECCHHHHHHHHHHHHHCCEEEECC-CCCCCCEEEECCCHHHHCCCHHHHHHHHHHCCCCCCCEE
T ss_conf             7642203525788653000045677665421137378857-588976155056535423802578887530343147237


Q ss_pred             EE-CCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHH-HCCCEEE
Q ss_conf             83-677789999999999997258780899514654440100000001068885-1871687
Q gi|254780669|r  163 VK-KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS-MGVPVIF  222 (301)
Q Consensus       163 iK-kgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~-~~~PVi~  222 (301)
                      +| ||-...+++ ...+.++...|..-+-+=   . |-.+.=.-||..+..+-+ .+..+|+
T Consensus       142 vKIRgN~~~ld~-~~~a~~l~d~g~d~iHvD---a-m~PG~~~aD~~l~~~~se~~nD~I~I  198 (234)
T TIGR00736       142 VKIRGNVIKLDE-LKVARKLVDAGVDAIHVD---A-MKPGEDRADLDLVKLVSEVKNDKIVI  198 (234)
T ss_pred             EEECCCCCCCCH-HHHHHHHHHHCCCEEEEE---E-ECCCCCCCCHHHHHHHHHHCCCEEEE
T ss_conf             897157875103-578789887323555543---2-25936936789999988761885798


No 374
>COG2355 Zn-dependent dipeptidase, microsomal dipeptidase homolog [Amino acid transport and metabolism]
Probab=27.06  E-value=49  Score=14.53  Aligned_cols=43  Identities=21%  Similarity=0.251  Sum_probs=18.7

Q ss_pred             HHHHHHHHCCCEEE-------EEC--CCCCCHHHHHHHHHHHHH-CCCCCEEE
Q ss_conf             99999850597799-------836--777899999999999972-58780899
Q gi|254780669|r  149 DLLTAAAQTGRVIN-------VKK--GQFLSPWEMHNILQKLHA-HGAKDVLF  191 (301)
Q Consensus       149 dLl~a~a~t~kpV~-------iKk--gq~~s~~e~~~a~eki~~-~Gn~~i~l  191 (301)
                      +-++|++++|-.|-       +++  ..-+|++++.-.++|+.+ .|-+.|-|
T Consensus       206 ~qlkaI~~~gGvIgv~~~~~fl~~~~~~~atldd~v~hI~h~v~~~G~dhVgl  258 (313)
T COG2355         206 EQLKAIAETGGVIGVNFIPAFLRPGGAARATLDDLVRHIDHFVELVGIDHVGL  258 (313)
T ss_pred             HHHHHHHHCCCEEEEEEEHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99999996499799986452236887789998999999999998538421686


No 375
>PRK12394 putative metallo-dependent hydrolase; Provisional
Probab=26.99  E-value=49  Score=14.53  Aligned_cols=91  Identities=18%  Similarity=0.245  Sum_probs=56.7

Q ss_pred             HHHH-HCCCEEEEECCCC-CCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCC--CCCCCHHHHHH-CCCEEECHHH
Q ss_conf             9985-0597799836777-8999999999999725878089951465444010000--00010688851-8716871177
Q gi|254780669|r  152 TAAA-QTGRVINVKKGQF-LSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVT--DMRSIPIMTSM-GVPVIFDASH  226 (301)
Q Consensus       152 ~a~a-~t~kpV~iKkgq~-~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvv--D~~~i~~lk~~-~~PVi~D~SH  226 (301)
                      .++| +.+.|+++--+.. .+.+|.   ++++.. | .=+.-|.+|.  +  +.++  +=+.++.+++. .-.|+||+-|
T Consensus       178 ~e~a~~~~lplmvH~~~~~~~~~ei---~~~lr~-G-DI~tH~f~~~--~--~~i~~~~g~v~~~v~~A~~rGv~fDvgh  248 (387)
T PRK12394        178 LRIANDLRCPVAIHSTHPVVPMKEL---VSLLRR-G-DIIAHAFHGK--G--STILTDEGAVLAEVRQARERGVIFDAAN  248 (387)
T ss_pred             HHHHHHCCCEEEEECCCCCCCHHHH---HHHHCC-C-CEEEEECCCC--C--CCEECCCCCCHHHHHHHHCCCEEEEECC
T ss_conf             9998655981899788999899999---987456-9-8898621588--8--8646888748299998750876899358


Q ss_pred             HHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             74212234532126388999999999971898899983
Q gi|254780669|r  227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       227 s~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                                   |...|-...++.|++.|.---.|.+
T Consensus       249 -------------G~~sFsf~~a~~al~~G~~PdtIST  273 (387)
T PRK12394        249 -------------GRSHFSMNTARRAIANGFLPDIISS  273 (387)
T ss_pred             -------------CCCCCCHHHHHHHHHCCCCCCEEEC
T ss_conf             -------------8885468999999972688652404


No 376
>PRK09028 cystathionine beta-lyase; Provisional
Probab=26.80  E-value=47  Score=14.65  Aligned_cols=62  Identities=11%  Similarity=0.200  Sum_probs=30.0

Q ss_pred             HHHHHHHHHHHHCCEEEE-ECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHHC-CCEEEEE
Q ss_conf             888999886652876885-22889999876-502157882-----25762899999998505-9779983
Q gi|254780669|r  103 GREIFRDLKKKYGFPILT-DVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQT-GRVINVK  164 (301)
Q Consensus       103 gL~il~e~k~~~glpv~T-eV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~t-~kpV~iK  164 (301)
                      ...++.+.-.++|+.+.- |..+++.++.+ .+...++++     |.+-+..-+-+.++|+. |.++.+-
T Consensus       113 T~~l~~~~l~~~Gi~v~~vd~~~~~~~~~~i~~~Tklv~~EtpsNP~l~v~Di~~ia~iA~~~g~~~vVD  182 (394)
T PRK09028        113 TRDLCDKILAGFGIETTYYDPMIGEGIRELIRPNTKVLFLESPGSITMEVQDVPTLSRIAHEHDIVVMLD  182 (394)
T ss_pred             HHHHHHHHHHHCCEEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEC
T ss_conf             7999998886567479995799989998536877269999558998752368999999999839879963


No 377
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated
Probab=26.67  E-value=50  Score=14.49  Aligned_cols=55  Identities=9%  Similarity=0.068  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHHHCCEEEE-E-CCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHHC
Q ss_conf             888999886652876885-2-2889999876-502157882-----25762899999998505
Q gi|254780669|r  103 GREIFRDLKKKYGFPILT-D-VHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQT  157 (301)
Q Consensus       103 gL~il~e~k~~~glpv~T-e-V~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~t  157 (301)
                      ...++.+.-.++|+.+.- | ..+++.++.. .+...++++     |..-+..-+-+.++|+.
T Consensus       121 T~~l~~~~l~~~GI~~~fvd~~~d~~~~~~~i~~~Tklv~~EtpsNP~l~v~Di~~ia~iA~~  183 (437)
T PRK05613        121 TETLFLVTLNRLGIETTFVENPDDPESWQAAVQPNTKAFFGETFANPQADVLDIPAVAEVAHR  183 (437)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCCHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHH
T ss_conf             789977677516815899479999999997378785599998799986533579999999987


No 378
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype; InterPro: IPR006412   Members of this family are class II examples of the enzyme fructose-bisphosphate aldolase, an enzyme both of glycolysis and (in the opposite direction) of the Calvin cycle of CO2 fixation. A deep split separates the tightly conserved yeast/Escherichia coli/Mycobacterium subtype (all species lacking the Calvin cycle) represented by IPR006411 from INTERPRO from a broader group of aldolases that includes both tagatose- and fructose-bisphosphate aldolases. This family represents a distinct, elongated, very well conserved subtype within the latter group. Most species with this aldolase subtype have the Calvin cycle.; GO: 0004332 fructose-bisphosphate aldolase activity, 0006096 glycolysis.
Probab=26.59  E-value=45  Score=14.81  Aligned_cols=14  Identities=21%  Similarity=0.363  Sum_probs=5.1

Q ss_pred             CCCCCCHHHHHHHH
Q ss_conf             67778999999999
Q gi|254780669|r  165 KGQFLSPWEMHNIL  178 (301)
Q Consensus       165 kgq~~s~~e~~~a~  178 (301)
                      .|-.--|.+|...+
T Consensus       230 hGsssvPq~W~~~~  243 (347)
T TIGR01521       230 HGSSSVPQEWLDVI  243 (347)
T ss_pred             ECCCCCCHHHHHHH
T ss_conf             33755727899999


No 379
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR; InterPro: IPR010242   Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] . FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems.   The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins , . It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly .   The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA . SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA , acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets.   In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins . Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen .   This entry describes IscR, an iron-sulphur binding transcription factor of the ISC iron-sulphur cluster assembly system.; GO: 0003690 double-stranded DNA binding, 0003700 transcription factor activity, 0006355 regulation of transcription DNA-dependent.
Probab=26.59  E-value=32  Score=15.75  Aligned_cols=16  Identities=25%  Similarity=0.395  Sum_probs=7.1

Q ss_pred             CCCCHHHHHHHHHHHH
Q ss_conf             1868899999999999
Q gi|254780669|r  277 NMINIKDLPKLLSQLL  292 (301)
Q Consensus       277 q~l~l~~l~~ll~~l~  292 (301)
                      |.|.|+-||.|..+|+
T Consensus        35 Q~ISLSYLEQLFaKLR   50 (140)
T TIGR02010        35 QNISLSYLEQLFAKLR   50 (140)
T ss_pred             CCCCHHHHHHHHHHHC
T ss_conf             1613567989988632


No 380
>TIGR02071 PBP_1b penicillin-binding protein 1B; InterPro: IPR011813    Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in Escherichia coli and other Proteobacteria, designated penicillin-binding protein 1B.; GO: 0008233 peptidase activity, 0008955 peptidoglycan glycosyltransferase activity, 0009252 peptidoglycan biosynthetic process, 0046677 response to antibiotic, 0009274 peptidoglycan-based cell wall.
Probab=26.35  E-value=51  Score=14.45  Aligned_cols=50  Identities=28%  Similarity=0.392  Sum_probs=34.7

Q ss_pred             EEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCC-------------CCCEEEEECCCCC
Q ss_conf             7882257628999999985059779983677789999999999997258-------------7808995146544
Q gi|254780669|r  137 ILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHG-------------AKDVLFCERGTSF  198 (301)
Q Consensus       137 ilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~G-------------n~~i~lcERG~~f  198 (301)
                      +.||||            .=-++|++|+.|..+|-+|++...+-..-.-             |..|-+.-||+-|
T Consensus        33 ~W~lPa------------~VYaR~~~L~pg~~ls~~e~~~~L~~~~YR~~~~~~~PGey~~~~~~i~~~rR~F~F   95 (742)
T TIGR02071        33 VWQLPA------------AVYARILNLEPGMSLSKKELLRELDALQYRQVSSVTLPGEYSVQNSSIELIRRPFDF   95 (742)
T ss_pred             EEECCH------------HHCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCEEEEEECCCCC
T ss_conf             230471------------110022210663031189999998531576013788882168876878995467788


No 381
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain.  Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522).  Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and  EndoH from Flavobacterium meningosepticum, and  EndoE from Enterococcus faecalis.  EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues.  EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
Probab=26.24  E-value=51  Score=14.44  Aligned_cols=99  Identities=16%  Similarity=0.026  Sum_probs=65.4

Q ss_pred             EECCCCCCCHHHHHHHHHHHHHHHHHCCCCEE---EECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC-----CEEE
Q ss_conf             95486349999999999999996553399706---601557688666322245671248889998866528-----7688
Q gi|254780669|r   48 IAGPCQIESHDHAFMIAEKLYAICQSLNIGLV---YKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYG-----FPIL  119 (301)
Q Consensus        48 IAGPCsiES~e~~~~~A~~lk~~~~~~~~~~i---fK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~g-----lpv~  119 (301)
                      -+|+..-++++-+...|+.|+..+.++...|+   +-|++...|.+..     ...+.-...++++++.+|     |-+-
T Consensus        77 g~g~~~~~~~~~~~~yA~~l~d~v~~yglDG~D~D~E~~~~~~~~~~~-----~~~~~~~~~v~eL~k~~GP~~Kll~id  151 (255)
T cd06542          77 GAGFANNLSDAAAKAYAKAIVDTVDKYGLDGVDFDDEYSGYGKNGTSQ-----PSNEAFVRLIKELRKYMGPTDKLLTID  151 (255)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCC-----CCHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             566678888999999999999999982998667636656677888777-----735899999999997639988279995


Q ss_pred             EECCCHH-HHHHHHHHCCEEEECHHHCCCHHHH
Q ss_conf             5228899-9987650215788225762899999
Q gi|254780669|r  120 TDVHTEQ-QCEAIADSVDILQIPALLCRQTDLL  151 (301)
Q Consensus       120 TeV~~~~-~~e~~~~~vDilQIgA~~~rqtdLl  151 (301)
                      ++..... ....+++++|-++..|+......+.
T Consensus       152 ~~~~~~~~~~~~~~~y~DY~i~Q~Ygs~~~~~~  184 (255)
T cd06542         152 GYGQALSNDGEEVSPYVDYVIYQYYGSSSSSTQ  184 (255)
T ss_pred             CCCCCCCCCCCCHHHHCCEEEEECCCCCCCCCC
T ss_conf             877533446533011067899864479987540


No 382
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional
Probab=26.21  E-value=43  Score=14.90  Aligned_cols=110  Identities=18%  Similarity=0.183  Sum_probs=51.8

Q ss_pred             HHHHHHHHCCEEEEECCCHHHHH-HHHHHC-----CEEEECHHHCCCHHHHHHHHHCC-CEEEEE---CCCCCCHHHHHH
Q ss_conf             99886652876885228899998-765021-----57882257628999999985059-779983---677789999999
Q gi|254780669|r  107 FRDLKKKYGFPILTDVHTEQQCE-AIADSV-----DILQIPALLCRQTDLLTAAAQTG-RVINVK---KGQFLSPWEMHN  176 (301)
Q Consensus       107 l~e~k~~~glpv~TeV~~~~~~e-~~~~~v-----DilQIgA~~~rqtdLl~a~a~t~-kpV~iK---kgq~~s~~e~~~  176 (301)
                      =++.++.+|.+-..=|..-..+- .+....     |-+=+|++.+--|-  .++...| +||.+-   ....+++++.. 
T Consensus        39 E~~~a~~~g~k~av~v~sgT~AL~lal~al~i~~gdeVi~p~~tf~at~--~ai~~~Ga~pvf~Did~~t~~id~~~~e-  115 (379)
T PRK11658         39 EQAFCQLTGNQHAIAVSSATAGMHITLMALGIGPGDEVITPSQTWVSTL--NMIVLLGATPVMVDVDRDTLMVTPEAIE-  115 (379)
T ss_pred             HHHHHHHHCCCEEEEECCHHHHHHHHHHHCCCCCCCEEEECCCCHHHHH--HHHHHCCCEEEEECCCCCCCCCCHHHHH-
T ss_conf             9999999786949997688999999999869888399998995569999--9999819989974574565354889998-


Q ss_pred             HHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHH-HHHCCCEEECHHHHH
Q ss_conf             9999972587808995146544401000000010688-851871687117774
Q gi|254780669|r  177 ILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM-TSMGVPVIFDASHSV  228 (301)
Q Consensus       177 a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~l-k~~~~PVi~D~SHs~  228 (301)
                         +....--+-|+..+   .||+   ..||..+..+ +++++|||-|+.||.
T Consensus       116 ---~~it~~tkaIi~Vh---~~G~---~~d~~~i~~i~~~~~i~vIEDaA~a~  159 (379)
T PRK11658        116 ---AAITPRTKAIIPVH---YAGA---PADLDAIRAIGERYGIPVIEDAAHAV  159 (379)
T ss_pred             ---HHCCCCCEEEEEEC---CCCC---CCCHHHHHHHHHHCCCEEEECCHHHH
T ss_conf             ---65482654999856---8898---66377999999975981897083553


No 383
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=26.11  E-value=51  Score=14.42  Aligned_cols=18  Identities=17%  Similarity=0.518  Sum_probs=7.9

Q ss_pred             CEEECCCCCEEEEECCCC
Q ss_conf             279769970699954863
Q gi|254780669|r   36 QVTFSNEQRFVLIAGPCQ   53 (301)
Q Consensus        36 ~i~ig~~~~l~iIAGPCs   53 (301)
                      ++.++.+.+.++|.||++
T Consensus       318 di~l~~~~~~liITGPNt  335 (780)
T PRK00409        318 DIELGFDKTVLVITGPNT  335 (780)
T ss_pred             EEEECCCCEEEEEECCCC
T ss_conf             478669841899968988


No 384
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism]
Probab=26.03  E-value=51  Score=14.41  Aligned_cols=65  Identities=18%  Similarity=0.293  Sum_probs=27.9

Q ss_pred             HHHHHHHHHCCEEEE-ECCCHHHHHHH-HH-----HCCEEEECHHHCCCHHHHHHHHHCC-CEEEEECCCCCCH
Q ss_conf             999886652876885-22889999876-50-----2157882257628999999985059-7799836777899
Q gi|254780669|r  106 IFRDLKKKYGFPILT-DVHTEQQCEAI-AD-----SVDILQIPALLCRQTDLLTAAAQTG-RVINVKKGQFLSP  171 (301)
Q Consensus       106 il~e~k~~~glpv~T-eV~~~~~~e~~-~~-----~vDilQIgA~~~rqtdLl~a~a~t~-kpV~iKkgq~~s~  171 (301)
                      .|.-.=+++|+.|.= |..+++..+.+ -+     ++..|-=|.-+.-..+=+-++++.. .|+++-+ .|.+|
T Consensus       117 lf~~tl~~~Gi~v~fvd~~d~~~~~~aI~~nTkavf~EtigNP~~~v~Die~ia~iAh~~gvpliVDN-T~atp  189 (426)
T COG2873         117 LFSHTLKRLGIEVRFVDPDDPENFEAAIDENTKAVFAETIGNPGLDVLDIEAIAEIAHRHGVPLIVDN-TFATP  189 (426)
T ss_pred             HHHHHHHHCCCEEEEECCCCHHHHHHHHCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEEC-CCCCC
T ss_conf             99988886481799927999899998738224068787516887663577999999987599389836-77730


No 385
>pfam09439 SRPRB Signal recognition particle receptor beta subunit. The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase which anchors the alpha subunit to the endoplasmic reticulum membrane.
Probab=25.90  E-value=52  Score=14.40  Aligned_cols=151  Identities=23%  Similarity=0.325  Sum_probs=67.6

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHH-HHHHHHHC--CCCEEEECCCCCCCCCCCCCCCCCCCHHHH-HHHHHHHHH---HC
Q ss_conf             706999548634999999999999-99965533--997066015576886663222456712488-899988665---28
Q gi|254780669|r   43 QRFVLIAGPCQIESHDHAFMIAEK-LYAICQSL--NIGLVYKSSFDKANRSSLAGKRGVGLKKGR-EIFRDLKKK---YG  115 (301)
Q Consensus        43 ~~l~iIAGPCsiES~e~~~~~A~~-lk~~~~~~--~~~~ifK~sfdKanRtS~~sfrG~Gle~gL-~il~e~k~~---~g  115 (301)
                      +|-++|.|||..=--......... .....-..  ....-|++  .+.  .++.=+-=+|-++-. .|+...+..   -|
T Consensus         3 ~ptvLllGl~~sGKT~Lf~~L~~~~~~~T~tS~~~n~~~~~~~--~~~--~~~~lvD~PGh~klR~~~~~~~~~~~~~~g   78 (181)
T pfam09439         3 QPAVIIAGLCDSGKTSLFTLLTTGSVRKTVTSQEPSAAYKYMN--NKG--NSLTLIDFPGHVKLRYKLLETLKDSSSLRG   78 (181)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCCCEECCCCCCCEEEEEC--CCC--CEEEEEECCCCHHHHHHHHHHHHHHCCCEE
T ss_conf             8869998689998999999997599487588867864068751--689--668999889968999999986430026449


Q ss_pred             CEEEEEC-CCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHH----HH---HC--
Q ss_conf             7688522-889999876502-1578822576289999999850597799836777899999999999----97---25--
Q gi|254780669|r  116 FPILTDV-HTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQK----LH---AH--  184 (301)
Q Consensus       116 lpv~TeV-~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~ek----i~---~~--  184 (301)
                      +-.+.|- .+...+..++++ -|+|....+.-+...+|.++-+++.+      ...++.......|+    +.   +.  
T Consensus        79 IVfVVDS~~~~~~l~~~Ae~Ly~iL~~~~~~~~~vPvLI~cNKqDl~------~A~~~~~Ik~~LEkEi~~lr~tr~~~l  152 (181)
T pfam09439        79 LVFVVDSTAFPKEVTDTAEFLYDILSITELLKNGIDILIACNKQEIF------TARPPKKIKQALEKEINTIRERRSKAL  152 (181)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHHCHHHCCCCCCEEEEEECCCCC------CCCCHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999786656679999999999984454336899789997374633------577999999999999999999775136


Q ss_pred             ----CC--CCEEEEECCCCCCCHHH
Q ss_conf             ----87--80899514654440100
Q gi|254780669|r  185 ----GA--KDVLFCERGTSFGYNTL  203 (301)
Q Consensus       185 ----Gn--~~i~lcERG~~fgy~~l  203 (301)
                          |.  .+.+|-+-|..|....|
T Consensus       153 ~~~d~~~~~~~~Lg~~g~~F~F~~l  177 (181)
T pfam09439       153 SGLDGSEDLSAQLGKKGKGFKFDQL  177 (181)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHC
T ss_conf             6766655545306878964056644


No 386
>PRK04175 rpl7ae 50S ribosomal protein L7Ae; Validated
Probab=25.85  E-value=52  Score=14.39  Aligned_cols=33  Identities=27%  Similarity=0.393  Sum_probs=14.9

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEC
Q ss_conf             069995486349999999999999996553399706601
Q gi|254780669|r   44 RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS   82 (301)
Q Consensus        44 ~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~   82 (301)
                      .|++|||-|+-      .++-.++-.+|..-.++|+|=+
T Consensus        49 ~LvviA~Dv~P------~eiv~hlP~LCeek~IPy~~V~   81 (123)
T PRK04175         49 KLVVIAEDVDP------EEIVAHLPLLCEEKKIPYVYVP   81 (123)
T ss_pred             CEEEEECCCCH------HHHHHHHHHHHHHCCCCEEEEC
T ss_conf             78999789990------9999988999985499989978


No 387
>PRK08305 spoVFB dipicolinate synthase subunit B; Reviewed
Probab=25.69  E-value=46  Score=14.75  Aligned_cols=157  Identities=15%  Similarity=0.164  Sum_probs=84.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHH
Q ss_conf             34999999999999999655339970660155768866632224567124888999886652876885228899998765
Q gi|254780669|r   53 QIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIA  132 (301)
Q Consensus        53 siES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~  132 (301)
                      |+=+++-+++.++.|++.|++...  ++-.    + -.+..+--  |  ++.+|.+++.+-.|-++++++-+.+++.. +
T Consensus        15 Siaay~kv~~~ir~L~~~GA~V~~--ImS~----~-a~~~~Trf--g--~~~~~~~~le~iTg~~vi~ti~~aE~igp-~   82 (195)
T PRK08305         15 SHCTYEEVMPQIEKLVAEGAEVRP--IVSY----T-VQTTDTRF--G--EGEEWIKKIEEITGFKVINSIVEAEPLGP-K   82 (195)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEE--EECH----H-HHHCCCCC--C--CHHHHHHHHHHHHCCCCEEECCCCEECCC-C
T ss_conf             799899999999999987996999--9754----4-77505667--5--27889999999859952001345513366-7


Q ss_pred             HHCCEEEECHHHCCCH-----------HHH---HHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             0215788225762899-----------999---998505977998367778999999999999725878089951465--
Q gi|254780669|r  133 DSVDILQIPALLCRQT-----------DLL---TAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGT--  196 (301)
Q Consensus       133 ~~vDilQIgA~~~rqt-----------dLl---~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~--  196 (301)
                      ...|++=|-- -.-||           ..+   ++.-+.+|||.+-=...-+.  |.++..--.--..+||.+.-=|-  
T Consensus        83 ~~~D~lvIAP-aTaNtiaKLAnGI~DtpV~maaka~Lrn~kPVvia~stNd~l--~~n~~Ni~~Ll~~kniyfvPfgqd~  159 (195)
T PRK08305         83 KPLDCMVIAP-CTGNTMAKLANGITDSPVLMAAKATLRNQKPVVLAISTNDAL--GLNAVNLGRLLNTKNIYFVPFGQDD  159 (195)
T ss_pred             CCCCEEEEEC-CCHHHHHHHHCCCCCCHHHHHHHHHHCCCCCEEEEEECCHHH--HHCHHHHHHHHHCCCEEEEECCCCC
T ss_conf             6336899900-754189998653558779999999862799889998368678--7689999999826978999568867


Q ss_pred             CCC-CHHHCCCCCCCHHH-----HH-HCCCEEECH
Q ss_conf             444-01000000010688-----85-187168711
Q gi|254780669|r  197 SFG-YNTLVTDMRSIPIM-----TS-MGVPVIFDA  224 (301)
Q Consensus       197 ~fg-y~~lvvD~~~i~~l-----k~-~~~PVi~D~  224 (301)
                      .++ .+.++-|+.-++..     +. .--||++..
T Consensus       160 ~~~Kp~slva~~~~l~~t~~~Al~g~qlqpv~~~~  194 (195)
T PRK08305        160 PEKKPNSLVARMDLLIPTIEEALQGKQLQPVLVEY  194 (195)
T ss_pred             CCCCCHHHHHCHHHHHHHHHHHHCCCCCCEEEEEC
T ss_conf             34470456505987799999996499766077743


No 388
>TIGR03642 cas_csx13 CRISPR-associated protein, Csx13 family. This model describes a protein N-terminal protein sequence domain strictly associated with CRISPR and CRISPR-associated protein systems. This model and TIGR02584 identify two separate clades from a larger homology domain family, both CRISPR-associated, while other homologs are found that may not be. Members are found in bacteria that include Pelotomaculum thermopropionicum SI, Thermoanaerobacter tengcongensis MB4, and Roseiflexus sp. RS-1, and in archaea that include Thermoplasma volcanium, Picrophilus torridus, and Methanospirillum hungatei. The molecular function is unknown.
Probab=25.63  E-value=52  Score=14.37  Aligned_cols=30  Identities=23%  Similarity=0.310  Sum_probs=25.4

Q ss_pred             CEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEE
Q ss_conf             1687117774212234532126388999999999971898899
Q gi|254780669|r  219 PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF  261 (301)
Q Consensus       219 PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlf  261 (301)
                      ++.++.|             |||+-+-..++.+|--+|.|+++
T Consensus        92 ri~l~Is-------------GGRK~Ms~~l~l~aql~~~Drvy  121 (124)
T TIGR03642        92 RIIVNIS-------------GGRKIMTIILALYAQLLFEDEVY  121 (124)
T ss_pred             EEEEEEC-------------CCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             3899952-------------87399999999999985876116


No 389
>pfam03392 OS-D Insect pheromone-binding family, A10/OS-D.
Probab=25.61  E-value=36  Score=15.43  Aligned_cols=29  Identities=24%  Similarity=0.477  Sum_probs=23.6

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             99954863499999999999999965533
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSL   74 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~   74 (301)
                      ++=-|||+.|..+.--.+-+.|+..|.+.
T Consensus        27 ~ld~gpCt~egk~lK~~lPeal~t~C~KC   55 (95)
T pfam03392        27 LLDKGPCTPEGKELKKVLPDALETDCAKC   55 (95)
T ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             72589998889999998699997145579


No 390
>COG0148 Eno Enolase [Carbohydrate transport and metabolism]
Probab=25.43  E-value=53  Score=14.34  Aligned_cols=88  Identities=24%  Similarity=0.254  Sum_probs=39.0

Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCHHHHHHHHH----HCCEEEE-CH-HHCCCHHHHHHHHHCC--CEEEEECCCCCCHHH
Q ss_conf             48889998866528768852288999987650----2157882-25-7628999999985059--779983677789999
Q gi|254780669|r  102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIAD----SVDILQI-PA-LLCRQTDLLTAAAQTG--RVINVKKGQFLSPWE  173 (301)
Q Consensus       102 ~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~----~vDilQI-gA-~~~rqtdLl~a~a~t~--kpV~iKkgq~~s~~e  173 (301)
                      +-++++.++-++|.+-.+-|=+++.+-+-.++    .=|-+|| |- .-+.|++.|+..-+.+  ..|+||-.|--|+.|
T Consensus       264 e~i~~~~~Lv~~YpivsiEDpl~E~Dweg~~~lt~~~g~kvqivGDDLfvTN~~~l~~gi~~~~aNaiLIK~NQIGTLTE  343 (423)
T COG0148         264 ELIEYYLELVKKYPIVSIEDPLSEDDWEGFAELTKRLGDKVQIVGDDLFVTNPKRLKKGIEKGAANAILIKPNQIGTLTE  343 (423)
T ss_pred             HHHHHHHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHCCEEEEECCCCEECCHHHHHHHHHHCCCCEEEEECHHCCCHHH
T ss_conf             99999999997699789708988430789999998609838997675423288999988874567538995200231899


Q ss_pred             HHHHHHHHHHCCCCCE
Q ss_conf             9999999972587808
Q gi|254780669|r  174 MHNILQKLHAHGAKDV  189 (301)
Q Consensus       174 ~~~a~eki~~~Gn~~i  189 (301)
                      .+.+++.....|-..|
T Consensus       344 t~~ai~~A~~~gy~~v  359 (423)
T COG0148         344 TLEAINLAKDAGYTAV  359 (423)
T ss_pred             HHHHHHHHHHCCCEEE
T ss_conf             9999999998798088


No 391
>cd00408 DHDPS-like Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stablilzes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.
Probab=25.43  E-value=53  Score=14.34  Aligned_cols=27  Identities=22%  Similarity=0.191  Sum_probs=12.7

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9995486349999999999999996553
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQS   73 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~   73 (301)
                      .+|+| |+-.|-+...+.|+..++.|.+
T Consensus        68 pvi~g-v~~~s~~~~~~~a~~a~~~Gad   94 (281)
T cd00408          68 PVIAG-VGANSTREAIELARHAEEAGAD   94 (281)
T ss_pred             EEEEE-CCCCCHHHHHHHHHHHHHCCCC
T ss_conf             09995-7878899999999999975999


No 392
>pfam03537 DUF297 TM1410 hypothetical-related protein.
Probab=25.40  E-value=53  Score=14.34  Aligned_cols=18  Identities=28%  Similarity=0.444  Sum_probs=7.5

Q ss_pred             HHHHHHHHHCCCEEEEEE
Q ss_conf             999999971898899983
Q gi|254780669|r  247 PLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       247 ~la~aa~a~G~dGlfiE~  264 (301)
                      .....+.+.|+||+|+.+
T Consensus        94 ~~~~~~~~~GfdGv~lD~  111 (203)
T pfam03537        94 ARLDLLWAKGFDGVFLDN  111 (203)
T ss_pred             HHHHHHHHCCCCEEEECC
T ss_conf             999999984998586434


No 393
>TIGR00715 precor6x_red precorrin-6x reductase; InterPro: IPR003723   Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase . In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase .    There are at least two distinct cobalamin biosynthetic pathways in bacteria :  Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway ; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis ; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii shermanii.     Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) . There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans.   This entry represents CobK and CbiJ precorrin-6x reductase (1.3.1.54 from EC). In the aerobic pathway, CobK catalyses the reduction of the macrocycle of precorrin-6X to produce precorrin-6Y; while in the anaerobic pathway CbiJ catalyses the reduction of the macrocycle of cobalt-precorrin-6X into cobalt-precorrin-6Y , .; GO: 0016994 precorrin-6A reductase activity, 0009236 cobalamin biosynthetic process.
Probab=25.27  E-value=32  Score=15.81  Aligned_cols=195  Identities=20%  Similarity=0.286  Sum_probs=88.7

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECC-------CCC--CCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             699954863499999999999999965533997066015-------576--88666322245671248889998866528
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS-------FDK--ANRSSLAGKRGVGLKKGREIFRDLKKKYG  115 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~s-------fdK--anRtS~~sfrG~Gle~gL~il~e~k~~~g  115 (301)
                      +.+|+|  +.|    ...+++.|...+.   +.-.+-.+       +++  |||+....|.+.   +||+   +.=+++.
T Consensus         3 vll~GG--T~d----sr~~~~~L~~~~~---~~i~~t~tt~~~~~l~~~~~a~~v~~gaL~~~---EGL~---~~l~~~~   67 (260)
T TIGR00715         3 VLLMGG--TKD----SRAIAKKLRALGD---VEILVTVTTEEGKKLLEISQASKVVTGALDKD---EGLR---ELLKEES   67 (260)
T ss_pred             EEEEEC--CHH----HHHHHHHHCCCCC---EEEEEEECCCCCCCCCCCCCCCCEEECCCCCC---CCHH---HHHHHCC
T ss_conf             899717--778----9999974037875---89998741577630010037771587574888---7537---8886449


Q ss_pred             CEEEEECCCHHHHHHHHH---HCCEEEECH-HHCCC--------------HHHHHHHHH----CCCEEEEECC-----CC
Q ss_conf             768852288999987650---215788225-76289--------------999999850----5977998367-----77
Q gi|254780669|r  116 FPILTDVHTEQQCEAIAD---SVDILQIPA-LLCRQ--------------TDLLTAAAQ----TGRVINVKKG-----QF  168 (301)
Q Consensus       116 lpv~TeV~~~~~~e~~~~---~vDilQIgA-~~~rq--------------tdLl~a~a~----t~kpV~iKkg-----q~  168 (301)
                      +-++-|=.+|-=++....   ++-=+||+- |+-|-              ++=+..+++    .++-|++=-|     .|
T Consensus        68 i~~~vDAtHPFA~~~t~~a~~vc~E~~~~YvrfeRp~e~~~~~~ii~V~d~~~a~~~a~q~~~~g~~V~l~~G~~~L~~~  147 (260)
T TIGR00715        68 IDILVDATHPFAAQITKNALEVCKELGIPYVRFERPEELVLGKNIIEVSDIEEAARVAEQGYLKGKRVFLTAGVSTLAAV  147 (260)
T ss_pred             CCEEEECCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCEEEECCHHHHHHHHHCCCCCCCEEEEEECHHHHHHH
T ss_conf             63898579735899999999999761981799608835369986688567788877653034453124440111778999


Q ss_pred             CCHHHHH----------HHHHHHHHCCCC-CEEEEECCCCCCCHHHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCC
Q ss_conf             8999999----------999999725878-08995146544401000000010688851871687117774212234532
Q gi|254780669|r  169 LSPWEMH----------NILQKLHAHGAK-DVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNC  237 (301)
Q Consensus       169 ~s~~e~~----------~a~eki~~~Gn~-~i~lcERG~~fgy~~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~  237 (301)
                      ....+|.          .++++...-|-+ +=|+--||. |+|..      ++..|+++..-+++-         -.+|.
T Consensus       148 ~~~~~~~~v~~rvlP~~~al~~~~~~G~p~~~Iva~~G~-~~~~~------e~aLlr~y~~~avvT---------K~SG~  211 (260)
T TIGR00715       148 VNSQDKEKVIVRVLPDGTALEKALKLGLPSDRIVAMRGP-FSEEL------EKALLREYRIDAVVT---------KESGE  211 (260)
T ss_pred             HHHCCCCEEEEEECCCCHHHHHHHHCCCCCCCEEECCCC-CCCHH------HHHHHHHHCCCEEEE---------CCCCC
T ss_conf             740377279999888802379999658981127872789-77136------788888620696898---------57688


Q ss_pred             CCCCHHHHHHHHHHHHHHCCCEEEEEE-CCCHH-HCCCC
Q ss_conf             126388999999999971898899983-69833-47978
Q gi|254780669|r  238 SGGERQYIVPLAKAAVAIGIAGIFLET-HQDPD-NAPSD  274 (301)
Q Consensus       238 ~gG~r~~v~~la~aa~a~G~dGlfiE~-Hp~P~-~AlsD  274 (301)
                      +||.++=+    .+|.++|+.=++||= .-++. .+..|
T Consensus       212 ~Gg~~~K~----~~A~~lgi~vi~i~RP~~~~~G~~~~D  246 (260)
T TIGR00715       212 KGGLKEKV----EAAEALGIKVILIARPKVDLGGVAVFD  246 (260)
T ss_pred             CCCCHHHH----HHHHHCCCEEEEEECCCCCCCCEEEEC
T ss_conf             67745888----999856942899856875989759981


No 394
>TIGR01584 citF citrate lyase, alpha subunit; InterPro: IPR006472   These sequences, from both Gram-positive and Gram-negative bacteria, represent the alpha subunit of the holoenzyme citrate lyase composed of alpha (2.8.3.10 from EC), beta, and acyl carrier protein subunits in a stoichiometric relationship of 6:6:6. Citrate lyase is an enzyme which converts citrate to oxaloacetate. In bacteria, this reaction is involved in citrate fermentation. The alpha subunit catalyzes the reaction Acetyl-CoA + citrate = acetate + (3S)-citryl-CoA. The protein from Lactococcus lactis subsp. lactis has been experimentally characterised . ; GO: 0008814 citrate CoA-transferase activity, 0006084 acetyl-CoA metabolic process, 0005737 cytoplasm, 0009346 citrate lyase complex.
Probab=24.87  E-value=54  Score=14.27  Aligned_cols=27  Identities=15%  Similarity=0.305  Sum_probs=11.6

Q ss_pred             CCHHHH--HHHHHCCCEEEEECCCCCCHH
Q ss_conf             899999--998505977998367778999
Q gi|254780669|r  146 RQTDLL--TAAAQTGRVINVKKGQFLSPW  172 (301)
Q Consensus       146 rqtdLl--~a~a~t~kpV~iKkgq~~s~~  172 (301)
                      |.||+-  +.+++-.+-+=|-=.|++.|.
T Consensus       309 Q~FD~~A~~S~~~N~~h~Ei~As~YAnP~  337 (496)
T TIGR01584       309 QSFDLKAVESIAKNPKHVEIDASLYANPA  337 (496)
T ss_pred             CCCHHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             57427899998508981678211236888


No 395
>cd04149 Arf6 Arf6 subfamily.  Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions.  In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis.  Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling.  Arf6 is required for and enhances Rac formation of ruffles.  Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection.  In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells.  Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis.  Arf6 is believed t
Probab=24.80  E-value=54  Score=14.27  Aligned_cols=23  Identities=9%  Similarity=0.192  Sum_probs=14.1

Q ss_pred             HHHCCEEEEECCCHHHHHHHHHH
Q ss_conf             65287688522889999876502
Q gi|254780669|r  112 KKYGFPILTDVHTEQQCEAIADS  134 (301)
Q Consensus       112 ~~~glpv~TeV~~~~~~e~~~~~  134 (301)
                      ...++-.|-|..+....+.+.+.
T Consensus        76 ~~~~iifVvDstd~~~~~~~~~~   98 (168)
T cd04149          76 GTQGLIFVVDSADRDRIDEARQE   98 (168)
T ss_pred             CCCEEEEEEECCCHHHHHHHHHH
T ss_conf             88668999837767899999999


No 396
>KOG0423 consensus
Probab=24.65  E-value=37  Score=15.34  Aligned_cols=48  Identities=10%  Similarity=0.286  Sum_probs=22.7

Q ss_pred             CHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             38899999999997189889998369833479782018688999999999
Q gi|254780669|r  241 ERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQ  290 (301)
Q Consensus       241 ~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l~l~~l~~ll~~  290 (301)
                      .++|-|.+...-+..-+--|+|  ||+|++|+-.-+--+-++.++++-..
T Consensus        99 KkDW~p~LGirHvLltikCLLI--~PnPESALNEeAGkmLLEnYdeYa~r  146 (223)
T KOG0423          99 KKDWNPSLGIRHVLLTIKCLLI--EPNPESALNEEAGKMLLENYDEYARR  146 (223)
T ss_pred             HCCCCCCCCHHHHHHHHHEEEE--CCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             0046843015667654102364--27817777588889999868999999


No 397
>PRK02240 GTP cyclohydrolase III; Provisional
Probab=24.58  E-value=51  Score=14.45  Aligned_cols=24  Identities=17%  Similarity=0.433  Sum_probs=14.2

Q ss_pred             CCCCHHHHHHHHHHHHHHCCEEEE
Q ss_conf             567124888999886652876885
Q gi|254780669|r   97 GVGLKKGREIFRDLKKKYGFPILT  120 (301)
Q Consensus        97 G~Gle~gL~il~e~k~~~glpv~T  120 (301)
                      |+.+++-..+.++++..|-+++-.
T Consensus        63 Gi~~~~h~~iq~~i~~~~Pv~vs~   86 (254)
T PRK02240         63 GIDLEAHARIQESIRNRYPVTVSM   86 (254)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             999899999999876239935999


No 398
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]
Probab=24.54  E-value=55  Score=14.23  Aligned_cols=102  Identities=18%  Similarity=0.121  Sum_probs=76.2

Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC-CEEEE-ECCCHHHHHHH
Q ss_conf             49999999999999996553399706601557688666322245671248889998866528-76885-22889999876
Q gi|254780669|r   54 IESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYG-FPILT-DVHTEQQCEAI  131 (301)
Q Consensus        54 iES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~g-lpv~T-eV~~~~~~e~~  131 (301)
                      .++.|+.+.+++.|.+-|.+..    =            =.||.+   ..++..+.++++|. .-|-. .|.+++|++.+
T Consensus        21 ~~~~e~a~~~a~Ali~gGi~~I----E------------ITl~sp---~a~e~I~~l~~~~p~~lIGAGTVL~~~q~~~a   81 (211)
T COG0800          21 GDDVEEALPLAKALIEGGIPAI----E------------ITLRTP---AALEAIRALAKEFPEALIGAGTVLNPEQARQA   81 (211)
T ss_pred             ECCHHHHHHHHHHHHHCCCCEE----E------------EECCCC---CHHHHHHHHHHHCCCCEECCCCCCCHHHHHHH
T ss_conf             0899999999999997698769----9------------964798---78999999998674658824556699999999


Q ss_pred             HH-HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             50-21578822576289999999850597799836777899999999999
Q gi|254780669|r  132 AD-SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQK  180 (301)
Q Consensus       132 ~~-~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~ek  180 (301)
                      .+ ..+.+=-|-   -+-++++.+.+.+.|++   +=.+||.|...|.|+
T Consensus        82 ~~aGa~fiVsP~---~~~ev~~~a~~~~ip~~---PG~~TptEi~~Ale~  125 (211)
T COG0800          82 IAAGAQFIVSPG---LNPEVAKAANRYGIPYI---PGVATPTEIMAALEL  125 (211)
T ss_pred             HHCCCCEEECCC---CCHHHHHHHHHCCCCCC---CCCCCHHHHHHHHHC
T ss_conf             985997898999---99999999986799636---887998999999980


No 399
>KOG3021 consensus
Probab=24.51  E-value=55  Score=14.23  Aligned_cols=35  Identities=11%  Similarity=0.002  Sum_probs=23.8

Q ss_pred             EEEC-----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             7976-----997069995486349999999999999996553
Q gi|254780669|r   37 VTFS-----NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQS   73 (301)
Q Consensus        37 i~ig-----~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~   73 (301)
                      |.-|     +..++++=-+|-  +.+++..--+..|+++-..
T Consensus        25 I~~~r~ydtDaG~~FvK~nr~--~~~~mfeGE~~sLeAi~sT   64 (313)
T KOG3021          25 ISDGRHYDTDAGKVFVKVNRS--IARDMFEGELASLEAIQST   64 (313)
T ss_pred             ECCCCCCCCCCCCEEEEECCC--CCHHHHHHHHHHHHHHHHC
T ss_conf             214544556776279986630--1268876578889999854


No 400
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated
Probab=24.42  E-value=55  Score=14.22  Aligned_cols=178  Identities=13%  Similarity=0.079  Sum_probs=100.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCCCCCCCCCCCCCCHHHHHHH-HHHHHHHCCEEEEECCCHHHHHHHH
Q ss_conf             999999999999999655339-97066015576886663222456712488899-9886652876885228899998765
Q gi|254780669|r   55 ESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGLKKGREIF-RDLKKKYGFPILTDVHTEQQCEAIA  132 (301)
Q Consensus        55 ES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il-~e~k~~~glpv~TeV~~~~~~e~~~  132 (301)
                      ...+.+.+.|..-.+.|+++. ++.-+              ....+ .+-++|+ ..+.+..++|+.-|-.++.-+|...
T Consensus        22 ~d~~~i~~~A~~Q~eaGA~~LDVN~g~--------------~~~de-~~~m~~~v~~iq~~~~~Pl~iDS~~~~aiEaaL   86 (268)
T PRK07535         22 KDAAFIQKLALRQVEAGANYLDVNAGT--------------AVEEE-PETMEWLVETVQEVVDVPLCIDSPNPEAIEAGL   86 (268)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCC--------------CCCCH-HHHHHHHHHHHHHCCCCCEEECCCCHHHHHHHH
T ss_conf             798999999999998499989960898--------------77468-999999999997338999676189899999999


Q ss_pred             HHCCE-EEECHHHCC--CHH-HHHHHHHCCCEEEE----ECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHC
Q ss_conf             02157-882257628--999-99998505977998----36777899999999999972587808995146544401000
Q gi|254780669|r  133 DSVDI-LQIPALLCR--QTD-LLTAAAQTGRVINV----KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV  204 (301)
Q Consensus       133 ~~vDi-lQIgA~~~r--qtd-Ll~a~a~t~kpV~i----Kkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lv  204 (301)
                      ++..- -=|-+-+..  .+| ++.-+.+.|-.|..    ++|+-.+.++=+.+++++...-.      +-|+  ...+++
T Consensus        87 k~~~Gr~iINSis~e~er~~~i~pLakkyga~vI~L~~de~Gip~tae~R~~ia~~i~~~a~------~~Gi--~~edi~  158 (268)
T PRK07535         87 KVAKGRPLINSVSAEEERLEAVLPLVKKYNAPVVALTMDDTGIPKDAEVRLAVAKKLVEKAA------DFGI--PPDDIY  158 (268)
T ss_pred             HHCCCCCEEEEECCCHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHH------HCCC--CHHHEE
T ss_conf             97799972660038805699999999984997999942899999999999999999999999------8599--889988


Q ss_pred             CCCC----------------CCHHHHHH--CCCEEECHHHHHHHCCCCCCCCCCCHHHHHH-HHHHHHHHCCCEEEEE
Q ss_conf             0000----------------10688851--8716871177742122345321263889999-9999997189889998
Q gi|254780669|r  205 TDMR----------------SIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVP-LAKAAVAIGIAGIFLE  263 (301)
Q Consensus       205 vD~~----------------~i~~lk~~--~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~-la~aa~a~G~dGlfiE  263 (301)
                      +|.-                ++-.+|+.  +...++-.|--.+     |-   =.|+++-. +.-.|+.+|.|.-.+-
T Consensus       159 ~DpLv~~i~t~~~~~~~~leair~ik~~~P~v~t~~GlSNiSF-----Gl---P~R~~lNs~FL~~a~~~GLd~aI~n  228 (268)
T PRK07535        159 IDPLVLPLSAAQTAGVEVLETIRRIKELYPKVHTTCGLSNISF-----GL---PNRKLINRAFLVMAMGAGMDSAILD  228 (268)
T ss_pred             EECCCCEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC-----CC---HHHHHHHHHHHHHHHHCCCCEEECC
T ss_conf             8455121006807899999999999987877775245400114-----75---3389999999999998699846459


No 401
>TIGR00423 TIGR00423 conserved hypothetical protein TIGR00423; InterPro: IPR005244    This entry describes a family of conserved hypothetical proteins with no known function. .
Probab=24.28  E-value=55  Score=14.20  Aligned_cols=118  Identities=16%  Similarity=0.184  Sum_probs=68.1

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHH-HCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCE---EEE-ECCCH
Q ss_conf             8634999999999999999655-339970660155768866632224567124888999886652876---885-22889
Q gi|254780669|r   51 PCQIESHDHAFMIAEKLYAICQ-SLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFP---ILT-DVHTE  125 (301)
Q Consensus        51 PCsiES~e~~~~~A~~lk~~~~-~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glp---v~T-eV~~~  125 (301)
                      +=.++.+| +++-++.+.+.|. ++-+.|-.=|-.         +..|..++.=+++|+.+|+++  |   -++ -=..|
T Consensus        33 ~Y~Ls~eE-I~~Kv~ea~~~G~tE~~iQGGlnP~~---------~~nGssl~yy~~l~~~Ik~~~--pPyG~~hiHafSp  100 (331)
T TIGR00423        33 AYVLSLEE-ILRKVKEAVAKGATEICIQGGLNPQL---------DINGSSLEYYEELFRAIKQEF--PPYGDVHIHAFSP  100 (331)
T ss_pred             CCCCCHHH-HHHHHHHHHHCCCEEEEEECCCCCCC---------CCCCCHHHHHHHHHHHHHHCC--CCCCCEEEECCCH
T ss_conf             81407799-99999999971982788523427887---------645414999999999997417--8965247614686


Q ss_pred             HHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCC--------CEEEEEC------CCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             999876502157882257628999999985059--------7799836------7778999999999999725878
Q gi|254780669|r  126 QQCEAIADSVDILQIPALLCRQTDLLTAAAQTG--------RVINVKK------GQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       126 ~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~--------kpV~iKk------gq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      ..+...|+--       .+.-.-+.|+.+.+.|        -=|+.-+      |.=+|=++|+-+.+.-...|-+
T Consensus       101 ~Ev~f~A~~~-------~~~~e~EvL~~LK~aGL~SmPGtgAEILdD~vRr~IcP~K~~s~eWlev~~~AH~~Gip  169 (331)
T TIGR00423       101 MEVYFLAKNE-------GLSIEKEVLKRLKKAGLDSMPGTGAEILDDSVRRKICPNKLSSDEWLEVIKTAHRLGIP  169 (331)
T ss_pred             HHHHHHHHHC-------CCCHHHHHHHHHHHHCCCCCCCCCEEECCHHHHHHHCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             8999999861-------89788999999888503567776226530335875477988727899999999866696


No 402
>PRK07094 biotin synthase; Provisional
Probab=24.25  E-value=55  Score=14.20  Aligned_cols=191  Identities=15%  Similarity=0.126  Sum_probs=97.0

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEC--CCHHHHHHHHH
Q ss_conf             9999999999999965533997066015576886663222456712488899988665287688522--88999987650
Q gi|254780669|r   56 SHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDV--HTEQQCEAIAD  133 (301)
Q Consensus        56 S~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV--~~~~~~e~~~~  133 (301)
                      |.|.+++.|+..++.|.+-   ++.-+.-|      + .+   ..+.-.++.+++|++.++.|..-+  ...++...+.+
T Consensus        71 s~eeI~~~A~~a~~~G~~~---~~lqsG~~------~-~~---~~e~~~~ii~~Ik~~~~l~i~lSlG~l~~e~~~~Lk~  137 (323)
T PRK07094         71 SPEEILECAKKAYELGYGT---IVLQSGED------P-YY---TDEKIADIIKEIKKELDVAITLSLGERSYEEYKAWKE  137 (323)
T ss_pred             CHHHHHHHHHHHHHCCCCE---EEEECCCC------C-CC---CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH
T ss_conf             9999999999999869988---99964899------8-86---6999999999986059945997578799999999998


Q ss_pred             H-CCEEEECHHHCCCHHHHHHHHHCCCEEEEEC-CCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCC-H----HHCCC
Q ss_conf             2-1578822576289999999850597799836-77789999999999997258780899514654440-1----00000
Q gi|254780669|r  134 S-VDILQIPALLCRQTDLLTAAAQTGRVINVKK-GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY-N----TLVTD  206 (301)
Q Consensus       134 ~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKk-gq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy-~----~lvvD  206 (301)
                      . +|-+-.     +.        +|--+-..++ ....+.++|+..++.+...|-+   +| -|..+|- +    +++-|
T Consensus       138 AG~dry~~-----nl--------ETs~~~~y~~i~p~~t~~~Rl~~l~~~k~~G~~---v~-sG~iiGlpGET~edr~~~  200 (323)
T PRK07094        138 AGADRYLL-----RH--------ETADRELYEKLHPGMSFENRIQCLKDLKELGYE---VG-SGFMVGLPGQTLEDLADD  200 (323)
T ss_pred             CCCCEEEC-----CC--------CCCCHHHHCCCCCCCCHHHHHHHHHHHHHCCCC---CC-CEEEECCCCCCHHHHHHH
T ss_conf             59774412-----45--------656989867758999989999999999983981---04-302779899999999999


Q ss_pred             CCCCHHHHHHC---CCE-EECHHHHHH----------------------HCCCCCCCCCCCHHHHHHHHHHHHHHCCCEE
Q ss_conf             00106888518---716-871177742----------------------1223453212638899999999997189889
Q gi|254780669|r  207 MRSIPIMTSMG---VPV-IFDASHSVQ----------------------QPGIHGNCSGGERQYIVPLAKAAVAIGIAGI  260 (301)
Q Consensus       207 ~~~i~~lk~~~---~PV-i~D~SHs~q----------------------~p~~~~~~~gG~r~~v~~la~aa~a~G~dGl  260 (301)
                      +   -.+++++   .|+ .|-|-+.|-                      +|..+=-.|.+.-.+-|..-..|+.+|++=+
T Consensus       201 l---~~LreL~~~~v~i~~fiP~~gTPl~~~~~~~~~~~lr~iAl~Rli~P~a~Ipattal~~l~~~g~~~~l~aGANvv  277 (323)
T PRK07094        201 I---LFLKELDLDMIGIGPFIPHPDTPLADEKGGSLELTLKVLALARLLLPDANIPATTALGTLNPDGREKGLKAGANVV  277 (323)
T ss_pred             H---HHHHHCCCCEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCHHHHHHHHHCCCCEE
T ss_conf             9---9998379988677255179999988999979999999999999978766574446532249889999987688664


Q ss_pred             EEEECCCHH---HCCCCCCCCC
Q ss_conf             998369833---4797820186
Q gi|254780669|r  261 FLETHQDPD---NAPSDGPNMI  279 (301)
Q Consensus       261 fiE~Hp~P~---~AlsD~~q~l  279 (301)
                      |--.-|..-   =++=|+.-.+
T Consensus       278 mp~~tp~~~r~~y~ly~~k~~~  299 (323)
T PRK07094        278 MPNLTPTEYRKLYQLYPGKICT  299 (323)
T ss_pred             CCCCCCHHHCCCCCCCCCCCCC
T ss_conf             7889946762575267998768


No 403
>cd05799 PGM2 This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1). The mammalian PGM2 is thought to be a phosphopentomutase that catalyzes the conversion of the nucleoside breakdown products, ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. PGM2L1 is thought to catalyze the 1,3-bisphosphoglycerate-dependent synthesis of glucose 1,6-bisphosphate and other aldose-bisphosphates that serve as cofactors for several sugar phosphomutases and possibly also as regulators of glycolytic enzymes. PGM2 and PGM2L1 belong to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/ph
Probab=24.18  E-value=56  Score=14.19  Aligned_cols=18  Identities=28%  Similarity=0.084  Sum_probs=6.8

Q ss_pred             CHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999996553
Q gi|254780669|r   56 SHDHAFMIAEKLYAICQS   73 (301)
Q Consensus        56 S~e~~~~~A~~lk~~~~~   73 (301)
                      |+.....+|..+.+.|.+
T Consensus        58 s~~~a~~~a~~l~~~G~~   75 (487)
T cd05799          58 SREFAELTAAVLAANGIK   75 (487)
T ss_pred             HHHHHHHHHHHHHHCCCE
T ss_conf             899999999999977997


No 404
>pfam00265 TK Thymidine kinase.
Probab=24.15  E-value=56  Score=14.19  Aligned_cols=44  Identities=18%  Similarity=0.128  Sum_probs=32.9

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCC
Q ss_conf             6999548634999999999999999655339970660155768866632
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA   93 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~   93 (301)
                      |.+|.||=-----..+++.+...+..+.+   -.+|||+.|.  |.+..
T Consensus         3 L~~i~GpMfsGKTteLi~~~~~~~~~gkk---vl~i~p~~D~--R~~~~   46 (175)
T pfam00265         3 IELIIGPMFSGKSTELIRRVYRYQLAQYK---CVVIKYAIDN--RYGTG   46 (175)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCCE---EEEEEECCCC--CCCCC
T ss_conf             99999251778999999999999987993---9999461127--78999


No 405
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins. Amino acid dehydrogenase(DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and are found in glutamate, leucine, and phenylalanine DHs (DHs), methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel  domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an al
Probab=23.95  E-value=56  Score=14.16  Aligned_cols=48  Identities=19%  Similarity=0.252  Sum_probs=30.4

Q ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCC--HHHCCCCCCCHHHHH-HCCCEEECHH
Q ss_conf             99999997258780899514654440--100000001068885-1871687117
Q gi|254780669|r  175 HNILQKLHAHGAKDVLFCERGTSFGY--NTLVTDMRSIPIMTS-MGVPVIFDAS  225 (301)
Q Consensus       175 ~~a~eki~~~Gn~~i~lcERG~~fgy--~~lvvD~~~i~~lk~-~~~PVi~D~S  225 (301)
                      ..+++.+...|.++|++|.|.+-++-  .+..+..+   .+.+ ..-|+|+|..
T Consensus        36 ~~ia~ll~~~~~k~V~~~d~Di~v~~t~~~~~~~~~---~~~~~~~~~vv~~~a   86 (86)
T cd05191          36 KGIAKLLADEGGKKVVLCDRDILVTATPAGVPVLEE---ATAKINEGAVVIDLA   86 (86)
T ss_pred             HHHHHHHHHHCCCEEEECCCCEEEECCCCCCCCHHH---HHHHCCCCCEEEECC
T ss_conf             899999998179707871555288605778712787---764216871888539


No 406
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional
Probab=23.94  E-value=56  Score=14.16  Aligned_cols=102  Identities=12%  Similarity=0.145  Sum_probs=60.0

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHH
Q ss_conf             63499999999999999965533997066015576886663222456712488899988665287688522889999876
Q gi|254780669|r   52 CQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAI  131 (301)
Q Consensus        52 CsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~  131 (301)
                      |.+-+.|.    |+.+.+.+++ .+|++|-|          .|-|-+-.+.+.++.+.+......-.+.--.+.+.++.+
T Consensus         6 CGit~~ed----a~~a~~~gaD-~iGfif~~----------~SpR~i~~~~a~~i~~~~~~~~~~VgVfvn~~~~~i~~~   70 (207)
T PRK13958          6 CGFTSIKD----VTAASQLPID-AIGFIHYE----------KSKRHQTITQIKKLASAVPNHIDKVCVMVNPDLTTIEHV   70 (207)
T ss_pred             ECCCCHHH----HHHHHHCCCC-EEEEECCC----------CCCCCCCHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHH
T ss_conf             18997999----9999968999-99995578----------999865999999999865546886999946979999999


Q ss_pred             HH--HCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCC
Q ss_conf             50--2157882257628999999985059779983677789
Q gi|254780669|r  132 AD--SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLS  170 (301)
Q Consensus       132 ~~--~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s  170 (301)
                      .+  ..|++|+-.  ....+.++++.+....+-+-|....+
T Consensus        71 ~~~~~ld~vQlHG--~e~~~~~~~~~~~~~~~~iika~~~~  109 (207)
T PRK13958         71 LSNTSINTIQLHG--TESIDFIQEIKKKYSSIKITKALAAD  109 (207)
T ss_pred             HHHCCCCEEEECC--CCCHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             9857997798648--99999999997555896799996166


No 407
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP). Most PRAIs are monomeric, monofunctional and thermolabile, but in some thermophile organisms PRAI is dimeric for reasons of stability and in others it is fused to other components of the tryptophan biosynthesis pathway to form multifunctional enzymes.
Probab=23.76  E-value=57  Score=14.14  Aligned_cols=123  Identities=15%  Similarity=0.142  Sum_probs=63.1

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHH
Q ss_conf             63499999999999999965533997066015576886663222456712488899988665287688522889999876
Q gi|254780669|r   52 CQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAI  131 (301)
Q Consensus        52 CsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~  131 (301)
                      |.+-+.+.    |+.+.+.+.+ .+|++|-+          .|-|-...++..++.+.++.....--++--.+.+.+..+
T Consensus         4 CGit~~~d----~~~~~~~g~d-~iGfif~~----------~SpR~i~~~~a~~l~~~~~~~~~~V~Vfvn~~~~~i~~~   68 (203)
T cd00405           4 CGITTLED----ALAAAEAGAD-AIGFIFAP----------KSPRYVSPEQAREIVAALPPFVKRVGVFVNEDLEEILEI   68 (203)
T ss_pred             CCCCCHHH----HHHHHHCCCC-EEEEECCC----------CCCCEECHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHH
T ss_conf             88895999----9999857999-89885569----------989711899999999736998539999916839999999


Q ss_pred             HH-H-CCEEEECHHHCCCHHHHHHHHHC-CCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             50-2-15788225762899999998505-97799836777899999999999972587808995146
Q gi|254780669|r  132 AD-S-VDILQIPALLCRQTDLLTAAAQT-GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERG  195 (301)
Q Consensus       132 ~~-~-vDilQIgA~~~rqtdLl~a~a~t-~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG  195 (301)
                      .+ + .|++|+-.-  -.-+.+.++.+. +.+|.--=.. ....++..+.+   ..+..+.+|.+..
T Consensus        69 ~~~~~~d~vQlHG~--e~~~~~~~lk~~~~~~iikai~v-~~~~~~~~~~~---~~~~~d~~L~Ds~  129 (203)
T cd00405          69 AEELGLDVVQLHGD--ESPEYCAQLRARLGLPVIKAIRV-KDEEDLEKAAA---YAGEVDAILLDSK  129 (203)
T ss_pred             HHHCCCCEEEECCC--CCHHHHHHHHHHCCCEEEEEECC-CCHHHHHHHHH---HCCCCCEEEEECC
T ss_conf             98769988998789--99799999875059649999614-97777999987---4377758999688


No 408
>COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane]
Probab=23.73  E-value=57  Score=14.14  Aligned_cols=111  Identities=16%  Similarity=0.197  Sum_probs=62.7

Q ss_pred             ECCCEEEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCC---CCEEEECCCCCCC-C-CCCCCCCC
Q ss_conf             31770683578772797699706999548634999999999999999655339---9706601557688-6-66322245
Q gi|254780669|r   23 HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN---IGLVYKSSFDKAN-R-SSLAGKRG   97 (301)
Q Consensus        23 ~~~~~~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~---~~~ifK~sfdKan-R-tS~~sfrG   97 (301)
                      .....+.|    ||+++||+.+-.            .++.+|+.+++.|-+..   |||  |+.....- . +-..+-+.
T Consensus        45 ~pvPVI~V----GNltvGGtGKTP------------~vi~la~~l~~rG~~~gvvSRGY--gg~~~~~~~~~~~~~~a~~  106 (336)
T COG1663          45 APVPVICV----GNLTVGGTGKTP------------VVIWLAEALQARGVRVGVVSRGY--GGKLKVVPLVDNIHTTAAE  106 (336)
T ss_pred             CCCCEEEE----CCEEECCCCCCH------------HHHHHHHHHHHCCCEEEEEECCC--CCCCCCCCCCCCCCCCHHH
T ss_conf             78878998----557777899688------------99999999986697367980576--8887654102567678677


Q ss_pred             CCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHH---HCCEEEE-----CHHHCCCHHHHHHHHH
Q ss_conf             671248889998866528768852288999987650---2157882-----2576289999999850
Q gi|254780669|r   98 VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIAD---SVDILQI-----PALLCRQTDLLTAAAQ  156 (301)
Q Consensus        98 ~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~---~vDilQI-----gA~~~rqtdLl~a~a~  156 (301)
                      .| +|.+-+-+    +++.||+...-..+-++.+.+   .+|++=.     -.||.|+++|+.--+.
T Consensus       107 ~G-DEPlLlA~----~t~~pv~v~~~R~~~~~~l~~~~~~~diIi~DDG~Qh~rL~rD~eIvvvd~~  168 (336)
T COG1663         107 VG-DEPLLLAR----RTGAPVAVSPDRKDAAKALLAAHLGCDIIVLDDGLQHYRLHRDFEIVVVDGQ  168 (336)
T ss_pred             CC-CHHHHHHH----HCCCCEEEEHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHCCEEEEEEECC
T ss_conf             28-46888755----3399689864298999999851789899997674312676436469997366


No 409
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=23.62  E-value=57  Score=14.12  Aligned_cols=23  Identities=13%  Similarity=0.180  Sum_probs=11.6

Q ss_pred             HHHCCEEEEECCCHHHHHHHHHH
Q ss_conf             65287688522889999876502
Q gi|254780669|r  112 KKYGFPILTDVHTEQQCEAIADS  134 (301)
Q Consensus       112 ~~~glpv~TeV~~~~~~e~~~~~  134 (301)
                      ...++-.+-|..+....+.+.+.
T Consensus        68 ~~~~iI~VvDssd~~~~~~~~~~   90 (162)
T cd04157          68 NIQGIIFVIDSSDRLRLVVVKDE   90 (162)
T ss_pred             CCCEEEEEEECCCHHHHHHHHHH
T ss_conf             67448999707638889999999


No 410
>pfam04872 Pox_L5 Poxvirus L5 protein family. This family includes variola (smallpox) and vaccinia virus L5 proteins. However, not all proteins in this family are called L5. L5 is thought to contain a metal-binding region.
Probab=23.53  E-value=56  Score=14.17  Aligned_cols=50  Identities=16%  Similarity=0.083  Sum_probs=39.3

Q ss_pred             HHHHHHHHHHHHHCCCEEEE-EEC-CCHHHCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             89999999999718988999-836-983347978201868899999999999
Q gi|254780669|r  243 QYIVPLAKAAVAIGIAGIFL-ETH-QDPDNAPSDGPNMINIKDLPKLLSQLL  292 (301)
Q Consensus       243 ~~v~~la~aa~a~G~dGlfi-E~H-p~P~~AlsD~~q~l~l~~l~~ll~~l~  292 (301)
                      +-+-.+.++-.++--|++|| +-| -.+..||+=-.+.+.++.-+.||.++.
T Consensus        15 ~pid~~~~t~L~C~gn~lmI~~lPn~g~~~ALald~~pI~~~~C~~lL~sIN   66 (79)
T pfam04872        15 NPIDKFDKTSLACKGNKLMIIGLPNSGTKPALALDGSPIVIPNCEALLQSIN   66 (79)
T ss_pred             CHHHHHHHHCEEECCCCEEEEECCCCCCCCCCCCCCCCEECCCHHHHHHHCC
T ss_conf             9799986420441788337753689886410002898322469899998626


No 411
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=23.50  E-value=57  Score=14.11  Aligned_cols=159  Identities=11%  Similarity=0.232  Sum_probs=99.5

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEC
Q ss_conf             70699954863499999999999999965533997066015576886663222456712488899988665287688522
Q gi|254780669|r   43 QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDV  122 (301)
Q Consensus        43 ~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV  122 (301)
                      ++.+..-||-.|----.+-+.|....-...+..++.|           +.++|| .|.-|-|++..+   ..|+|+.- |
T Consensus       203 ~~vi~LVGPTGVGKTTTlAKLAar~~~~~~~~kVaiI-----------TtDtYR-IGA~EQLk~Ya~---im~vp~~v-v  266 (407)
T COG1419         203 KRVIALVGPTGVGKTTTLAKLAARYVMLKKKKKVAII-----------TTDTYR-IGAVEQLKTYAD---IMGVPLEV-V  266 (407)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEE-----------EECCCH-HHHHHHHHHHHH---HHCCCEEE-E
T ss_conf             8579998998875887999999999753257606899-----------714411-528999999999---86995599-6


Q ss_pred             CCHHHHHH---HHHHCCEEEECH--HHCCCHHHHHHHHHCCCE-----EEEECCCCCCHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             88999987---650215788225--762899999998505977-----99836777899999999999972587808995
Q gi|254780669|r  123 HTEQQCEA---IADSVDILQIPA--LLCRQTDLLTAAAQTGRV-----INVKKGQFLSPWEMHNILQKLHAHGAKDVLFC  192 (301)
Q Consensus       123 ~~~~~~e~---~~~~vDilQIgA--~~~rqtdLl~a~a~t~kp-----V~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lc  192 (301)
                      -++...+.   .....|++=|-.  |+-++...+.++...-.+     +++==.-...-.+|.-+.+.+...+-..+|+|
T Consensus       267 ~~~~el~~ai~~l~~~d~ILVDTaGrs~~D~~~i~el~~~~~~~~~i~~~Lvlsat~K~~dlkei~~~f~~~~i~~~I~T  346 (407)
T COG1419         267 YSPKELAEAIEALRDCDVILVDTAGRSQYDKEKIEELKELIDVSHSIEVYLVLSATTKYEDLKEIIKQFSLFPIDGLIFT  346 (407)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             39999999999853188899968998833789999999997035662179998457646889999997245886616897


Q ss_pred             ECCCCCCCHHHCCCCCCCHHHHHHCCCEEEC
Q ss_conf             1465444010000000106888518716871
Q gi|254780669|r  193 ERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD  223 (301)
Q Consensus       193 ERG~~fgy~~lvvD~~~i~~lk~~~~PVi~D  223 (301)
                      -=--+..|+++      +-+|-+.++||-|=
T Consensus       347 KlDET~s~G~~------~s~~~e~~~PV~Yv  371 (407)
T COG1419         347 KLDETTSLGNL------FSLMYETRLPVSYV  371 (407)
T ss_pred             CCCCCCCHHHH------HHHHHHHCCCEEEE
T ss_conf             13356763389------99999968974997


No 412
>TIGR02152 D_ribokin_bact ribokinase; InterPro: IPR011877    This entry describes ribokinase, an enzyme catalyzing the first step in ribose catabolism. The rbsK gene encoding ribokinase typically is found with ribose transport genes. Ribokinase belongs to the carbohydrate kinase pfkB family. ; GO: 0004747 ribokinase activity, 0006014 D-ribose metabolic process.
Probab=23.47  E-value=57  Score=14.10  Aligned_cols=122  Identities=19%  Similarity=0.225  Sum_probs=75.6

Q ss_pred             EECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCE
Q ss_conf             97699706999548634999999999999999655339970660155768866632224567124888999886652876
Q gi|254780669|r   38 TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFP  117 (301)
Q Consensus        38 ~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glp  117 (301)
                      .=.++|..+|++|=+.-=|++.+...-+.+++.--  .+                 .=.+.-+|--+..++-+ +++|++
T Consensus       100 ~~~G~N~I~v~~GAN~~l~~~~~~~~~~~i~~s~~--~~-----------------~QlEiP~etv~~a~~~a-~~~G~~  159 (303)
T TIGR02152       100 DDTGENRIVVVAGANAELTPEDIDAAEALIAESDI--VL-----------------LQLEIPLETVLEALKIA-KKHGVK  159 (303)
T ss_pred             CCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCE--EE-----------------EECCCCHHHHHHHHHHH-HHCCCC
T ss_conf             37888579880275645798899999987746888--99-----------------72378889999999999-965898


Q ss_pred             EEEECCCHHHH-------HHHHHHCCEEEECHHHCCC-HHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             88522889999-------8765021578822576289-999999850597799836777899999999999972587808
Q gi|254780669|r  118 ILTDVHTEQQC-------EAIADSVDILQIPALLCRQ-TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDV  189 (301)
Q Consensus       118 v~TeV~~~~~~-------e~~~~~vDilQIgA~~~rq-tdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i  189 (301)
                      |+=   +|--+       +.+..++|+|      +=| ||   +.-=|+.+|       .+.+++..|++++.+.|.++|
T Consensus       160 viL---NPAPA~~~~~~m~e~l~~~D~i------~PNEtE---ae~Ltg~~v-------~~~~~~~~AA~~L~~~G~~~V  220 (303)
T TIGR02152       160 VIL---NPAPAQKKLPKMDELLSLVDII------VPNETE---AEILTGIEV-------TDEEDAEKAAEKLLEKGVKNV  220 (303)
T ss_pred             EEE---CCCCCCCCCCHHHHHHHHCCEE------CCCHHH---HHHHCCCCC-------CCHHHHHHHHHHHHHCCCEEE
T ss_conf             986---6888887875489898642464------478799---998739987-------898999999999986784069


Q ss_pred             EEE--ECCCCC
Q ss_conf             995--146544
Q gi|254780669|r  190 LFC--ERGTSF  198 (301)
Q Consensus       190 ~lc--ERG~~f  198 (301)
                      |+|  +||.-|
T Consensus       221 IiTLG~kGa~~  231 (303)
T TIGR02152       221 IITLGSKGALL  231 (303)
T ss_pred             EEEECCCEEEE
T ss_conf             88654736799


No 413
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=23.40  E-value=45  Score=14.77  Aligned_cols=66  Identities=15%  Similarity=0.143  Sum_probs=35.0

Q ss_pred             CCHHHHHHHHHH-HHHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEE---EC--CCCCCH
Q ss_conf             712488899988-665287688522889999876502-15788225762899999998505977998---36--777899
Q gi|254780669|r   99 GLKKGREIFRDL-KKKYGFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINV---KK--GQFLSP  171 (301)
Q Consensus        99 Gle~gL~il~e~-k~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~i---Kk--gq~~s~  171 (301)
                      |-+.-..+++.- ....++-.|-|-.|.++++.+.+. -+++.-+             .-.++|++|   |.  +..+++
T Consensus        70 G~~~~R~lW~~Yy~~~~~iIfVVDssD~~r~~eak~~L~~ll~~~-------------~l~~~PlLilaNKqDl~~a~~~  136 (184)
T smart00178       70 GHQQARRLWKDYFPEVNGIVYLVDAYDKERFAESKRELDALLSDE-------------ELATVPFLILGNKIDAPYAASE  136 (184)
T ss_pred             CCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHH-------------HHCCCCEEEEEECCCCCCCCCH
T ss_conf             877788999988216758999972686889999999999986467-------------6559709999975677789999


Q ss_pred             HHHHHH
Q ss_conf             999999
Q gi|254780669|r  172 WEMHNI  177 (301)
Q Consensus       172 ~e~~~a  177 (301)
                      .|....
T Consensus       137 ~ei~~~  142 (184)
T smart00178      137 DELRYA  142 (184)
T ss_pred             HHHHHH
T ss_conf             999988


No 414
>COG1109 {ManB} Phosphomannomutase [Carbohydrate transport and metabolism]
Probab=23.24  E-value=58  Score=14.07  Aligned_cols=24  Identities=17%  Similarity=0.279  Sum_probs=10.6

Q ss_pred             EECCCCCCHHHHH-HHHHHHHHCCC
Q ss_conf             8367778999999-99999972587
Q gi|254780669|r  163 VKKGQFLSPWEMH-NILQKLHAHGA  186 (301)
Q Consensus       163 iKkgq~~s~~e~~-~a~eki~~~Gn  186 (301)
                      -++|++.+.+... -.+.++.+.+.
T Consensus       257 d~~G~~~~Gd~i~~lla~~ll~~~~  281 (464)
T COG1109         257 DERGNFVDGDQILALLAKYLLEKGK  281 (464)
T ss_pred             ECCCCEECHHHHHHHHHHHHHHCCC
T ss_conf             5899787727999999999996578


No 415
>PRK11539 hypothetical protein; Provisional
Probab=23.16  E-value=52  Score=14.36  Aligned_cols=53  Identities=19%  Similarity=0.063  Sum_probs=21.1

Q ss_pred             EEECCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEC
Q ss_conf             6835787727976997069995486349999999999999996553399706601
Q gi|254780669|r   28 IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS   82 (301)
Q Consensus        28 ~~ig~~~~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~   82 (301)
                      ..+|-|.--+.-.+++-+++-+||-.-++.---.-+.-.|+..|.+  +.+++=+
T Consensus       504 LDVGQG~avlI~~~~~~~L~DtG~~~~~~~~g~~vi~P~L~~~Gi~--lD~lvlS  556 (754)
T PRK11539        504 LDVGQGLAMVIERNGKAILYDTGNAWPEGDSAQQVIIPWLRWHNLT--PEGVILS  556 (754)
T ss_pred             EECCCCEEEEEEECCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCC--CEEEEEC
T ss_conf             9727851899998997899957998888872377889999967997--2089945


No 416
>PRK09490 metH B12-dependent methionine synthase; Provisional
Probab=23.16  E-value=58  Score=14.06  Aligned_cols=21  Identities=29%  Similarity=0.434  Sum_probs=10.3

Q ss_pred             CCCCCCCHHHHHHHHHHHHHH
Q ss_conf             486349999999999999996
Q gi|254780669|r   50 GPCQIESHDHAFMIAEKLYAI   70 (301)
Q Consensus        50 GPCsiES~e~~~~~A~~lk~~   70 (301)
                      |=|-=-++||+..+++.++..
T Consensus       312 GGCCGTTPeHI~al~~~v~~~  332 (1229)
T PRK09490        312 GGCCGTTPEHIAAIAEAVAGL  332 (1229)
T ss_pred             CCCCCCCHHHHHHHHHHHHCC
T ss_conf             766799989999999875038


No 417
>TIGR00789 flhB_rel FlhB domain protein; InterPro: IPR004683 This group describes a short protein (80-93 residues) homologous to the C-terminus of the flagellar biosynthetic protein FlhB. It is found so far only in species that also have FlhB. In a phylogenetic tree based on alignment of both this family and the homologous region of FlhB and its homologs, the members of this family form a monophyletic set..
Probab=23.01  E-value=49  Score=14.58  Aligned_cols=31  Identities=32%  Similarity=0.402  Sum_probs=22.8

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHH
Q ss_conf             456712488899988665287688522889999
Q gi|254780669|r   96 RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQC  128 (301)
Q Consensus        96 rG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~  128 (301)
                      .|.| +-+-+|.+.+| +||+|+..|=+-.+.+
T Consensus        23 sG~G-evA~~II~~AK-~~gipi~ed~~L~~~L   53 (84)
T TIGR00789        23 SGVG-EVAEKIIELAK-KHGIPIKEDEDLVDVL   53 (84)
T ss_pred             CCCC-HHHHHHHHHHH-HCCCCCCCCHHHHHHH
T ss_conf             1676-57889999997-6389976582899987


No 418
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]
Probab=22.99  E-value=59  Score=14.04  Aligned_cols=217  Identities=20%  Similarity=0.292  Sum_probs=115.8

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCC-----CCCCCCCC-CCCCHHHHHHHHHHHHH-HCCE
Q ss_conf             999548634999999999999999655339-9706601557688-----66632224-56712488899988665-2876
Q gi|254780669|r   46 VLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKAN-----RSSLAGKR-GVGLKKGREIFRDLKKK-YGFP  117 (301)
Q Consensus        46 ~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKan-----RtS~~sfr-G~Gle~gL~il~e~k~~-~glp  117 (301)
                      ++.+|=   -+.|...++++.|.+.|+... .|.-|.  -+.|-     +++....+ |..+++.|+++++++++ .++|
T Consensus        22 yit~Gd---P~~e~s~e~i~~L~~~GaD~iELGvPfS--DPvADGP~Iq~A~~rAL~~g~t~~~~lel~~~~r~~~~~~P   96 (265)
T COG0159          22 YVTAGD---PDLETSLEIIKTLVEAGADILELGVPFS--DPVADGPTIQAAHLRALAAGVTLEDTLELVEEIRAKGVKVP   96 (265)
T ss_pred             EEECCC---CCHHHHHHHHHHHHHCCCCEEEECCCCC--CCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             894889---9989999999999867988899668888--86766889999899999779988999999999986189998


Q ss_pred             EEE-----ECCC---HHHHHHHHHH-CCEEEECHHHCCCH-HHHHHHHHCCC-EEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             885-----2288---9999876502-15788225762899-99999850597-799836777899999999999972587
Q gi|254780669|r  118 ILT-----DVHT---EQQCEAIADS-VDILQIPALLCRQT-DLLTAAAQTGR-VINVKKGQFLSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       118 v~T-----eV~~---~~~~e~~~~~-vDilQIgA~~~rqt-dLl~a~a~t~k-pV~iKkgq~~s~~e~~~a~eki~~~Gn  186 (301)
                      ++-     .|..   ..-++.+++. ||-+=||-.--..- ++..++.+.+. +|.+--+  -|+++++   +++.+..-
T Consensus        97 ivlm~Y~Npi~~~Gie~F~~~~~~~GvdGlivpDLP~ee~~~~~~~~~~~gi~~I~lvaP--tt~~~rl---~~i~~~a~  171 (265)
T COG0159          97 IVLMTYYNPIFNYGIEKFLRRAKEAGVDGLLVPDLPPEESDELLKAAEKHGIDPIFLVAP--TTPDERL---KKIAEAAS  171 (265)
T ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEECC--CCCHHHH---HHHHHHCC
T ss_conf             899870118877359999999997599879857898667778999999769867988699--9998999---99997479


Q ss_pred             CCEEEEEC-CCCCCCHHHC-CC-CCCCHHHHHH-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             80899514-6544401000-00-0010688851-8716871177742122345321263889999999999718988999
Q gi|254780669|r  187 KDVLFCER-GTSFGYNTLV-TD-MRSIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL  262 (301)
Q Consensus       187 ~~i~lcER-G~~fgy~~lv-vD-~~~i~~lk~~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfi  262 (301)
                      -=|.+.-| |+| |-.+.+ .+ -+.+..+|++ ..||++--.=|             +++-+    +....+ +||+.+
T Consensus       172 GFiY~vs~~GvT-G~~~~~~~~~~~~v~~vr~~~~~Pv~vGFGIs-------------~~e~~----~~v~~~-ADGVIV  232 (265)
T COG0159         172 GFIYYVSRMGVT-GARNPVSADVKELVKRVRKYTDVPVLVGFGIS-------------SPEQA----AQVAEA-ADGVIV  232 (265)
T ss_pred             CCEEEEECCCCC-CCCCCCCHHHHHHHHHHHHHCCCCEEEECCCC-------------CHHHH----HHHHHH-CCEEEE
T ss_conf             858999666666-77765304699999999974489738744869-------------99999----999976-885797


Q ss_pred             EECCCHHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             8369833479782018688999999999999
Q gi|254780669|r  263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLA  293 (301)
Q Consensus       263 E~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~  293 (301)
                      -+---  +.+.++...-.+.++..|++++++
T Consensus       233 GSAiV--~~i~~~~~~~~~~~~~~l~~~l~~  261 (265)
T COG0159         233 GSAIV--KIIEEGLDEEALEELRALVKELKA  261 (265)
T ss_pred             CHHHH--HHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             39999--999955514469999999999998


No 419
>pfam05036 SPOR Sporulation related domain. This 70 residue domain is composed of two 35 residue repeats found in proteins involved in sporulation and cell division such as FtsN, DedD, and CwlM. This domain is involved in binding peptidoglycan. Two tandem repeats fold into a pseudo-2-fold symmetric single-domain structure containing numerous contacts between the repeats. FtsN is an essential cell division protein with a simple bitopic topology, a short N-terminal cytoplasmic segment fused to a large carboxy periplasmic domain through a single transmembrane domain. These repeats lay at the periplasmic C-terminus. FtsN localizes to the septum ring complex.
Probab=22.79  E-value=59  Score=14.02  Aligned_cols=22  Identities=41%  Similarity=0.486  Sum_probs=9.7

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             7778999999999999725878
Q gi|254780669|r  166 GQFLSPWEMHNILQKLHAHGAK  187 (301)
Q Consensus       166 gq~~s~~e~~~a~eki~~~Gn~  187 (301)
                      |.|.+.++...+.+++.+.|..
T Consensus        49 Gpf~~~~~A~~~~~~Lk~~g~~   70 (75)
T pfam05036        49 GPFASREEARAALKKLKAAGLS   70 (75)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCC
T ss_conf             8869999999999999985998


No 420
>COG1366 SpoIIAA Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) [Signal transduction mechanisms]
Probab=22.79  E-value=31  Score=15.90  Aligned_cols=66  Identities=23%  Similarity=0.287  Sum_probs=36.8

Q ss_pred             HCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCC
Q ss_conf             0000001068885187168711777421223453212638899999999997189889998369833479
Q gi|254780669|r  203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP  272 (301)
Q Consensus       203 lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~Al  272 (301)
                      +++|+.+++.|-..++-+++...+++++-|..-- .-|.+   |.+++--...|.+..|+-...+++.+.
T Consensus        47 ivIDls~v~~~dS~gl~~L~~~~~~~~~~g~~~~-l~~i~---p~v~~~~~~~gl~~~~~~~~~~~~~~~  112 (117)
T COG1366          47 LVIDLSGVDFMDSAGLGVLVALLKSARLRGVELV-LVGIQ---PEVARTLELTGLDKSFIITPTELEAAL  112 (117)
T ss_pred             EEEECCCCCEECCHHHHHHHHHHHHHHHCCCCEE-EEECC---HHHHHHHHHHCCCCEEEECCCCHHHHH
T ss_conf             9998888877454589999999999986699489-99299---999999999397412552334077887


No 421
>PRK12861 malic enzyme; Reviewed
Probab=22.65  E-value=59  Score=14.00  Aligned_cols=152  Identities=18%  Similarity=0.267  Sum_probs=77.9

Q ss_pred             CCCCCCCH-----HHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEE----EEE
Q ss_conf             22456712-----488899988665287688522889999876502157882257628999999985059779----983
Q gi|254780669|r   94 GKRGVGLK-----KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI----NVK  164 (301)
Q Consensus        94 sfrG~Gle-----~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV----~iK  164 (301)
                      +|.|.-||     +..+|.+++|++.++||.-|=.+-.-+-..+                -|+-++--++|.+    .+-
T Consensus       129 tfgginledi~ap~cf~ie~~l~~~~~ipv~hddqhgtaii~~a----------------~l~nal~~~~k~~~~~kiv~  192 (762)
T PRK12861        129 TFGGINLEDIKAPECFTVERKLRERMKIPVFHDDQHGTAITVAA----------------AFINGLKVVGKSIKEVKVVT  192 (762)
T ss_pred             CCCCCCHHHCCCCCCHHHHHHHHHHCCCCEECCCCCCHHHHHHH----------------HHHHHHHHHCCCHHHEEEEE
T ss_conf             75623798768974027999999867998231677608999999----------------99999998287565616999


Q ss_pred             CCCCCCHHHHHHHHHHHHHCC--CCCEEEEECC-C-CCCCHHHCCCCC-------CCHHHHHH--CCCEEECHHHHHHHC
Q ss_conf             677789999999999997258--7808995146-5-444010000000-------10688851--871687117774212
Q gi|254780669|r  165 KGQFLSPWEMHNILQKLHAHG--AKDVLFCERG-T-SFGYNTLVTDMR-------SIPIMTSM--GVPVIFDASHSVQQP  231 (301)
Q Consensus       165 kgq~~s~~e~~~a~eki~~~G--n~~i~lcERG-~-~fgy~~lvvD~~-------~i~~lk~~--~~PVi~D~SHs~q~p  231 (301)
                      .|-.++.   +.+++-+.+.|  .+||++|.|- . .-|..++.....       +.-.|.+.  +--|++-.|-    |
T Consensus       193 ~GaGaa~---ia~~~l~~~~G~~~~ni~~~D~~G~i~~~r~~~~~~~k~~~a~~t~~~~l~ea~~gaDvfiG~S~----~  265 (762)
T PRK12861        193 SGAGAAA---LACLDLLVDLGLPVENIWVTDIEGVVYRGRTTLMDPAKERFAQETDARTLAEVIGGADVFLGLSA----G  265 (762)
T ss_pred             ECCCHHH---HHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHCCCCEEEECCC----C
T ss_conf             6877889---99999999839995558999477851189865357999999856897779998378988997678----9


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHH----------------CCCCCCCCCC
Q ss_conf             234532126388999999999971898899983698334----------------7978201868
Q gi|254780669|r  232 GIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDN----------------APSDGPNMIN  280 (301)
Q Consensus       232 ~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~----------------AlsD~~q~l~  280 (301)
                          +  -=..++|..|++..+      +|.=..|+|+-                .-||=|+|++
T Consensus       266 ----~--~~~~~mv~~Ma~~pi------vfalANP~PEI~p~~a~~~r~~~i~aTGRSD~pNQvN  318 (762)
T PRK12861        266 ----G--VLKAEMLKAMAARPL------ILALANPTPEIFPELAHATRDDVVIATGRSDYPNQVN  318 (762)
T ss_pred             ----C--CCCHHHHHHHCCCCE------EEECCCCCCCCCHHHHHHHCCCEEEECCCCCCCCCCC
T ss_conf             ----9--899999985377876------9972699988898998541686898348878853124


No 422
>PRK07315 fructose-bisphosphate aldolase; Provisional
Probab=22.59  E-value=60  Score=13.99  Aligned_cols=78  Identities=24%  Similarity=0.419  Sum_probs=35.6

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC-CHHH--CCCCCCCHHHHH-H-CCCEEECHHHHHHHCCCCCCCCCC
Q ss_conf             7778999999999999725878089951465444-0100--000001068885-1-871687117774212234532126
Q gi|254780669|r  166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFG-YNTL--VTDMRSIPIMTS-M-GVPVIFDASHSVQQPGIHGNCSGG  240 (301)
Q Consensus       166 gq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fg-y~~l--vvD~~~i~~lk~-~-~~PVi~D~SHs~q~p~~~~~~~gG  240 (301)
                      +....+++.    ..+..+|. +.+..-=|+..| |..-  ..||.-+..+++ . +.|+++   |     |+    ||=
T Consensus       151 ~~~~~~e~a----~~f~eTgv-D~LAvaiGt~HG~Y~~~~~~L~~d~l~~I~~~v~~vPLVL---H-----Gg----SG~  213 (293)
T PRK07315        151 GELAPIEDA----KAMVETGI-DFLAAGIGNIHGPYPENWEGLDLDHLEKLTEAVPGFPIVL---H-----GG----SGI  213 (293)
T ss_pred             CCCCCHHHH----HHHHHCCC-CEEEHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCEEE---E-----CC----CCC
T ss_conf             666888899----99987066-4340120452455389998768999999985179985797---5-----89----999


Q ss_pred             CHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             388999999999971898899983
Q gi|254780669|r  241 ERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       241 ~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                      ..    ..-+.|+..|+.=+=+-|
T Consensus       214 ~~----e~i~~ai~~Gi~KvNi~T  233 (293)
T PRK07315        214 PD----DQIQEAIKLGVAKVNVNT  233 (293)
T ss_pred             CH----HHHHHHHHCCCEEEEECC
T ss_conf             99----999999981955887461


No 423
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=22.56  E-value=49  Score=14.57  Aligned_cols=53  Identities=13%  Similarity=0.099  Sum_probs=29.7

Q ss_pred             HHHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEE--C---CCCCCHHHHHH
Q ss_conf             665287688522889999876502-157882257628999999985059779983--6---77789999999
Q gi|254780669|r  111 KKKYGFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVK--K---GQFLSPWEMHN  176 (301)
Q Consensus       111 k~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iK--k---gq~~s~~e~~~  176 (301)
                      ....++-.|-|..|.+..+.+.+. -++++-+             .-.+.|++|=  |   +..++++|+..
T Consensus        85 ~~~~~iIfVVDssD~~r~~eak~~L~~lL~~~-------------~l~~~PlLIlaNK~Dl~~a~~~~ei~~  143 (190)
T cd00879          85 PEVDGIVFLVDAADPERFQESKEELDSLLSDE-------------ELANVPFLILGNKIDLPGAVSEEELRQ  143 (190)
T ss_pred             HCCCEEEEEEECCCHHHHHHHHHHHHHHHHHH-------------HHCCCCEEEEEECCCCCCCCCHHHHHH
T ss_conf             31137999997767789999999999998555-------------006980899986667767989999998


No 424
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm). Glutamate mutase catalysis the conversion of (S)-glutamate with (2S,3S)-3-methylaspartate. The rearrangement reaction is initiated by the extraction of a hydrogen from the protein-bound substrate by a 5'-desoxyadenosyl radical, which is generated by the homolytic cleavage of the organometallic bond of the cofactor B12. Glm is a heterotetrameric molecule consisting of two alpha and two epsilon polypeptide chains.
Probab=22.51  E-value=60  Score=13.98  Aligned_cols=91  Identities=13%  Similarity=0.195  Sum_probs=53.8

Q ss_pred             CCHHHHHHHHHHHHHHCCEEEE---ECCCHHHHHHHH-HHCCEEEECHHHCCC-------HHHHHHHHHCCCEEEEECCC
Q ss_conf             7124888999886652876885---228899998765-021578822576289-------99999985059779983677
Q gi|254780669|r   99 GLKKGREIFRDLKKKYGFPILT---DVHTEQQCEAIA-DSVDILQIPALLCRQ-------TDLLTAAAQTGRVINVKKGQ  167 (301)
Q Consensus        99 Gle~gL~il~e~k~~~glpv~T---eV~~~~~~e~~~-~~vDilQIgA~~~rq-------tdLl~a~a~t~kpV~iKkgq  167 (301)
                      |-+.|.++++.+-++.|+.|+.   .+.-.+-++.+. +-+|++=+-+-+-..       .++|++.+..+.+|.+==+.
T Consensus        11 ~Hd~G~~iva~~l~~~GfeVi~lG~~~~~e~~~~~a~e~~ad~i~vSsl~g~~~~~~~~l~~~L~e~G~~di~vvvGG~i   90 (128)
T cd02072          11 CHAVGNKILDHAFTEAGFNVVNLGVLSPQEEFIDAAIETDADAILVSSLYGHGEIDCKGLREKCDEAGLKDILLYVGGNL   90 (128)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCC
T ss_conf             53788999999999789729847988999999999987399999982320256248999999999679999989978986


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             7899999999999972587808
Q gi|254780669|r  168 FLSPWEMHNILQKLHAHGAKDV  189 (301)
Q Consensus       168 ~~s~~e~~~a~eki~~~Gn~~i  189 (301)
                      -...++|.....++.+.|-..+
T Consensus        91 ~i~~~d~~~~~~~l~~~Gv~~v  112 (128)
T cd02072          91 VVGKQDFEDVEKRFKEMGFDRV  112 (128)
T ss_pred             CCCCCCHHHHHHHHHHCCCCEE
T ss_conf             7783104899999996696857


No 425
>TIGR00097 HMP-P_kinase phosphomethylpyrimidine kinase; InterPro: IPR004399 Phosphomethylpyrimidine kinase (2.7.4.7 from EC), also known as HMP-phosphate kinase, catalyses the phosphorylation of HMP-P to HMP-PP in the reaction: ATP + 4-amino-2-methyl-5-phosphomethylpyrimidine = ADP + 4-amino-2-methyl-5-diphosphomethylpyrimidine during the biosynthesis of thiamine.; GO: 0008972 phosphomethylpyrimidine kinase activity, 0009228 thiamin biosynthetic process.
Probab=22.50  E-value=60  Score=13.98  Aligned_cols=30  Identities=20%  Similarity=0.455  Sum_probs=17.6

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCEEEEECC
Q ss_conf             2224567124888999886652876885228
Q gi|254780669|r   93 AGKRGVGLKKGREIFRDLKKKYGFPILTDVH  123 (301)
Q Consensus        93 ~sfrG~Gle~gL~il~e~k~~~glpv~TeV~  123 (301)
                      +|=-|-|+.-=||-|+.. .-||+-|+|=|.
T Consensus         8 DSGGGAGIQADLKTF~A~-~vfG~svITalT   37 (264)
T TIGR00097         8 DSGGGAGIQADLKTFSAL-GVFGTSVITALT   37 (264)
T ss_pred             CCCCHHHHHHHHHHHHHC-CCCEEEEEEEEE
T ss_conf             887226688889999765-830317999975


No 426
>PRK00125 pyrF orotidine 5'-phosphate decarboxylase; Reviewed
Probab=22.42  E-value=60  Score=13.97  Aligned_cols=122  Identities=12%  Similarity=0.193  Sum_probs=69.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH---HHCCEEEEECC-----CHH
Q ss_conf             9999999999999996553399706601557688666322245671248889998866---52876885228-----899
Q gi|254780669|r   55 ESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKK---KYGFPILTDVH-----TEQ  126 (301)
Q Consensus        55 ES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~---~~glpv~TeV~-----~~~  126 (301)
                      .+.+.+++.++.+.+...  ....+|||      -..+  |.-.|. +|+..|+++-+   +-|++|+-|.-     .+.
T Consensus        33 ~~~~~l~~F~~~iIdat~--~~v~a~Kp------q~Af--fE~~G~-~G~~~Le~~i~~~~~~~~~vI~DaKRGDIGsT~  101 (277)
T PRK00125         33 GDADGIFEFCRIIVDATA--DLVAAFKP------QIAY--FEAHGA-EGLAQLERTIAYLREAGVLVIADAKRGDIGSTA  101 (277)
T ss_pred             CCHHHHHHHHHHHHHHHH--CCCEEECC------CHHH--HHHHCH-HHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHH
T ss_conf             758999999999999740--60358627------7899--998285-149999999999987698499963434727799


Q ss_pred             HH--HHHHH--H-CCEEEECHHHCCCH--HHHHHHHHCCC--EEEEECC-------CCCCH----HHHHHHHHHHHHCCC
Q ss_conf             99--87650--2-15788225762899--99999850597--7998367-------77899----999999999972587
Q gi|254780669|r  127 QC--EAIAD--S-VDILQIPALLCRQT--DLLTAAAQTGR--VINVKKG-------QFLSP----WEMHNILQKLHAHGA  186 (301)
Q Consensus       127 ~~--e~~~~--~-vDilQIgA~~~rqt--dLl~a~a~t~k--pV~iKkg-------q~~s~----~e~~~a~eki~~~Gn  186 (301)
                      ..  +...+  . +|-+-+-.++=..+  ..++.+.+.+|  -|+.|-.       |.+..    .-+..+++.+...++
T Consensus       102 ~aYA~a~f~~~~~aDAvTvnPYmG~dsl~Pfl~~a~~~~kgvFvL~~TSNpgs~d~Q~~~~~~g~~ly~~va~~~~~~~~  181 (277)
T PRK00125        102 EAYAKAWFESPLEADAVTVSPYMGFDSLEPYLEYAEEHGKGVFVLCRTSNPGGSDLQFLDTADGRPLYQHVADLAADLNN  181 (277)
T ss_pred             HHHHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHCCCCCCHHHHHHHHHHHHCC
T ss_conf             99999985385778868964766833008999999855985999982699877877630257996799999999998625


Q ss_pred             C
Q ss_conf             8
Q gi|254780669|r  187 K  187 (301)
Q Consensus       187 ~  187 (301)
                      .
T Consensus       182 ~  182 (277)
T PRK00125        182 A  182 (277)
T ss_pred             C
T ss_conf             6


No 427
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated
Probab=22.36  E-value=60  Score=13.96  Aligned_cols=68  Identities=21%  Similarity=0.226  Sum_probs=35.2

Q ss_pred             HHHHHHHHHHHHCCEEEE-ECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHH-CCCEEEEECCCCCCH
Q ss_conf             888999886652876885-22889999876-502157882-----2576289999999850-597799836777899
Q gi|254780669|r  103 GREIFRDLKKKYGFPILT-DVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQ-TGRVINVKKGQFLSP  171 (301)
Q Consensus       103 gL~il~e~k~~~glpv~T-eV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~-t~kpV~iKkgq~~s~  171 (301)
                      ...++.+.-.++|+.|.- |..+++.++.. .+...++++     |.+-+..-.-+.++++ .|.++.+-+ -|+||
T Consensus       116 T~~l~~~~l~~~Gi~v~~vD~~d~~~~~~~i~~~Tkli~~EsPsNP~l~v~Di~~ia~iA~~~g~~~vVDN-TfatP  191 (431)
T PRK08248        116 TYNLFAHTLPKLGITVKFVDPSDPENFEAAITDKTKALFAETIGNPKGDVLDIEAVADIAHRHHIPLIVDN-TFASP  191 (431)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEEC-CCCCH
T ss_conf             89998742323887999989977577997537774599960489998742278999999977698599866-75303


No 428
>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2.1.1 from EC methylates the 23S rRNA. It specifically methylates the uridine in position 2552 of 23s rRNA in the 50S particle using S-adenosyl-L-methionine as a substrate. It was previously known as cell division protein ftsJ.; GO: 0016436 rRNA (uridine) methyltransferase activity, 0006364 rRNA processing.
Probab=22.35  E-value=60  Score=13.96  Aligned_cols=70  Identities=19%  Similarity=0.198  Sum_probs=41.3

Q ss_pred             CCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHH-CCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             727976997069995486349999999999999996553-3997066015576886663222456712488899988665
Q gi|254780669|r   35 NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQS-LNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKK  113 (301)
Q Consensus        35 ~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~-~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~  113 (301)
                      -+|-++.-.|  =|+|--+|.-.= .+..++..-++|.+ |...|=|=.          .-|||.+++   +++.|+|..
T Consensus       103 ~DVV~SDaaP--~~SG~~~iDh~R-s~dLv~~aL~ia~~vL~~~Gnfvv----------KvFqGe~~d---~y~~e~r~~  166 (192)
T TIGR00438       103 VDVVMSDAAP--NISGIWDIDHLR-SIDLVELALDIAKEVLKPKGNFVV----------KVFQGEEID---EYLNELRKL  166 (192)
T ss_pred             EEEEEECCCC--CCCCCCCCCHHH-HHHHHHHHHHHHHHHHHCCCCEEE----------EEEECCCHH---HHHHHHHHC
T ss_conf             7789852688--878987543443-799999999999998615898999----------985374288---999976520


Q ss_pred             HCCEEEE
Q ss_conf             2876885
Q gi|254780669|r  114 YGFPILT  120 (301)
Q Consensus       114 ~glpv~T  120 (301)
                      |..-=+|
T Consensus       167 F~~~k~~  173 (192)
T TIGR00438       167 FEKVKVT  173 (192)
T ss_pred             CCEEEEE
T ss_conf             5476744


No 429
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=22.29  E-value=60  Score=13.95  Aligned_cols=89  Identities=19%  Similarity=0.239  Sum_probs=52.6

Q ss_pred             HHHHHHHHH-CCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             999886652-87688522889999876502-1578822576289999999850597799836777899999999999972
Q gi|254780669|r  106 IFRDLKKKY-GFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHA  183 (301)
Q Consensus       106 il~e~k~~~-glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~  183 (301)
                      .++++|+.. ..+|..||.+.+|+..+.+. +|++|.-                       |   +||+++.-+++.+..
T Consensus       173 av~~~r~~~~~~~IeVEv~~lee~~~a~~~g~d~I~LD-----------------------n---~s~e~~~~~v~~l~~  226 (279)
T PRK08385        173 AIRRAKEFSVYKVVEVEVESLEDALKAAKAGADIIMLD-----------------------N---MTPEEIREVIEALKE  226 (279)
T ss_pred             HHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEEEEC-----------------------C---CCHHHHHHHHHHHHH
T ss_conf             99999984899618997098999999997699999984-----------------------9---999999999999875


Q ss_pred             CCC-CCEEEEECCCCCCCHHHCCCCCCCHHHHHHCC--CEEECHHHHH
Q ss_conf             587-80899514654440100000001068885187--1687117774
Q gi|254780669|r  184 HGA-KDVLFCERGTSFGYNTLVTDMRSIPIMTSMGV--PVIFDASHSV  228 (301)
Q Consensus       184 ~Gn-~~i~lcERG~~fgy~~lvvD~~~i~~lk~~~~--PVi~D~SHs~  228 (301)
                      .|. .++.+-=-|-        +++.++....+++.  =.+-.+|||.
T Consensus       227 ~~~~~~v~ieaSGG--------I~~~ni~~ya~tGVD~IS~g~lt~s~  266 (279)
T PRK08385        227 LGLREKVKIEVSGG--------ITPETIAEYAKLDVDVISLGALTHSV  266 (279)
T ss_pred             HCCCCCEEEEEECC--------CCHHHHHHHHHCCCCEEECCHHHCCC
T ss_conf             07689789999789--------98999999985598999849777699


No 430
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed
Probab=22.27  E-value=60  Score=13.95  Aligned_cols=103  Identities=18%  Similarity=0.186  Sum_probs=58.4

Q ss_pred             HHHHHHHH---CCCEEEEEC------CCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHH------HCCCCCCCHHH
Q ss_conf             99999850---597799836------7778999999999999725878089951465444010------00000010688
Q gi|254780669|r  149 DLLTAAAQ---TGRVINVKK------GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT------LVTDMRSIPIM  213 (301)
Q Consensus       149 dLl~a~a~---t~kpV~iKk------gq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~------lvvD~~~i~~l  213 (301)
                      +.++++-+   .++|+.+.=      .-..+++|....+..++..|. +++=|--|-......      ..+.|. --+-
T Consensus       611 EV~~aVR~~~p~~~Pl~vRiSatDw~~gG~t~edsv~la~~l~~~Gv-D~IdvSsGg~~~~~~p~~g~~yQvpfA-~~Ir  688 (770)
T PRK08255        611 EVFRAVRAVWPADKPMSVRISAHDWVEGGNTPDDAVEIARAFKAAGA-DMIDVSSGQVSKDEKPVYGRMYQTPFA-DRIR  688 (770)
T ss_pred             HHHHHHHHHCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCC-CEEEECCCCCCCCCCCCCCCCCCHHHH-HHHH
T ss_conf             99999998678988669998510256899999999999999997499-899957888886677888876566999-9999


Q ss_pred             HHHCCCEE-----ECHHHHHHHCCCCCCCCCCCHHHH--------H--HHHHHHHHHCCCE
Q ss_conf             85187168-----711777421223453212638899--------9--9999999718988
Q gi|254780669|r  214 TSMGVPVI-----FDASHSVQQPGIHGNCSGGERQYI--------V--PLAKAAVAIGIAG  259 (301)
Q Consensus       214 k~~~~PVi-----~D~SHs~q~p~~~~~~~gG~r~~v--------~--~la~aa~a~G~dG  259 (301)
                      ++.+.|++     .||-|+-..-      ..|+.++|        -  ...+||..+|+++
T Consensus       689 ~e~~i~t~AVG~I~~p~~Ae~Il------~~GrADlValgR~~L~dP~W~l~aA~~lg~~~  743 (770)
T PRK08255        689 NEAGIATIAVGAISEADHVNSII------AAGRADLCALARPHLADPAWTLHEAARIGYRD  743 (770)
T ss_pred             HHCCCCEEEECCCCCHHHHHHHH------HCCCCCEEEECHHHHCCCCHHHHHHHHCCCCC
T ss_conf             87599789961889999999999------76998875247776519950999999759988


No 431
>PRK05939 hypothetical protein; Provisional
Probab=22.25  E-value=61  Score=13.95  Aligned_cols=14  Identities=21%  Similarity=0.499  Sum_probs=7.6

Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             68899999999999
Q gi|254780669|r  279 INIKDLPKLLSQLL  292 (301)
Q Consensus       279 l~l~~l~~ll~~l~  292 (301)
                      +-+++.++|+.+|.
T Consensus       377 vGlEd~~DLi~DL~  390 (396)
T PRK05939        377 VGIEDTADLIADFE  390 (396)
T ss_pred             EEECCHHHHHHHHH
T ss_conf             41099999999999


No 432
>PRK04311 selenocysteine synthase; Provisional
Probab=22.16  E-value=61  Score=13.94  Aligned_cols=58  Identities=24%  Similarity=0.328  Sum_probs=36.3

Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEC--------------CCHHHHHHHHHHCCEE
Q ss_conf             997066015576886663222456712488899988665287688522--------------8899998765021578
Q gi|254780669|r   75 NIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDV--------------HTEQQCEAIADSVDIL  138 (301)
Q Consensus        75 ~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV--------------~~~~~~e~~~~~vDil  138 (301)
                      .-+.++|-      .+|-|.-.|---+-.++-|.++.+++++|++-|.              ++|.--+.++..+|++
T Consensus       218 ~Ta~llkv------H~SN~~i~GFt~~v~~~eL~~l~~~~~ip~~~DlGSG~l~~~~~~gl~~Ep~v~~~l~~GaDLV  289 (465)
T PRK04311        218 NTALLLKV------HTSNYRIVGFTKEVSEAELAALGKEHGLPVVVDLGSGSLVDLSQYGLPDEPTVQELLAAGVDLV  289 (465)
T ss_pred             CCEEEEEE------ECCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCEE
T ss_conf             65489999------5687654674688999999999987599279988875213653126999998899997299889


No 433
>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated
Probab=21.98  E-value=35  Score=15.49  Aligned_cols=91  Identities=18%  Similarity=0.185  Sum_probs=58.2

Q ss_pred             CHHHHHHHHHHHHH-----------HCCEEEEECCCHHHHHHH-HHHCCEEEECHHHCCCHHH---HHHHHH----CCCE
Q ss_conf             12488899988665-----------287688522889999876-5021578822576289999---999850----5977
Q gi|254780669|r  100 LKKGREIFRDLKKK-----------YGFPILTDVHTEQQCEAI-ADSVDILQIPALLCRQTDL---LTAAAQ----TGRV  160 (301)
Q Consensus       100 le~gL~il~e~k~~-----------~glpv~TeV~~~~~~e~~-~~~vDilQIgA~~~rqtdL---l~a~a~----t~kp  160 (301)
                      ++++|++.++-=.+           --+-.-+-.++.-.++.+ .|+.|+.||-||++--.|-   |.++|-    ..||
T Consensus       159 l~~~l~Y~E~qit~lLaa~HtGqEgs~~DfESKAlHaGmlD~l~~EiaDiaQi~a~~~Pk~d~daPLvEiGmGtiD~~KP  238 (779)
T PRK00941        159 LEKALEYVEEQITQLLAATHTGQEGSYLDFESKALHAGMLDHVGMEIADIAQIVAYDFPKGDPDAPLVELGMGTIDKSKP  238 (779)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEECCCCCCCCCC
T ss_conf             99999999999999999985377555334277776521577889999999988741788889998741203675477886


Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCC-CEEEE
Q ss_conf             998367778999999999999725878-08995
Q gi|254780669|r  161 INVKKGQFLSPWEMHNILQKLHAHGAK-DVLFC  192 (301)
Q Consensus       161 V~iKkgq~~s~~e~~~a~eki~~~Gn~-~i~lc  192 (301)
                      |.+-=|-...|-  ..+.+|+...|-. +|=+|
T Consensus       239 vIl~iGHNv~p~--~~i~dY~ee~~L~d~vEi~  269 (779)
T PRK00941        239 VILVIGHNVAPG--TEIIDYLEENGLTDKVEVA  269 (779)
T ss_pred             EEEEECCCCCHH--HHHHHHHHHCCCHHHEEEE
T ss_conf             799973775327--8999999876842432674


No 434
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional
Probab=21.83  E-value=60  Score=13.95  Aligned_cols=26  Identities=31%  Similarity=0.660  Sum_probs=20.4

Q ss_pred             CCHHHHHHHHHHHHHHCCEEEEECCCH
Q ss_conf             712488899988665287688522889
Q gi|254780669|r   99 GLKKGREIFRDLKKKYGFPILTDVHTE  125 (301)
Q Consensus        99 Gle~gL~il~e~k~~~glpv~TeV~~~  125 (301)
                      |..+++.+++.+ ++|++||+|=|-.|
T Consensus       139 GYRKAlRlm~lA-ekf~~Pvit~IDTp  164 (322)
T CHL00198        139 GYRKALRLMEHA-NRFGLPILTFIDTP  164 (322)
T ss_pred             HHHHHHHHHHHH-HHCCCCEEEEECCC
T ss_conf             999999999999-97099779983289


No 435
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated
Probab=21.72  E-value=62  Score=13.88  Aligned_cols=63  Identities=16%  Similarity=0.132  Sum_probs=36.2

Q ss_pred             HHHHHHHHHHHHCCEEE-EECCCHHHHHHH-HHHCCEEEE-----CHHHCCCHHHHHHHHHC-CCEEEEEC
Q ss_conf             88899988665287688-522889999876-502157882-----25762899999998505-97799836
Q gi|254780669|r  103 GREIFRDLKKKYGFPIL-TDVHTEQQCEAI-ADSVDILQI-----PALLCRQTDLLTAAAQT-GRVINVKK  165 (301)
Q Consensus       103 gL~il~e~k~~~glpv~-TeV~~~~~~e~~-~~~vDilQI-----gA~~~rqtdLl~a~a~t-~kpV~iKk  165 (301)
                      ...++.+.-.++|+.+. .|..+.+.++.. .+...++++     |..-+.+-+-+.++++. +.++.+-+
T Consensus       110 t~~l~~~~l~~~gi~~~fvd~~d~~~~~~~i~~~Tklv~~EsP~NPtl~v~DI~~i~~iA~~~g~~~vVDN  180 (424)
T PRK06084        110 TYNLLAHTLPRIGIQTRFAAHDDIAALEALIDERTKAVFCESIGNPAGNIVDLQALADAAHRHGVPLIVDN  180 (424)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCHHHHHHHCCCCCEEEEEECCCCCCCEECCHHHHHHHHHHCCCEEEEEC
T ss_conf             89999998874686159958867799997548765189984389998650378999999987499599545


No 436
>pfam01244 Peptidase_M19 Membrane dipeptidase (Peptidase family M19).
Probab=21.63  E-value=62  Score=13.87  Aligned_cols=228  Identities=17%  Similarity=0.226  Sum_probs=102.2

Q ss_pred             EEEEECCCCCC---CHHHHHHHHHHHHHHHHHCC--CCEEEECC-CC---CCCC-CCCCCCCCC-CCHHHHHHHHHHHHH
Q ss_conf             69995486349---99999999999999655339--97066015-57---6886-663222456-712488899988665
Q gi|254780669|r   45 FVLIAGPCQIE---SHDHAFMIAEKLYAICQSLN--IGLVYKSS-FD---KANR-SSLAGKRGV-GLKKGREIFRDLKKK  113 (301)
Q Consensus        45 l~iIAGPCsiE---S~e~~~~~A~~lk~~~~~~~--~~~ifK~s-fd---KanR-tS~~sfrG~-Gle~gL~il~e~k~~  113 (301)
                      ++-|--||...   +.+.+++....+++......  +..+..+. ..   +.+| ..+-+++|. .++.-+..|+... +
T Consensus        49 ~fai~v~~~~~~~~~~~~al~~id~~~~~~~~~~~~~~~~~s~~di~~a~~~gk~a~~l~~Eg~~~l~~dl~~l~~~y-~  127 (316)
T pfam01244        49 FFAIFVPCDAQYEDAVQATLEQIDIFRRLVRKNPEQLRLVRTADDIERAKKEGKIAILLGIEGAHALGDDLALLRTFY-A  127 (316)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHCCCEEEEEEEECHHHHHCCHHHHHHHH-H
T ss_conf             999995787775089999999999999999969896899699999999997799899995207677645099999999-6


Q ss_pred             HCCEEEEECCCHHHHHHHHHHC-CE-EEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             2876885228899998765021-57-882257628999999985059779983677789999999999997258780899
Q gi|254780669|r  114 YGFPILTDVHTEQQCEAIADSV-DI-LQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLF  191 (301)
Q Consensus       114 ~glpv~TeV~~~~~~e~~~~~v-Di-lQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~l  191 (301)
                      .|+..+|=.|...  ..+++.+ +- .+-| ..-.--+++++.-+.|-.|-+--   +|..-+.-+++..    ..-|++
T Consensus       128 ~GvR~~~Lt~n~~--N~~a~g~~~~~~~~G-Lt~~G~~~v~~mn~lGmivDlSH---~s~~~~~d~~~~s----~~Pvia  197 (316)
T pfam01244       128 LGVRYLGLTWNCN--NLFADGCLERKRDGG-LTRFGKEVVREMNRLGILIDLSH---LSERTFWDVLELS----KAPVVA  197 (316)
T ss_pred             CCCEEEEEECCCC--CCCCCCCCCCCCCCC-CCHHHHHHHHHHHHCCCEEECCC---CCHHHHHHHHHHC----CCCEEE
T ss_conf             1937998523788--8