HHsearch alignment for GI: 254780669 and conserved domain: pfam04481

>pfam04481 DUF561 Protein of unknown function (DUF561). Protein of unknown function found in a cyanobacterium, and the chloroplasts of algae.
Probab=92.99  E-value=0.88  Score=26.03  Aligned_cols=200  Identities=21%  Similarity=0.298  Sum_probs=123.6

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCC
Q ss_conf             69995486349999999999999996553399706601557688666322245671248889998866528768852288
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHT  124 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~  124 (301)
T Consensus        15 lKVIsGL~NFd-~~~V~~i~~AA~~ggAt---------------------~vDIA--~dp~LV~~v~~~~~lPiCVSaVe   70 (243)
T pfam04481        15 IKVISGLNNFN-YEQVLKIARASQIAKAT---------------------YVDIA--ADPQLVKVVKSVSNIPICVSAVE   70 (243)
T ss_pred             HHHHCCCCCCC-HHHHHHHHHHHHCCCCC---------------------EEEEC--CCHHHHHHHHHHCCCCEEEECCC
T ss_conf             77640723269-89999999998715997---------------------68741--79999999997289985860479


Q ss_pred             HHHH-HHHHHHCCEEEECHHHCCC-----H---HHHHHHHHC-----CCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             9999-8765021578822576289-----9---999998505-----977998367778999999999999725878089
Q gi|254780669|r  125 EQQC-EAIADSVDILQIPALLCRQ-----T---DLLTAAAQT-----GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVL  190 (301)
Q Consensus       125 ~~~~-e~~~~~vDilQIgA~~~rq-----t---dLl~a~a~t-----~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~  190 (301)
T Consensus        71 p~~f~~aV~AGA~lvEIGNfDsFY~qGr~f~a~eVL~Lt~~Tr~LLP~~~LsVTVPHiL~ld~Qv~LA~~L~~~Ga-DiI  149 (243)
T pfam04481        71 PELLYEAVLAGADLVEIGNFDSFYKQGRVLSVCEIIALVKETRKLLPHTPLCVTIPHILKLKEQINLAKQLESLGI-DLI  149 (243)
T ss_pred             HHHHHHHHHHCCCEEEECCHHHHHHCCCEECHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHCC-CEE
T ss_conf             7888999982787898645364765476644999999999999768998447745763567899999999998188-778


Q ss_pred             EEECCC-CCCCHHHCCCC--CCCHHH-------HHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEE
Q ss_conf             951465-44401000000--010688-------85187168711777421223453212638899999999997189889
Q gi|254780669|r  191 FCERGT-SFGYNTLVTDM--RSIPIM-------TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI  260 (301)
Q Consensus       191 lcERG~-~fgy~~lvvD~--~~i~~l-------k~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGl  260 (301)
T Consensus       150 QTEGgtss~p~~~g~~glIekaapTLAaay~IS~~v~vPVlcA---------------SGlS~vT~Pm---AiaaGAsGV  211 (243)
T pfam04481       150 QTEGKITSISKNHCVNDLIEKSASTLASTYEISKHVQLPVICA---------------SGLSDVTVPL---AFSYGASGI  211 (243)
T ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEC---------------CCCCHHHHHH---HHHCCCCCC
T ss_conf             7289877788884257779887588999999986178766754---------------6764214788---997487710


Q ss_pred             EEEECCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             998369833479782018688999999999999999885
Q gi|254780669|r  261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK  299 (301)
Q Consensus       261 fiE~Hp~P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~vk  299 (301)
T Consensus       212 GVGS------------avn~Lnd~~aMva~vr~l~~al~  238 (243)
T pfam04481       212 GIGS------------AVSKLNDIEKMVNYISEIKKAIS  238 (243)
T ss_pred             CHHH------------HHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             0657------------76500249999999999999973