HHsearch alignment for GI: 254780669 and conserved domain: pfam09370

>pfam09370 TIM-br_sig_trns TIM-barrel signal transduction protein. This domain is likely to have a TIM barrel fold related to IGPS. Although this family of proteins are functionally uncharacterized this domain is found as an N-terminal domain of sigma 54 -dependent transcriptional activators (enhancer-binding proteins) suggesting a potential role in signal recognition/receiving and signal transduction.
Probab=94.60  E-value=0.29  Score=29.18  Aligned_cols=136  Identities=18%  Similarity=0.255  Sum_probs=84.7

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCC
Q ss_conf             69995486349999999999999996553399706601557688666322245671248889998866528768852288
Q gi|254780669|r   45 FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHT  124 (301)
Q Consensus        45 l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~  124 (301)
T Consensus        82 tPViaGv~~tDP~~~~~~~L~~l~~~GfsGV~NfPTvglidG~fR~~L-EetGmgy~~EVEmIr~A~~-~dl~T~~yvf~  159 (268)
T pfam09370        82 TPVLAGVCGTDPFRDMDRFLDELKEMGFAGVQNFPTVGLIDGEFRQNL-EETGMGYDLEVEMIRLAHE-KGLLTTPYVFN  159 (268)
T ss_pred             CCEEEECCCCCCCCCHHHHHHHHHHHCCCCEEECCCEEEECCHHHHHH-HHCCCCHHHHHHHHHHHHH-CCCCCCCEECC
T ss_conf             875876158897452999999999719774443882203351888778-8808867999999999997-79833313268


Q ss_pred             HHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHC-CCEEEEECCCCCCHHHHHHHHHHHHHC---CCCC-EEEEECCC
Q ss_conf             9999876502-15788225762899999998505-977998367778999999999999725---8780-89951465
Q gi|254780669|r  125 EQQCEAIADS-VDILQIPALLCRQTDLLTAAAQT-GRVINVKKGQFLSPWEMHNILQKLHAH---GAKD-VLFCERGT  196 (301)
Q Consensus       125 ~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t-~kpV~iKkgq~~s~~e~~~a~eki~~~---Gn~~-i~lcERG~  196 (301)
T Consensus       160 ~e~a~~Ma~AGaDiIv~H~------------GlT~gG~iG~~~a--~sl~~a~~~~~~i~~aa~~v~~diIvLchGGp  223 (268)
T pfam09370       160 VEEARAMAEAGADIIVAHM------------GLTTGGTIGADTA--LSLDDCVELINAIARAARSVNPDVIVLCHGGP  223 (268)
T ss_pred             HHHHHHHHHCCCCEEEECC------------CCCCCCCCCCCCC--CCHHHHHHHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             9999999974998999767------------7677767467776--78999999999999999985998699951788