HHsearch results for GI: 254780669 and protein with PDBid: 1tx2_A

>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, manic, transferase; HET: 680; 1.83A {Bacillus anthracis str} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A*
Probab=95.64  E-value=0.14  Score=29.91  Aligned_cols=203  Identities=14%  Similarity=0.181  Sum_probs=128.2

Q ss_pred             CHHHHHHHHHHHHHHHHHCC-CCEE-EECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHH
Q ss_conf             99999999999999655339-9706-601557688666322245671248889998866528768852288999987650
Q gi|254780669|r   56 SHDHAFMIAEKLYAICQSLN-IGLV-YKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIAD  133 (301)
Q Consensus        56 S~e~~~~~A~~lk~~~~~~~-~~~i-fK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~  133 (301)
                      +.|.+++-|+.+.+-|++.. +|+. -+|   .|.+-   |... -++.-+.+++.+++..++++--|-..++-++.+.+
T Consensus        61 ~~~~a~~~a~~mi~~GAdIIDIGaeSTrP---ga~~i---s~ee-E~~Rl~pvi~~l~~~~~i~iSIDT~~~~Va~~al~  133 (297)
T 1tx2_A           61 EVDAAVRHAKEMRDEGAHIIDIGGESTRP---GFAKV---SVEE-EIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIE  133 (297)
T ss_dssp             HHHHHHHHHHHHHHTTCSEEEEESCC-------CCCC---CHHH-HHHHHHHHHHHHHHHSCSCEEEECSCHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCEECCC---CCEEC---CHHH-HHHHHCHHHHHHHHCCCEEEEEECCCHHHHHHHHH
T ss_conf             99999999999998799599989756799---98206---8588-87762567898852676489884885999999997


Q ss_pred             -HCCEE-EECHHHCCCHHHHHHHHHCCCEEEEECCC----CCCH-----HHHHHHHHHHHHCCCC-CEEEEECCCCCCCH
Q ss_conf             -21578-82257628999999985059779983677----7899-----9999999999725878-08995146544401
Q gi|254780669|r  134 -SVDIL-QIPALLCRQTDLLTAAAQTGRVINVKKGQ----FLSP-----WEMHNILQKLHAHGAK-DVLFCERGTSFGYN  201 (301)
Q Consensus       134 -~vDil-QIgA~~~rqtdLl~a~a~t~kpV~iKkgq----~~s~-----~e~~~a~eki~~~Gn~-~i~lcERG~~fgy~  201 (301)
                       .+||+ -|-+++ ..-.++..+++.+.++.+-.-+    ....     .++..-++...+.|.+ +-|+..=|+-||-+
T Consensus       134 ~Ga~iINDVsg~~-~d~~m~~~~~~~~~~~vlmH~~~~~~~~~~~~~v~~~~~~~i~~~~~~GI~~~~IiiDPGiGFgK~  212 (297)
T 1tx2_A          134 AGAHIINDIWGAK-AEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKT  212 (297)
T ss_dssp             HTCCEEEETTTTS-SCTHHHHHHHHHTCCEEEECCCSCCCCSSHHHHHHHHHHHHHHHHHHTTCCGGGEEEECCTTSSCC
T ss_pred             CCCEEEECCCCCC-CCHHHHHHHHHCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHEEECCCCCCCCC
T ss_conf             5962997474333-572789998633788233257777764433105689999999999986988899877665677745


Q ss_pred             ---HHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHH
Q ss_conf             ---00000001068885187168711777421223453212638899999999997189889998369833
Q gi|254780669|r  202 ---TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD  269 (301)
Q Consensus       202 ---~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~  269 (301)
                         |+ .=++++..++++++||.+=+|.--....-.+..+..+..--..++-.|+..|++  ++-||.-++
T Consensus       213 ~~~n~-~ll~~l~~~~~lg~PiLvGvSRKsfi~~~~~~~~~~Rl~~Tla~~~~a~~~Ga~--IiRvHDV~e  280 (297)
T 1tx2_A          213 PEQNL-EAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCE--FVRVHDVKE  280 (297)
T ss_dssp             HHHHH-HHHHTGGGGGGGCSCBEEECTTCHHHHHHHTCCGGGCHHHHHHHHHHHHHTTCS--EEEESCHHH
T ss_pred             CCCCH-HHHHHHHHHHCCCCCEEEECCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCC--EEEECCHHH
T ss_conf             10247-898777654105776375124888898874899788437999999999987998--999698899