HHsearch results for GI: 254780669 and protein with PDBid: 1vli_A

>1vli_A Spore coat polysaccharide biosynthesis protein SPSE; 2636322, structural genomics, JCSG, protein structure initiative, BSU37870, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6
Probab=99.53  E-value=8.8e-11  Score=90.37  Aligned_cols=252  Identities=15%  Similarity=0.193  Sum_probs=181.6

Q ss_pred             ECCCEEEECCCCCCEEECCCCCEEEEE--CCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC---------CCCCCC--
Q ss_conf             317706835787727976997069995--48634999999999999999655339-9706601---------557688--
Q gi|254780669|r   23 HTNAAIHLGSGKNQVTFSNEQRFVLIA--GPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS---------SFDKAN--   88 (301)
Q Consensus        23 ~~~~~~~ig~~~~~i~ig~~~~l~iIA--GPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~---------sfdKan--   88 (301)
                      +....++|    ++..||.+.|.+|||  |-+=-=+.+.+.++.+..++.|++.. .. .|++         .+++.+  
T Consensus        11 ~~m~~~~i----~~~~ig~~~~~~IIAEIG~NH~Gd~~~ak~lI~~A~~sGaDaVKFQ-~~~~d~l~~~~~~~~~~~~~~   85 (385)
T 1vli_A           11 HHMAAFQI----ANKTVGKDAPVFIIAEAGINHDGKLDQAFALIDAAAEAGADAVKFQ-MFQADRMYQKDPGLYKTAAGK   85 (385)
T ss_dssp             ---CEEEE----TTEEEETTSCCEEEEEEETTTTTCHHHHHHHHHHHHHHTCSEEEEC-CBCGGGGTSCCC---------
T ss_pred             CCCCEEEE----CCEEECCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CCCHHHEECCCHHHCCCCCCC
T ss_conf             23441898----9999489998389998157768809999999999998195999950-506776078764434567888


Q ss_pred             -CCCCCCCC--CCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEE
Q ss_conf             -66632224--56712488899988665287688522889999876502-157882257628999999985059779983
Q gi|254780669|r   89 -RSSLAGKR--GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVK  164 (301)
Q Consensus        89 -RtS~~sfr--G~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iK  164 (301)
                       .+-..-|+  .+.. +-...|.+..++.|+...+.+-+..-++.+.+. +|.+-|+++.+.|.+||++++++++||.+-
T Consensus        86 ~~~~~~~~kk~els~-~~~~~l~~~~k~~~i~~~~s~fd~~s~~~l~~l~~~~~KIaS~di~n~~Ll~~i~~~~kpiiiS  164 (385)
T 1vli_A           86 DVSIFSLVQSMEMPA-EWILPLLDYCREKQVIFLSTVCDEGSADLLQSTSPSAFKIASYEINHLPLLKYVARLNRPMIFS  164 (385)
T ss_dssp             CCCHHHHGGGBSSCG-GGHHHHHHHHHHTTCEEECBCCSHHHHHHHHTTCCSCEEECGGGTTCHHHHHHHHTTCSCEEEE
T ss_pred             CCCHHHHHHHHHHHH-HHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHCCCEEEE
T ss_conf             863999998365528-9999999999984987998537278887887609631675265546579999999709977993


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHCCCCCCCHHHHH-HC-CCEEECHHHHHHHCCCCCCCCCCCH
Q ss_conf             677789999999999997258780899514654440100000001068885-18-7168711777421223453212638
Q gi|254780669|r  165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS-MG-VPVIFDASHSVQQPGIHGNCSGGER  242 (301)
Q Consensus       165 kgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lvvD~~~i~~lk~-~~-~PVi~D~SHs~q~p~~~~~~~gG~r  242 (301)
                      -|. .+.+|...+++.+...++.+++|.+==+++....--..++.+..+|+ +. .|| -=..|+.          +|. 
T Consensus       165 tG~-~~~~eI~~~~~~i~~~~~~~i~llhC~s~YPt~~~~~nL~~i~~lk~~~~~~~i-G~SdHs~----------~~~-  231 (385)
T 1vli_A          165 TAG-AEISDVHEAWRTIRAEGNNQIAIMHCVAKYPAPPEYSNLSVIPMLAAAFPEAVI-GFSDHSE----------HPT-  231 (385)
T ss_dssp             CTT-CCHHHHHHHHHHHHTTTCCCEEEEEECSSSSCCGGGCCTTHHHHHHHHSTTSEE-EEEECCS----------SSS-
T ss_pred             CCC-CCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCE-EECCCCC----------CCH-
T ss_conf             265-443468999999986478767998547889996576418899999983266745-8788886----------741-


Q ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCHHHC--CCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999718988999836983347--9782018688999999999999999885
Q gi|254780669|r  243 QYIVPLAKAAVAIGIAGIFLETHQDPDNA--PSDGPNMINIKDLPKLLSQLLAIDKIIK  299 (301)
Q Consensus       243 ~~v~~la~aa~a~G~dGlfiE~Hp~P~~A--lsD~~q~l~l~~l~~ll~~l~~i~~~vk  299 (301)
                          ..+.+|+++||.  +||-|-..+..  -.|...+++|++|..+++.++.+..+..
T Consensus       232 ----~~~~~Ai~~GA~--iIEKH~Tl~k~~~g~D~~~Sl~p~e~~~~v~~ir~~~~~lG  284 (385)
T 1vli_A          232 ----EAPCAAVRLGAK--LIEKHFTIDKNLPGADHSFALNPDELKEMVDGIRKTEAELK  284 (385)
T ss_dssp             ----HHHHHHHHTTCS--EEEEEBCSCTTSSCSSCTTSBCHHHHHHHHHHHHHHHHHHH
T ss_pred             ----HHHHHHHHCCCC--EEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             ----667998737982--68999970366534555426695899999999999999838