HHsearch results for GI: 254780669 and protein with PDBid: 2qkf_A

>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 kdops; 1.75A {Neisseria meningitidis serogroup B} PDB: 3fyo_A* 3fyp_A* 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A*
Probab=100.00  E-value=0  Score=342.17  Aligned_cols=266  Identities=44%  Similarity=0.765  Sum_probs=254.9

Q ss_pred             CCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             72797699706999548634999999999999999655339970660155768866632224567124888999886652
Q gi|254780669|r   35 NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKY  114 (301)
Q Consensus        35 ~~i~ig~~~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~  114 (301)
                      |++.||+++|++||||||+.||.|+.+++|+.+.+..++.+.+.+...+|.+.++++..++++.+..++|+++.+.++++
T Consensus         6 ~~~~Ig~~~p~~iIAg~~~n~n~d~~le~AkkLi~~Ak~aGadaVKfQ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~   85 (280)
T 2qkf_A            6 NDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEF   85 (280)
T ss_dssp             TTEEESTTSCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHTCCEEEEEESCCSSCSSSSSCCCSCHHHHHHHHHHHHHHH
T ss_pred             CCEEECCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             99998899926999838824598999999999999999839898998424079756854222222256899999998750


Q ss_pred             CCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             87688522889999876502157882257628999999985059779983677789999999999997258780899514
Q gi|254780669|r  115 GFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER  194 (301)
Q Consensus       115 glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcER  194 (301)
                      ++++.|++++..+.+...+++|++|||+|.++|++|+++++++++||++++|+..+.++|.++++++.+.||.++++|+|
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~~~~i~s~~~~n~~ll~~~~~~~~pv~l~tg~~~~~~~~~~~~~~i~s~Gn~~~~l~~~  165 (280)
T 2qkf_A           86 GIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCER  165 (280)
T ss_dssp             CCCEEEECCSGGGHHHHHHHCSEEEECGGGTTBHHHHHHHHHTCCEEEEECCTTSCGGGHHHHHHHHHHTTCCCEEEEEC
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCHHHCCCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             87523210207889999999888654455402338999988516743532777567999998999998669986388863


Q ss_pred             CCCCCCHHHCCCCCCCHHHHHH--CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCC
Q ss_conf             6544401000000010688851--87168711777421223453212638899999999997189889998369833479
Q gi|254780669|r  195 GTSFGYNTLVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP  272 (301)
Q Consensus       195 G~~fgy~~lvvD~~~i~~lk~~--~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~Al  272 (301)
                      |+++++.....+++.+..++..  ..|++.|++|..+.+........|+++..+.++.||+|+|++|++||.|++|++++
T Consensus       166 ~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~aAvalGA~g~iIEkHft~dk~~  245 (280)
T 2qkf_A          166 GSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQTRDAGSAASGGRRAQALDLALAGMATRLAGLFLESHPDPKLAK  245 (280)
T ss_dssp             CEECSTTCEECCTTHHHHHHHHTTTCCEEEEHHHHCC----------CHHHHHHHHHHHHHTTCCSEEEEEC--------
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCEEEEEECCCHHHCC
T ss_conf             23356653211066799999861489861201010026665564224410345412599997489989999788801058


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             7820186889999999999999998851
Q gi|254780669|r  273 SDGPNMINIKDLPKLLSQLLAIDKIIKP  300 (301)
Q Consensus       273 sD~~q~l~l~~l~~ll~~l~~i~~~vk~  300 (301)
                      ||++++|+|++|++|++.+++|++++|+
T Consensus       246 ~D~~~Sl~p~el~~lv~~ir~i~~~ik~  273 (280)
T 2qkf_A          246 CDGPSALPLHLLEDFLIRIKALDDLIKS  273 (280)
T ss_dssp             --------CCHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             9722257999999999999999999758