HHsearch results for GI: 254780669 and protein with PDBid: 2wqp_A

>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transferase; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A
Probab=99.46  E-value=3.9e-10  Score=86.11  Aligned_cols=246  Identities=13%  Similarity=0.131  Sum_probs=169.5

Q ss_pred             CCCEEEECCCCCCEEECCCCCEEEEE--CCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEEC------CCCCCCC-CCCC
Q ss_conf             17706835787727976997069995--48634999999999999999655339-9706601------5576886-6632
Q gi|254780669|r   24 TNAAIHLGSGKNQVTFSNEQRFVLIA--GPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKS------SFDKANR-SSLA   93 (301)
Q Consensus        24 ~~~~~~ig~~~~~i~ig~~~~l~iIA--GPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~------sfdKanR-tS~~   93 (301)
                      .+..+.|    |+..||.+.|.+|||  |-+---+.+.+.++.+..++.|++.. .. .|++      ....... ....
T Consensus         3 ~~~~~ki----~~~~ig~~~~~~iIAEIg~NH~Gdl~~a~~LI~~A~~sGadaVKFQ-~~~~~~~~~~~~~~~~~~~~~~   77 (349)
T 2wqp_A            3 NNNEFKI----GNRSVGYNHEPLIICEIGINHEGSLKTAFEMVDAAYNAGAEVVKHQ-THIVEDEMSDEAKQVIPGNADV   77 (349)
T ss_dssp             CCCEEEE----TTEEEETTSCCEEEEEEETTTTTCHHHHHHHHHHHHHHTCSEEEEE-ECCHHHHCCGGGGGCCCTTCSS
T ss_pred             CCCCEEE----CCEEECCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEC-CCCHHHHHCHHHHHHCCCCCCC
T ss_conf             8870778----9989689998289997067757769999999999998399999901-7373776186667520478886


Q ss_pred             CC----CC--CCCHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECC
Q ss_conf             22----45--6712488899988665287688522889999876502-15788225762899999998505977998367
Q gi|254780669|r   94 GK----RG--VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKG  166 (301)
Q Consensus        94 sf----rG--~Gle~gL~il~e~k~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkg  166 (301)
                      ++    .-  +..+ -...|.+..++.|+...+.+-+..-++.+.+. +|.+-|++..+.|.+||++++++++||.+=-|
T Consensus        78 ~~~~~~~~~el~~~-~~~~l~~~~k~~gi~f~~t~fd~~sv~~l~~~~~~~~KIaS~~~~n~~Li~~i~~~~kpiiiStG  156 (349)
T 2wqp_A           78 SIYEIMERCALNEE-DEIKLKEYVESKGMIFISTLFSRAAALRLQRMDIPAYKIGSGECNNYPLIKLVASFGKPIILSTG  156 (349)
T ss_dssp             CHHHHHHHHCCCHH-HHHHHHHHHHHTTCEEEEEECSHHHHHHHHHHTCSCEEECGGGTTCHHHHHHHHTTCSCEEEECT
T ss_pred             CHHHHHHHHHHHHH-HHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHCCCCEECCCHHHCCHHHHHHHHHCCCCEEEECC
T ss_conf             03343554433268-99999999862575288503642367887751555212152121408999999973997567435


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHC--CCCCCCHHHHHHC--CCEEECHHHHHHHCCCCCCCCCCCH
Q ss_conf             77899999999999972587808995146544401000--0000106888518--7168711777421223453212638
Q gi|254780669|r  167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV--TDMRSIPIMTSMG--VPVIFDASHSVQQPGIHGNCSGGER  242 (301)
Q Consensus       167 q~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~~lv--vD~~~i~~lk~~~--~PVi~D~SHs~q~p~~~~~~~gG~r  242 (301)
                      . .+.+|...+++.+...++ +++|.+==+.  |.+-.  ..++.+..||+..  +||=+. .|+.           |. 
T Consensus       157 ~-~~~~eI~~~v~~~~~~~~-~~~llhC~s~--YPt~~~~~nL~~I~~lk~~~~~~~iG~S-DHt~-----------g~-  219 (349)
T 2wqp_A          157 M-NSIESIKKSVEIIREAGV-PYALLHCTNI--YPTPYEDVRLGGMNDLSEAFPDAIIGLS-DHTL-----------DN-  219 (349)
T ss_dssp             T-CCHHHHHHHHHHHHHHTC-CEEEEECCCC--SSCCGGGCCTHHHHHHHHHCTTSEEEEE-CCSS-----------SS-
T ss_pred             C-CHHHHHHHHHHHHHHHCC-CCEEEEEECC--CCCHHHHCCHHHHHHHHHHCCCCCEEEC-CCCC-----------CC-
T ss_conf             4-305556678988876324-6313253489--9951554168988999986788755606-8887-----------62-


Q ss_pred             HHHHHHHHHHHHHCCCEEEEEECCC--HHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             8999999999971898899983698--3347978201868899999999999999988
Q gi|254780669|r  243 QYIVPLAKAAVAIGIAGIFLETHQD--PDNAPSDGPNMINIKDLPKLLSQLLAIDKII  298 (301)
Q Consensus       243 ~~v~~la~aa~a~G~dGlfiE~Hp~--P~~AlsD~~q~l~l~~l~~ll~~l~~i~~~v  298 (301)
                          ..+.+|++.||.  +||-|-.  ...--.|...+++|++|+.++..++.+..+.
T Consensus       220 ----~~~~~Ava~GA~--iIEKH~Tl~~~~~g~D~~~Sl~p~e~~~~v~~ir~~~~~l  271 (349)
T 2wqp_A          220 ----YACLGAVALGGS--ILERHFTDRMDRPGPDIVCSMNPDTFKELKQGAHALKLAR  271 (349)
T ss_dssp             ----HHHHHHHHHTCC--EEEEEBCSCTTCCSTTGGGCBCHHHHHHHHHHHHHHHHHS
T ss_pred             ----HHHHHHHHCCCC--EEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             ----778999976987--5789999537668987511289799999999999999871