HHsearch results for GI: 254780669 and protein with PDBid: 3btv_A

>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3btu_A
Probab=90.71  E-value=0.6  Score=25.69  Aligned_cols=79  Identities=10%  Similarity=0.083  Sum_probs=59.5

Q ss_pred             HHHHHHHHCCEEEEECCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCC------CEEEEECCCCCCHHHHHHHHHH
Q ss_conf             9988665287688522889999876502157882257628999999985059------7799836777899999999999
Q gi|254780669|r  107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTG------RVINVKKGQFLSPWEMHNILQK  180 (301)
Q Consensus       107 l~e~k~~~glpv~TeV~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~------kpV~iKkgq~~s~~e~~~a~ek  180 (301)
                      .++..++|++|-.+-..+.+++- ..+-+|++-|-.-+-...++..++.+.|      |+|++-|+...+.+|....++.
T Consensus        63 a~~~a~~~~~~~~~~y~~~~~ll-~~~~vD~V~I~tp~~~H~~~~~~al~aG~~~~~~KhV~~EKPla~~~~ea~~l~~~  141 (438)
T 3btv_A           63 SIATIQRLKLSNATAFPTLESFA-SSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKA  141 (438)
T ss_dssp             HHHHHHHTTCTTCEEESSHHHHH-HCSSCSEEEECSCHHHHHHHHHHHHHHGGGCTTCCEEEEESSCCSSHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCCCCCHHHHH-CCCCCCEEEECCCHHHHHHHHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHHH
T ss_conf             99999983999872069999995-59999889991987999999999998352015674599917713557788899998


Q ss_pred             HHHCCC
Q ss_conf             972587
Q gi|254780669|r  181 LHAHGA  186 (301)
Q Consensus       181 i~~~Gn  186 (301)
                      ....|.
T Consensus       142 a~~~~~  147 (438)
T 3btv_A          142 AAERGV  147 (438)
T ss_dssp             HHTTTC
T ss_pred             HHHCCC
T ss_conf             761398