HHsearch results for GI: 254780669 and protein with PDBid: 3g8r_A

>3g8r_A Probable spore coat polysaccharide biosynthesis protein E; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472}
Probab=99.25  E-value=8.7e-09  Score=77.25  Aligned_cols=231  Identities=14%  Similarity=0.185  Sum_probs=153.7

Q ss_pred             EEEE--CCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEC-----------CCCCCCCCC-CCCCCC--CCCHHHHHHHHH
Q ss_conf             9995--486349999999999999996553399706601-----------557688666-322245--671248889998
Q gi|254780669|r   46 VLIA--GPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS-----------SFDKANRSS-LAGKRG--VGLKKGREIFRD  109 (301)
Q Consensus        46 ~iIA--GPCsiES~e~~~~~A~~lk~~~~~~~~~~ifK~-----------sfdKanRtS-~~sfrG--~Gle~gL~il~e  109 (301)
                      +|||  |.+---+.+.+.++.+..++.|+......+.|=           ++......+ ..-|+-  +-. +-+..|.+
T Consensus         7 ~iIAEIg~NH~Gd~~~ak~lI~~a~~~ga~~d~~~avKfQ~~~~d~~~~~~~~~~~~~~~~~~~~~~~ls~-~~~~~l~~   85 (350)
T 3g8r_A            7 LFIFEMANNHMGNVEHGVALIRAIRESCQGFDFDFGFKLQYRNLDTFIHSSFKGRDDVKYVKRFEETRLQP-EQMQKLVA   85 (350)
T ss_dssp             EEEEECTTTTTTCSHHHHHHHHHHHHHTTTCCSEEEEEEEECCHHHHBCGGGTTCCSSSSHHHHHHTCCCH-HHHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECHHHHCCHHCCCCCCHHHHHHHHHHHCCH-HHHHHHHH
T ss_conf             99999256653759999999999998679976557368871158993460103777425999999753999-99999999


Q ss_pred             HHHHHCCEEEEECCCHHHHHHHHHH-CCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             8665287688522889999876502-157882257628999999985059779983677789999999999997258780
Q gi|254780669|r  110 LKKKYGFPILTDVHTEQQCEAIADS-VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKD  188 (301)
Q Consensus       110 ~k~~~glpv~TeV~~~~~~e~~~~~-vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~  188 (301)
                      -.++.|+...+.+.+..-++.+.+. +|.+-|++..+.|.+||++++++++||.+--| +++.+|...+++.+...+++-
T Consensus        86 ~~k~~gi~f~~s~fd~~s~~~l~~~~~~~~KIaS~d~~n~~Li~~i~~~~kpiiiStG-~~~~~eI~~a~~~~~~~~~~~  164 (350)
T 3g8r_A           86 EMKANGFKAICTPFDEESVDLIEAHGIEIIKIASCSFTDWPLLERIARSDKPVVASTA-GARREDIDKVVSFMLHRGKDL  164 (350)
T ss_dssp             HHHHTTCEEEEEECSHHHHHHHHHTTCCEEEECSSSTTCHHHHHHHHTSCSCEEEECT-TCCHHHHHHHHHHHHTTTCCE
T ss_pred             HHHHHCCCEEECCCHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHHCCCCEEECC-CCCHHHHHHHHHHHHCCCCEE
T ss_conf             9862174425262547776565404863797244153104799998500587612347-778888666666553258769


Q ss_pred             EEEEECCCCCCCHHHC--CCCCCCHHHHH-H-CCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             8995146544401000--00001068885-1-871687117774212234532126388999999999971898899983
Q gi|254780669|r  189 VLFCERGTSFGYNTLV--TDMRSIPIMTS-M-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET  264 (301)
Q Consensus       189 i~lcERG~~fgy~~lv--vD~~~i~~lk~-~-~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~  264 (301)
                       ++-+ +++ .|.+..  +.++.+..||+ + ++||=+ -.|+.           |.-   ...+.+|+++||.  +||-
T Consensus       165 -~llh-c~s-~YPt~~ed~nL~~I~~Lk~~~~~~~vGy-SDHt~-----------g~~---~~~~~~Av~~GA~--iIEK  224 (350)
T 3g8r_A          165 -TIMH-CVA-EYPTPDDHLHLARIKTLRQQYAGVRIGY-STHED-----------PDL---MEPIMLAVAQGAT--VFEK  224 (350)
T ss_dssp             -EEEE-CCC-CSSCCGGGCCTTHHHHHHHHCTTSEEEE-EECCC-----------SSC---CHHHHHHHHTTCC--EEEE
T ss_pred             -EEEE-CCC-CCCCCHHHCCCHHHHHHHHHCCCCEEEE-CCCCC-----------CCC---CCCHHHHHHCCCC--CEEE
T ss_conf             -9961-477-7899837747123544787536785787-88877-----------754---2126878858974--1206


Q ss_pred             CCCHHHC-CCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             6983347-978201868899999999999999988
Q gi|254780669|r  265 HQDPDNA-PSDGPNMINIKDLPKLLSQLLAIDKII  298 (301)
Q Consensus       265 Hp~P~~A-lsD~~q~l~l~~l~~ll~~l~~i~~~v  298 (301)
                      |-..++. ..|...++.+++|.+++..++.+..+.
T Consensus       225 HfTldk~~~g~d~~S~~~~e~~~~v~~i~~~~~~l  259 (350)
T 3g8r_A          225 HVGLPTDQYGINNYSANPEQVRRWLAAAARALAML  259 (350)
T ss_dssp             EBCCCBTTBCCCTTCBCHHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHH
T ss_conf             78447667897232027278999999999999995