HHsearch results for GI: 254780669 and protein with PDBid: 3gdo_A

>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A
Probab=90.66  E-value=0.96  Score=24.35  Aligned_cols=74  Identities=11%  Similarity=0.198  Sum_probs=57.3

Q ss_pred             HHHHHHC-CEEEEECCCHHHHHHHH-HHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             8866528-76885228899998765-021578822576289999999850597799836777899999999999972587
Q gi|254780669|r  109 DLKKKYG-FPILTDVHTEQQCEAIA-DSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGA  186 (301)
Q Consensus       109 e~k~~~g-lpv~TeV~~~~~~e~~~-~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn  186 (301)
                      +++++|+ .++.+++.     |.+. +-+|.+-|-+-+....+++.++.+.||+|++-|+...+.+|....++.....|.
T Consensus        43 ~~~~~~~~~~~~~s~~-----ell~~~~~DaV~i~tp~~~H~~~~~~al~~gk~V~~EKPla~~~~ea~~l~~~a~~~~~  117 (358)
T 3gdo_A           43 EVKRDFPDAEVVHELE-----EITNDPAIELVIVTTPSGLHYEHTMACIQAGKHVVMEKPMTATAEEGETLKRAADEKGV  117 (358)
T ss_dssp             HHHHHCTTSEEESSTH-----HHHTCTTCCEEEECSCTTTHHHHHHHHHHTTCEEEEESSCCSSHHHHHHHHHHHHHHTC
T ss_pred             HHHHHCCCCCEECCHH-----HHHCCCCCCEEEECCCHHHHHHHHHHHHHCCCEEEEECEEHHHHHHHHHHHHHHHHCCE
T ss_conf             9998679983539999-----99659999999988976889999999986599898612000103678999998762451


Q ss_pred             C
Q ss_conf             8
Q gi|254780669|r  187 K  187 (301)
Q Consensus       187 ~  187 (301)
                      .
T Consensus       118 ~  118 (358)
T 3gdo_A          118 L  118 (358)
T ss_dssp             C
T ss_pred             E
T ss_conf             5