HHsearch results for GI: 254780669 and protein with PDBid: 3moi_A

>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica}
Probab=95.00  E-value=0.07  Score=31.83  Aligned_cols=76  Identities=20%  Similarity=0.306  Sum_probs=62.2

Q ss_pred             HHHHHHHHHCCEEEEECCCHHHHHHHH-HHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHC
Q ss_conf             999886652876885228899998765-0215788225762899999998505977998367778999999999999725
Q gi|254780669|r  106 IFRDLKKKYGFPILTDVHTEQQCEAIA-DSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAH  184 (301)
Q Consensus       106 il~e~k~~~glpv~TeV~~~~~~e~~~-~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~  184 (301)
                      -.+++.++||+++.+++   ++  .+. .-+|++-|-.-+-...+++.++.+.||.|++-|+...+++|....++.....
T Consensus        40 ~~~~~~~~~~~~~~~~~---~e--ll~~~~vD~V~i~tp~~~H~~~~~~al~~gkhV~~EKPla~~~~ea~~l~~~a~~~  114 (387)
T 3moi_A           40 VRERFGKEYGIPVFATL---AE--MMQHVQMDAVYIASPHQFHCEHVVQASEQGLHIIVEKPLTLSRDEADRMIEAVERA  114 (387)
T ss_dssp             HHHHHHHHHTCCEESSH---HH--HHHHSCCSEEEECSCGGGHHHHHHHHHHTTCEEEECSCCCSCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCEECCH---HH--HHCCCCCCEEEECCCCHHHHHHHHHHHHHCCCEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             99999998599858999---99--96599998899908967899999999861895653788879999999999999980


Q ss_pred             CC
Q ss_conf             87
Q gi|254780669|r  185 GA  186 (301)
Q Consensus       185 Gn  186 (301)
                      |.
T Consensus       115 g~  116 (387)
T 3moi_A          115 GV  116 (387)
T ss_dssp             TC
T ss_pred             CC
T ss_conf             99