BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780669|ref|YP_003065082.1|
2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter
asiaticus str. psy62]
         (301 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780669|ref|YP_003065082.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040346|gb|ACT57142.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 301

 Score =  624 bits (1610), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 301/301 (100%), Positives = 301/301 (100%)

Query: 1   MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHA 60
           MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHA
Sbjct: 1   MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHA 60

Query: 61  FMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT 120
           FMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT
Sbjct: 61  FMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT 120

Query: 121 DVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQK 180
           DVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQK
Sbjct: 121 DVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQK 180

Query: 181 LHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGG 240
           LHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGG
Sbjct: 181 LHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGG 240

Query: 241 ERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           ERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP
Sbjct: 241 ERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300

Query: 301 L 301
           L
Sbjct: 301 L 301


>gi|315122220|ref|YP_004062709.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495622|gb|ADR52221.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 281

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 249/281 (88%), Positives = 262/281 (93%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M HTN  I LG GK QVTFSN++R VLIAGPCQIES +HAFM+AEKLYAICQSLNIGLVY
Sbjct: 1   MTHTNLEIQLGHGKKQVTFSNQKRLVLIAGPCQIESREHAFMMAEKLYAICQSLNIGLVY 60

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANRSSLAGKRG+GL+KGREIF DLKKKYGFPILTDVHTEQQC+AIADSVDILQI
Sbjct: 61  KSSFDKANRSSLAGKRGIGLEKGREIFLDLKKKYGFPILTDVHTEQQCKAIADSVDILQI 120

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAAQTGRVINVKKGQFLSPWEMHN+LQKLHA+GA DVLFCERGTSFGY
Sbjct: 121 PAFLCRQTDLLIAAAQTGRVINVKKGQFLSPWEMHNVLQKLHANGAMDVLFCERGTSFGY 180

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LVTDMRS PIM SMGVPVIFDASHSVQQPGI GNCSGGER++I PLAKAAVAIGIAGI
Sbjct: 181 NNLVTDMRSFPIMASMGVPVIFDASHSVQQPGIRGNCSGGEREFIAPLAKAAVAIGIAGI 240

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           FLETHQDPDNAPSDGPNMINI DLPKLLSQLL+IDK+IK L
Sbjct: 241 FLETHQDPDNAPSDGPNMINIDDLPKLLSQLLSIDKVIKSL 281


>gi|86357551|ref|YP_469443.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium etli CFN 42]
 gi|86281653|gb|ABC90716.1| 2-dehydro-3-deoxyphosphooctonate aldolase protein [Rhizobium etli
           CFN 42]
          Length = 281

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 185/276 (67%), Positives = 231/276 (83%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G+ QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L +GLVYKSS
Sbjct: 5   TNSEVKIGEGEGQVTFSNAGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLGVGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+GL+KG E+F DLKK++GFP+LTDVHT +QC  +A+ +D+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGLEKGMEVFADLKKEFGFPVLTDVHTAEQCAEVAEVIDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIMT+MG PVIFDA+HSV QPG  G  SGG+R+++  LA+AAVA GIAG+FLE
Sbjct: 185 VSDMRSLPIMTAMGAPVIFDATHSVAQPGGQGESSGGQREFVETLARAAVATGIAGVFLE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D + K
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAVAK 280


>gi|190891624|ref|YP_001978166.1| 3-deoxy-8-phosphooctulonate synthase [Rhizobium etli CIAT 652]
 gi|190696903|gb|ACE90988.1| 3-deoxy-8-phosphooctulonate synthase protein [Rhizobium etli CIAT
           652]
          Length = 281

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 185/276 (67%), Positives = 230/276 (83%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G+ QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYKSS
Sbjct: 5   TNSEVKIGEGEGQVTFSNTGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLGIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+GL+KG E+F DLKK++GFP+LTDVHT +QC  +A+ +D+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGLEKGMEVFADLKKEFGFPVLTDVHTAEQCAEVAEVIDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLKKLNASGNANVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM +MG PVIFDA+HSV QPG  G  SGG+R+++  LA+AAVA GIAG+FLE
Sbjct: 185 VSDMRSLPIMAAMGAPVIFDATHSVAQPGGQGESSGGQREFVETLARAAVATGIAGVFLE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D + K
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAVAK 280


>gi|327189238|gb|EGE56417.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium etli CNPAF512]
          Length = 281

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/276 (66%), Positives = 229/276 (82%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G  QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L+IGLVYKSS
Sbjct: 5   TNSEVKIGEGNGQVTFSNTGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLDIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+GL+KG E+F DLKK++GFP+LTDVHT +QC  +A+ +D+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGLEKGMEVFADLKKEFGFPVLTDVHTAEQCAEVAEVIDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM +MG PVIFDA+HSV QPG  G  SGG+R+++  LA+AAVA GIAG+FLE
Sbjct: 185 VSDMRSLPIMAAMGAPVIFDATHSVAQPGGQGESSGGQREFVETLARAAVATGIAGVFLE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           THQDPDNAPSDGPNM+ + D+P+LL +LLA D + K
Sbjct: 245 THQDPDNAPSDGPNMVYLNDMPRLLEKLLAFDAVAK 280


>gi|218660788|ref|ZP_03516718.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium etli IE4771]
          Length = 281

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/276 (66%), Positives = 230/276 (83%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G+ QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYKSS
Sbjct: 5   TNSEVKIGEGEGQVTFSNTGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLGIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+GL+KG ++F DLK+++GFP+LTDVHT +QC  +A+ +D+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGLEKGMQVFADLKREFGFPVLTDVHTAEQCAEVAEVIDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM +MG PVIFDA+HSV QPG  G  SGG+R+++  LA+AAVA GIAG+FLE
Sbjct: 185 VSDMRSLPIMAAMGAPVIFDATHSVAQPGGQGESSGGQREFVETLARAAVATGIAGVFLE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D I K
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAIAK 280


>gi|218462323|ref|ZP_03502414.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium etli Kim 5]
          Length = 281

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 183/276 (66%), Positives = 230/276 (83%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G+ QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYKSS
Sbjct: 5   TNSEVKIGEGEGQVTFSNTGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLGIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+GL+KG ++F DLK+++GFP+LTDVHT +QC  +A+ +D+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGLEKGMQVFADLKREFGFPVLTDVHTAEQCAEVAEVIDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM +MG PVIFDA+HSV QPG  G  SGG+R+++  LA+AAVA GIAG+FLE
Sbjct: 185 VSDMRSLPIMAAMGAPVIFDATHSVAQPGGQGESSGGQREFVETLARAAVATGIAGVFLE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D + K
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAVAK 280


>gi|209549199|ref|YP_002281116.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209534955|gb|ACI54890.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 281

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/276 (66%), Positives = 228/276 (82%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G  QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYKSS
Sbjct: 5   TNSEVRIGEGAGQVTFSNTGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLGIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+GL+KG ++F DLKK++GFP+LTDVHT +QC  +A  VD+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGLEKGMQVFADLKKEFGFPVLTDVHTAEQCAEVAKVVDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGR +NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAAETGRAVNVKKGQFLAPWDMRNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM SMG PV+FDA+HSV QPG  G+ SGG+R+++  LA+AAVA GIAG+F+E
Sbjct: 185 VSDMRSLPIMASMGAPVVFDATHSVAQPGGQGDSSGGQREFVETLARAAVATGIAGVFVE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D + K
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAVAK 280


>gi|116251994|ref|YP_767832.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115256642|emb|CAK07730.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 281

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/276 (66%), Positives = 230/276 (83%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G+ QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYKSS
Sbjct: 5   TNSEVRIGEGQGQVTFSNAGRLSLIAGPCQMESRDHAFMVAGTLKELCGKLGIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+G++KG E+F DLKK++GFP+LTDVHT +QCE +A  VD+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGIEKGMEVFADLKKEFGFPVLTDVHTAEQCEEVAKVVDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM +MG PV+FDA+HSV QPG  G  SGG+R+++  LA+AAVA GIAG+F+E
Sbjct: 185 VSDMRSLPIMAAMGAPVVFDATHSVAQPGGQGESSGGQREFVETLARAAVAAGIAGVFVE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D + K
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAVAK 280


>gi|241204521|ref|YP_002975617.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240858411|gb|ACS56078.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 281

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/276 (65%), Positives = 230/276 (83%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G+ QV+FSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYKSS
Sbjct: 5   TNSEVRIGEGQGQVSFSNTGRLSLIAGPCQMESRDHAFMVAGTLKELCGKLGIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+G++KG E+F DLKK++GFP+LTDVHT +QC  +A  VD+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGIEKGMEVFADLKKEFGFPVLTDVHTAEQCAEVAKVVDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM +MG PV+FDA+HSV QPG  G+ SGG+R+++  LA+AAVA GIAG+F+E
Sbjct: 185 VSDMRSLPIMAAMGAPVVFDATHSVAQPGGQGDSSGGQREFVETLARAAVAAGIAGVFVE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D + K
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAVAK 280


>gi|159184755|ref|NP_354432.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Agrobacterium
           tumefaciens str. C58]
 gi|159140043|gb|AAK87217.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Agrobacterium
           tumefaciens str. C58]
          Length = 281

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 182/278 (65%), Positives = 229/278 (82%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +  N  +  G G ++V+F N +RF LIAGPCQ+ES DHAFMIA  L  +C SL IGLVYK
Sbjct: 3   VTNNLKVTAGDGASKVSFCNTERFSLIAGPCQMESRDHAFMIAGVLKELCDSLGIGLVYK 62

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SSFDKANR+SL+GKRG+GL    EIF DLKK++GFP+L+D+HTE+QC  +++ VD+LQIP
Sbjct: 63  SSFDKANRTSLSGKRGIGLDSAMEIFADLKKEFGFPVLSDIHTEEQCAIVSEVVDVLQIP 122

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDLL AAA+TGRVINVKKGQFL+PW+M N+L KL+  G  +VL CERG SFGYN
Sbjct: 123 AFLSRQTDLLVAAAKTGRVINVKKGQFLAPWDMKNVLAKLNESGNPNVLLCERGASFGYN 182

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV+DMRS+PIM S+G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+F
Sbjct: 183 TLVSDMRSLPIMASLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGLF 242

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +ETH+DPDNAPSDGPNM+++KD+PKLL +LLA D I K
Sbjct: 243 IETHEDPDNAPSDGPNMVHLKDMPKLLEKLLAFDAITK 280


>gi|22095794|sp|Q8UFH3|KDSA_AGRT5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
          Length = 282

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 182/278 (65%), Positives = 229/278 (82%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +  N  +  G G ++V+F N +RF LIAGPCQ+ES DHAFMIA  L  +C SL IGLVYK
Sbjct: 4   VTNNLKVTAGDGASKVSFCNTERFSLIAGPCQMESRDHAFMIAGVLKELCDSLGIGLVYK 63

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SSFDKANR+SL+GKRG+GL    EIF DLKK++GFP+L+D+HTE+QC  +++ VD+LQIP
Sbjct: 64  SSFDKANRTSLSGKRGIGLDSAMEIFADLKKEFGFPVLSDIHTEEQCAIVSEVVDVLQIP 123

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDLL AAA+TGRVINVKKGQFL+PW+M N+L KL+  G  +VL CERG SFGYN
Sbjct: 124 AFLSRQTDLLVAAAKTGRVINVKKGQFLAPWDMKNVLAKLNESGNPNVLLCERGASFGYN 183

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV+DMRS+PIM S+G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+F
Sbjct: 184 TLVSDMRSLPIMASLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGLF 243

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +ETH+DPDNAPSDGPNM+++KD+PKLL +LLA D I K
Sbjct: 244 IETHEDPDNAPSDGPNMVHLKDMPKLLEKLLAFDAITK 281


>gi|227821843|ref|YP_002825813.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sinorhizobium fredii
           NGR234]
 gi|227340842|gb|ACP25060.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sinorhizobium fredii
           NGR234]
          Length = 279

 Score =  365 bits (937), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 180/278 (64%), Positives = 229/278 (82%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           + TNA + +G G  QV FS ++R  LIAGPCQ+ES +HAFM+A KL  +C+SL +GLVYK
Sbjct: 1   METNARVVVGEGIGQVVFSQKERLTLIAGPCQMESREHAFMMAGKLAELCKSLGLGLVYK 60

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SSFDKANR+SL+GKRG+GL+K  EIF DLK+++GFP+LTDVHTE+QC  +A ++DILQIP
Sbjct: 61  SSFDKANRTSLSGKRGIGLEKAMEIFADLKREFGFPVLTDVHTEEQCSQVAGTIDILQIP 120

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDLL AAA+TGR INVKKGQFL+PW+M N+L K    G  +VL CERG SFGYN
Sbjct: 121 AFLSRQTDLLVAAAKTGRAINVKKGQFLAPWDMKNVLAKFTMSGNPNVLLCERGASFGYN 180

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV+DMRS+PIM  +G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F
Sbjct: 181 TLVSDMRSLPIMAGLGAPVVFDATHSVQQPGGQGGSSGGQREFVETLARAAVAVGVAGVF 240

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +ETH+DPD+APSDGPNM+ +KD+P+LL +LLA D I K
Sbjct: 241 IETHEDPDSAPSDGPNMVPLKDMPRLLEKLLAFDAISK 278


>gi|15965195|ref|NP_385548.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sinorhizobium meliloti
           1021]
 gi|20532119|sp|Q92Q99|KDSA_RHIME RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|15074375|emb|CAC46021.1| Probable 2-dehydro-3-deoxyphosphooctonate aldolase [Sinorhizobium
           meliloti 1021]
          Length = 280

 Score =  365 bits (937), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 179/279 (64%), Positives = 232/279 (83%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M+ TN+ + +G G  QV FS ++R  LIAGPCQ+ES +HAFMIA +L  +C+SL +GLVY
Sbjct: 1   MMETNSRVVVGEGAGQVVFSQKERLTLIAGPCQMESREHAFMIAGELVELCRSLGLGLVY 60

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL+GKRG+GL K  E+F DLK+++GFP+LTD+HTE+QC A+A++VDILQI
Sbjct: 61  KSSFDKANRTSLSGKRGIGLDKAMEVFADLKREFGFPVLTDIHTEEQCAAVAETVDILQI 120

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA L RQTDLL AAA+TGR INVKKGQFL+PW+M N+L K    G  +VL CERG SFGY
Sbjct: 121 PAFLSRQTDLLVAAAKTGRTINVKKGQFLAPWDMKNVLAKFTESGNPNVLLCERGASFGY 180

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMRS+PIM ++G PV+FDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+
Sbjct: 181 NTLVSDMRSLPIMAALGAPVVFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGV 240

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+ETH+DPDNAPSDGPNM+ +KD+P+LL +LLA D + K
Sbjct: 241 FVETHEDPDNAPSDGPNMVPLKDMPRLLEKLLAFDAVAK 279


>gi|325292756|ref|YP_004278620.1| 2-dehydro-3-deoxyphosphooctonate aldolase / KDO 8-P synthase
           [Agrobacterium sp. H13-3]
 gi|325060609|gb|ADY64300.1| 2-dehydro-3-deoxyphosphooctonate aldolase / KDO 8-P synthase
           [Agrobacterium sp. H13-3]
          Length = 281

 Score =  363 bits (931), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 177/278 (63%), Positives = 229/278 (82%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +  N  +  G G ++V+FSN +RF LIAGPCQ+ES +HAFMIA  L  +C  L IGLVYK
Sbjct: 3   VTNNLKVTAGDGASKVSFSNAERFSLIAGPCQMESREHAFMIAGVLKELCDKLGIGLVYK 62

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SSFDKANR+SL+GKRG+GL    ++F DLKK++GFP+LTD+HTE+QC  +++ VD+LQIP
Sbjct: 63  SSFDKANRTSLSGKRGIGLDNAMQVFADLKKEFGFPVLTDIHTEEQCAVVSEVVDVLQIP 122

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDLL AAA+TGRVINVKKGQFL+PW+M N+L KL+  G  +V+ CERG SFGYN
Sbjct: 123 AFLSRQTDLLVAAAKTGRVINVKKGQFLAPWDMKNVLAKLNESGNPNVMLCERGASFGYN 182

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV+DMRS+PIM ++G PV+FDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+F
Sbjct: 183 TLVSDMRSLPIMAALGAPVVFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGLF 242

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +ETH+DPDNAPSDGPNM+++KD+PKLL +LLA D I K
Sbjct: 243 IETHEDPDNAPSDGPNMVHLKDMPKLLEKLLAFDAITK 280


>gi|307309209|ref|ZP_07588880.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sinorhizobium meliloti
           BL225C]
 gi|307321539|ref|ZP_07600934.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sinorhizobium meliloti
           AK83]
 gi|306892846|gb|EFN23637.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sinorhizobium meliloti
           AK83]
 gi|306900355|gb|EFN30971.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sinorhizobium meliloti
           BL225C]
          Length = 279

 Score =  362 bits (930), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 178/278 (64%), Positives = 231/278 (83%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           + TN+ + +G G  QV FS ++R  LIAGPCQ+ES +HAFMIA +L  +C+SL +GLVYK
Sbjct: 1   METNSRVVVGEGAGQVVFSQKERLTLIAGPCQMESREHAFMIAGELVELCRSLGLGLVYK 60

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SSFDKANR+SL+GKRG+GL K  E+F DLK+++GFP+LTD+HTE+QC A+A++VDILQIP
Sbjct: 61  SSFDKANRTSLSGKRGIGLDKAMEVFADLKREFGFPVLTDIHTEEQCAAVAETVDILQIP 120

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDLL AAA+TGR INVKKGQFL+PW+M N+L K    G  +VL CERG SFGYN
Sbjct: 121 AFLSRQTDLLVAAAKTGRTINVKKGQFLAPWDMKNVLAKFTESGNPNVLLCERGASFGYN 180

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV+DMRS+PIM ++G PV+FDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+F
Sbjct: 181 TLVSDMRSLPIMAALGAPVVFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGVF 240

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +ETH+DPDNAPSDGPNM+ +KD+P+LL +LLA D + K
Sbjct: 241 VETHEDPDNAPSDGPNMVPLKDMPRLLEKLLAFDAVAK 278


>gi|49475364|ref|YP_033405.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella henselae str.
           Houston-1]
 gi|59798265|sp|Q6G409|KDSA_BARHE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|49238170|emb|CAF27379.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella henselae str.
           Houston-1]
          Length = 279

 Score =  361 bits (926), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 174/279 (62%), Positives = 218/279 (78%), Gaps = 4/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   NA + +G+    + FSNE  F LIAGPCQIES DHAF +A ++  I   + IG VY
Sbjct: 1   MSEPNAIVKVGN----IIFSNEAPFSLIAGPCQIESRDHAFEMAGRIKTITDQVGIGFVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL+  RGVGL+    IF DLKK++G PILTDVHTE+QC  +A +VDILQI
Sbjct: 57  KSSYDKANRTSLSAVRGVGLENAMAIFSDLKKEFGCPILTDVHTEEQCTVVASTVDILQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRVIN+KKGQFL+PW+M N+L+K+   G ++V+ CERGTSFGY
Sbjct: 117 PAFLCRQTDLLVAAAKTGRVINIKKGQFLAPWDMKNVLRKVTQSGNRNVMLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N L++DMRS+PI+ S G PVIFDA+HSVQ+PG  G+ SGG+RQ++  LA+AAV++G+AGI
Sbjct: 177 NRLISDMRSLPILRSFGAPVIFDATHSVQEPGGQGDSSGGQRQFVEILARAAVSVGVAGI 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           FLETHQDPDNAPSDGPNMI I  L +LL  L+  D + K
Sbjct: 237 FLETHQDPDNAPSDGPNMIKIDHLQRLLETLMEFDYLSK 275


>gi|163760087|ref|ZP_02167170.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hoeflea phototrophica
           DFL-43]
 gi|162282486|gb|EDQ32774.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hoeflea phototrophica
           DFL-43]
          Length = 280

 Score =  359 bits (921), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 166/280 (59%), Positives = 208/280 (74%), Gaps = 5/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   N+ + +G       F N +   LIAGPCQ ES DHAF +A  L  +C  L IGLVY
Sbjct: 1   MSEANSTVTVG----DAVFDNTRPLTLIAGPCQFESRDHAFDMAGALKELCAGLGIGLVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL+  RG GL     +F DL+++ G P+LTD+HTE+ C  +A  VD+LQI
Sbjct: 57  KSSYDKANRTSLSSTRGAGLDAAMPVFDDLRQQLGLPVLTDIHTEEHCAIVAPHVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG+VINVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLVAAAKTGKVINVKKGQFLAPWDMKNVLGKITGSGNANVLLTERGASFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMR++PIM  MG PVIFDA+HSVQQPG  G  SGGER+++  L++AAVA+GIAG+
Sbjct: 177 NTLVSDMRALPIMADMGAPVIFDATHSVQQPGGQGATSGGERRFVETLSRAAVAVGIAGV 236

Query: 261 FLETHQDPDNA-PSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+ETHQDPDN+  SDGPNMI +KDLP+LL  L+A D + K
Sbjct: 237 FIETHQDPDNSTSSDGPNMIPLKDLPRLLETLMAFDSVAK 276


>gi|239832022|ref|ZP_04680351.1| 3-deoxy-8-phosphooctulonate synthase [Ochrobactrum intermedium LMG
           3301]
 gi|239824289|gb|EEQ95857.1| 3-deoxy-8-phosphooctulonate synthase [Ochrobactrum intermedium LMG
           3301]
          Length = 277

 Score =  358 bits (920), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 171/281 (60%), Positives = 222/281 (79%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   N+++ +G+    VTFSN   F LIAGPCQ+E+ +HAF +A +L  +   L IGLVY
Sbjct: 1   MATANSSVKIGN----VTFSNSAPFALIAGPCQMETREHAFEMAGRLKEMTDKLGIGLVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL  +RG+GL+K  E+F DLKK++GFP+LTD+HTE QC  +A  VD+LQI
Sbjct: 57  KSSFDKANRTSLKAERGIGLEKALEVFADLKKEFGFPVLTDIHTEGQCAEVAPVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLSKITESGNPNVLATERGVSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMRS+PIM ++G PV+FDA+HSVQQPG  G  SGG+R+++  L++AAVA+G+AG+
Sbjct: 177 NTLVSDMRSLPIMAALGSPVVFDATHSVQQPGGQGGSSGGQREFVETLSRAAVAVGVAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F+ETHQDPDNAPSDGPNM+ +  +P LL +L+A D+I K L
Sbjct: 237 FIETHQDPDNAPSDGPNMVPVDKMPTLLEKLMAFDRIAKGL 277


>gi|222085873|ref|YP_002544404.1| 3-deoxy-8-phosphooctulonate synthase [Agrobacterium radiobacter
           K84]
 gi|221723321|gb|ACM26477.1| 3-deoxy-8-phosphooctulonate synthase [Agrobacterium radiobacter
           K84]
          Length = 279

 Score =  358 bits (919), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 178/278 (64%), Positives = 230/278 (82%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           + TN+ + +G G ++V FSN  +  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYK
Sbjct: 1   MSTNSEVIVGEGASKVLFSNTAKLSLIAGPCQMESRDHAFMVAGVLKELCGKLGIGLVYK 60

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SS+DKANR+SL+GKRG+GL+K  E+F DLKK+YGFP+L+D+HTE+QC  +A +VDILQIP
Sbjct: 61  SSYDKANRTSLSGKRGIGLEKAMEVFADLKKEYGFPVLSDIHTEEQCAVVAKTVDILQIP 120

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L KL+  G  +++ CERG SFGYN
Sbjct: 121 AFLSRQTDLLVAAAKTGRVVNVKKGQFLAPWDMKNVLAKLNDSGNLNIMLCERGASFGYN 180

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV+DMRS+PIM +MG PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+F
Sbjct: 181 TLVSDMRSLPIMAAMGAPVIFDATHSVQQPGGQGGSTGGDRRFVETLARAAVAVGVAGVF 240

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +ETH+DPDNAPSDGPNM+ +KD+P+LL +LLA D I K
Sbjct: 241 VETHEDPDNAPSDGPNMVYLKDMPQLLEKLLAFDAIAK 278


>gi|150396292|ref|YP_001326759.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sinorhizobium medicae
           WSM419]
 gi|150027807|gb|ABR59924.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sinorhizobium medicae
           WSM419]
          Length = 279

 Score =  358 bits (918), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 179/278 (64%), Positives = 228/278 (82%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           + TN+ + +G G  QV FS ++R  LIAGPCQ+ES +HAF IA KL  +C+SL IGLVYK
Sbjct: 1   METNSRVVVGEGAGQVVFSQKERLTLIAGPCQMESREHAFTIAGKLVELCRSLGIGLVYK 60

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SSFDKANR+SL+GKRG+GL    E+F DLK+++GFP+LTD+HTE+QC  +A++VDILQIP
Sbjct: 61  SSFDKANRTSLSGKRGIGLDNAMEVFADLKREFGFPVLTDIHTEEQCALVAETVDILQIP 120

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDLL AAA+TGR INVKKGQFL+PW+M N+L K    G  +VL CERG SFGYN
Sbjct: 121 AFLSRQTDLLVAAAKTGRAINVKKGQFLAPWDMKNVLAKFTQSGNPNVLLCERGASFGYN 180

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV+DMRS+PIM ++G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F
Sbjct: 181 TLVSDMRSLPIMAALGAPVVFDATHSVQQPGGQGGSSGGQREFVETLARAAVAVGVAGVF 240

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +ETH+DPDNAPSDGPNM+ +KD+P+LL +LLA D I K
Sbjct: 241 VETHEDPDNAPSDGPNMVPLKDMPRLLEKLLAFDAIAK 278


>gi|319404083|emb|CBI77671.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 280

 Score =  357 bits (915), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 172/279 (61%), Positives = 217/279 (77%), Gaps = 4/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M  +N  + +G+    V FSNE    LIAGPCQ+ES DHAF +A ++  I     IG VY
Sbjct: 1   MFKSNITVKVGN----VVFSNEAPLSLIAGPCQMESRDHAFEMAGRIKTIVDQFGIGFVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL+  RG+GL+K   IF DLKK++G P+LTDVHTE+QC A+A  VD+LQI
Sbjct: 57  KSSYDKANRTSLSATRGIGLEKAIAIFSDLKKEFGCPVLTDVHTEEQCMAVASVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRVIN+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGY
Sbjct: 117 PAFLCRQTDLLVAAARTGRVINIKKGQFLAPWDMENVLEKVTKSGNPNVMLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LV+DMRS+PIM S G PVIFDA+HSVQ+PG  G+ SGG+R+++  LA+AAV+IG+AGI
Sbjct: 177 NRLVSDMRSLPIMRSFGAPVIFDATHSVQEPGGQGSSSGGQREFVEVLARAAVSIGVAGI 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           FLETHQDPDNAPSDG NMI I +L +LL  L+  D++ K
Sbjct: 237 FLETHQDPDNAPSDGLNMIKIDNLYRLLEILIDFDRLAK 275


>gi|307947117|ref|ZP_07662452.1| 3-deoxy-8-phosphooctulonate synthase [Roseibium sp. TrichSKD4]
 gi|307770781|gb|EFO30007.1| 3-deoxy-8-phosphooctulonate synthase [Roseibium sp. TrichSKD4]
          Length = 280

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 163/279 (58%), Positives = 212/279 (75%), Gaps = 4/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   N+ +++G+    V+FSN   F LIAGPCQ+ES +HA   A  +  I  +L I +V+
Sbjct: 1   MSKPNSVVNVGN----VSFSNTAAFSLIAGPCQMESREHALECAAAVKEIAGNLGIPVVF 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL+GKRGVGL     +F D+K++YG P+LTDVH  +QC  +++ VDILQI
Sbjct: 57  KSSFDKANRTSLSGKRGVGLSDALPVFGDIKERYGMPVLTDVHAAEQCAPVSEVVDILQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAAQTG V+NVKKGQFL+PW+M N+++K+      +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLVAAAQTGAVVNVKKGQFLAPWDMKNVMEKVTESSNPNVLLTERGASFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMR++PIM   G PVIFDA+HSVQQPG  G  SGG+R  +  L++AAVA+G+AG+
Sbjct: 177 NTLVSDMRALPIMAQTGAPVIFDATHSVQQPGGQGTSSGGDRTMVPVLSRAAVAVGVAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+ETH DPD+APSDGPNM+ +KDL  LLSQL A+D ++K
Sbjct: 237 FIETHPDPDSAPSDGPNMVPLKDLGALLSQLKALDSVVK 275


>gi|319407095|emb|CBI80732.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella sp. 1-1C]
          Length = 280

 Score =  356 bits (913), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 173/279 (62%), Positives = 217/279 (77%), Gaps = 4/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M+ +N  + +G+    V FSNE    LIAGPCQ+ES DHAF +A ++  I     IG VY
Sbjct: 1   MLKSNITVKVGN----VVFSNEAPLSLIAGPCQMESRDHAFEMAGRIKTIADQFGIGFVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL   RG+GL+K   IF DLKK++G P+LTDVHTE+QC AIA  VD+LQI
Sbjct: 57  KSSYDKANRTSLNATRGIGLEKAIAIFSDLKKEFGCPVLTDVHTEEQCMAIASVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGR+IN+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGY
Sbjct: 117 PAFLCRQTDLLVAAARTGRIINIKKGQFLAPWDMRNVLEKVTKSGNPNVMLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LV+DMRS+PIM S G PVIFDA+HSVQ+PG  GN SGG+R+++  LA+AAV+IG+AGI
Sbjct: 177 NRLVSDMRSLPIMRSFGAPVIFDATHSVQEPGGQGNSSGGQREFVEVLARAAVSIGVAGI 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           FLETHQDPDNAPSDG NMI I +L +LL  L+  D++ K
Sbjct: 237 FLETHQDPDNAPSDGLNMIKIDNLYRLLEILIDFDRLAK 275


>gi|319408345|emb|CBI81998.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella schoenbuchensis R1]
          Length = 277

 Score =  354 bits (908), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 177/279 (63%), Positives = 220/279 (78%), Gaps = 4/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   N ++ +G+    + FSN+    LIAGPCQ+ES DHAF IA +L AI   + IG VY
Sbjct: 1   MSKPNTSVKVGN----IVFSNDAPLSLIAGPCQMESRDHAFEIAGRLKAIADQIGIGFVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL   RG+GL+K   IF DLKK++GFPILTDVHTE+QCEA+A +VDILQI
Sbjct: 57  KSSYDKANRTSLNAARGIGLEKAMIIFSDLKKEFGFPILTDVHTEEQCEAVASTVDILQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRVIN+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGY
Sbjct: 117 PAFLCRQTDLLVAAAKTGRVINIKKGQFLAPWDMENVLKKITQSGNPNVMLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LV+DMRS+PIM S G PVIFDA+HSVQ+PG  G+ S G+RQ++  LA+AAVA+G+AG+
Sbjct: 177 NRLVSDMRSLPIMRSFGAPVIFDATHSVQEPGGKGDSSSGQRQFVEALARAAVAVGVAGV 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           FLETHQDPDNAPSDGPNMI I +L +LL  L+  D + K
Sbjct: 237 FLETHQDPDNAPSDGPNMIKIDNLQRLLEILMDFDCLAK 275


>gi|49474123|ref|YP_032165.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella quintana str.
           Toulouse]
 gi|59798259|sp|Q6G026|KDSA_BARQU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|49239627|emb|CAF25986.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella quintana str.
           Toulouse]
          Length = 278

 Score =  353 bits (905), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 167/279 (59%), Positives = 213/279 (76%), Gaps = 4/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   N  + +G+    + FSNE  F LI GPCQ+ES DHAF +A ++  I   + IG VY
Sbjct: 1   MFQPNTIVKVGN----IVFSNETPFSLIVGPCQMESRDHAFEMAGRIKTITDQIGIGFVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL   RG+GL+K   IF D+KK++G P+LTDVHTE+QC A+   VD+LQI
Sbjct: 57  KSSYDKANRTSLGAARGIGLEKAMAIFSDIKKEFGCPVLTDVHTEEQCAAVGSVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRVIN+KKGQFL+PW+M N+L+K+   G   V+ CERGTSFGY
Sbjct: 117 PAFLCRQTDLLVAAAKTGRVINIKKGQFLAPWDMENVLKKVTQSGNPHVMLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N L++DMRS+PI+ S G PVIFDA+HSVQ+PG  G+ SGG+RQ++  LA+AAV++G+AGI
Sbjct: 177 NRLISDMRSLPILRSFGAPVIFDATHSVQEPGGQGDSSGGQRQFVEVLARAAVSVGVAGI 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           FLETHQDPDNAPSDGPNM+ I  L +LL  L+  D + K
Sbjct: 237 FLETHQDPDNAPSDGPNMVKIDHLQRLLETLMEFDYLSK 275


>gi|121602682|ref|YP_988846.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella bacilliformis
           KC583]
 gi|158513077|sp|A1US93|KDSA_BARBK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|120614859|gb|ABM45460.1| 3-deoxy-8-phosphooctulonate synthase [Bartonella bacilliformis
           KC583]
          Length = 282

 Score =  352 bits (903), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 173/279 (62%), Positives = 218/279 (78%), Gaps = 4/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   N ++ +G+    V FSN+    LI GPCQIES DHAF +A ++ AI     IG VY
Sbjct: 1   MSQPNVSVKVGN----VVFSNKAPLSLIVGPCQIESRDHAFEMAGRIKAIADQAGIGFVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL+  RG+GL+K   IF DLKK++GFPILTDVHTE+QC A++  VD+LQI
Sbjct: 57  KSSYDKANRTSLSAARGIGLEKAIAIFADLKKEFGFPILTDVHTEEQCRAVSSVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG VIN+KKGQFL+PW+M N+L+K+   G  DV+ CERGTSFGY
Sbjct: 117 PAFLCRQTDLLVAAAKTGCVINIKKGQFLAPWDMENVLKKVTQSGNPDVMLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LV+DMRS+PIM+S G PVIFDA+HSVQ+PG  G+ SGG+RQ++  LA+AAVA+G+AGI
Sbjct: 177 NRLVSDMRSLPIMSSFGAPVIFDATHSVQEPGGKGDSSGGQRQFVEILARAAVAVGVAGI 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           FLETHQDPDNAPSDG NMI I +L +L+  L+  D++ K
Sbjct: 237 FLETHQDPDNAPSDGANMIEIDNLQRLIEILMNFDRLTK 275


>gi|163868052|ref|YP_001609256.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella tribocorum
           CIP 105476]
 gi|189028406|sp|A9IS46|KDSA_BART1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|161017703|emb|CAK01261.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella tribocorum CIP 105476]
          Length = 278

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 168/281 (59%), Positives = 216/281 (76%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   NA + +G+    + FSNE    LIAGPCQ+ES DHAF +A ++  +   L IG VY
Sbjct: 1   MTKPNARVKVGN----IIFSNEMPLSLIAGPCQMESRDHAFEMAGRIKTMTDQLGIGFVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL+  RG+GL+K   IF DLKK++  PILTDVHTE+QC  ++ +VDILQI
Sbjct: 57  KSSYDKANRTSLSAARGIGLEKAMAIFSDLKKEFDCPILTDVHTEEQCTIVSSTVDILQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG V+N+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGY
Sbjct: 117 PAFLCRQTDLLVAAAKTGCVVNIKKGQFLAPWDMENVLKKVVHSGNPNVMLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N L++DMRS+PI+ S G PVIFDA+HSVQ+PG  G  SGG+RQ++  LA+AAV++G+AGI
Sbjct: 177 NRLISDMRSLPILRSFGAPVIFDATHSVQEPGGQGASSGGQRQFVEVLARAAVSVGVAGI 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           FLETHQDPD+APSDGPNMI I DL +L+  L+  D + K L
Sbjct: 237 FLETHQDPDHAPSDGPNMIKIDDLQRLIETLMEFDDLSKKL 277


>gi|319898759|ref|YP_004158852.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella clarridgeiae 73]
 gi|319402723|emb|CBI76270.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella clarridgeiae 73]
          Length = 278

 Score =  349 bits (895), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 173/279 (62%), Positives = 217/279 (77%), Gaps = 4/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   NA + +G+    V FSNE    LIAGPCQ+ES DHAF +A ++  I     IG VY
Sbjct: 1   MFKPNATVKVGN----VFFSNEAPLSLIAGPCQMESRDHAFEMAGRIKTIADQFGIGFVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL+  RG+GL+K   IF DLK+++G P+LTDVHTE+QC A+A +VDILQI
Sbjct: 57  KSSYDKANRTSLSAIRGIGLEKAIAIFSDLKEEFGCPVLTDVHTEEQCMAVASAVDILQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRVIN+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGY
Sbjct: 117 PAFLCRQTDLLIAAAKTGRVINIKKGQFLAPWDMENVLKKVTQSGNPNVMLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LV+DMRS+PIM S G P+IFDA+HSVQ+PG  G+ SGG+RQ++  LA+AAV+IG+AGI
Sbjct: 177 NRLVSDMRSLPIMRSFGAPIIFDATHSVQEPGGRGSSSGGQRQFVEILARAAVSIGVAGI 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           FLETHQDPDNAPSDG NMI I +L +LL  L+  D + K
Sbjct: 237 FLETHQDPDNAPSDGLNMIKIDNLYRLLETLIDFDCLAK 275


>gi|240850257|ref|YP_002971650.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella grahamii
           as4aup]
 gi|240267380|gb|ACS50968.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella grahamii
           as4aup]
          Length = 278

 Score =  348 bits (893), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 167/281 (59%), Positives = 214/281 (76%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   NA + +G+    + FSNE    LIAGPCQ+ES DHAF +A ++  I   L IG VY
Sbjct: 1   MAKPNACVKVGN----IIFSNEMPLSLIAGPCQMESRDHAFEMAGRIKTITDQLGIGFVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL   RG+GL+K   +F DLKK++  PILTDVHTE+QC  ++ +VDILQI
Sbjct: 57  KSSYDKANRTSLGAARGIGLEKAMAVFSDLKKEFDCPILTDVHTEEQCTIVSSTVDILQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+T  VIN+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGY
Sbjct: 117 PAFLCRQTDLLVAAAKTECVINIKKGQFLAPWDMENVLKKVVYSGNPNVMLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N L++DMRS+PI+ S G PVIFDA+HSVQ+PG  G  SGG+RQ++  LA+AAV++G+AGI
Sbjct: 177 NRLISDMRSLPILRSFGAPVIFDATHSVQEPGGQGASSGGQRQFVEVLARAAVSVGVAGI 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           FLETHQDPDNAPSDGPNM+ + +L +LL  L+  D + K L
Sbjct: 237 FLETHQDPDNAPSDGPNMVKLDNLQRLLETLMEFDYLSKKL 277


>gi|153009385|ref|YP_001370600.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ochrobactrum anthropi
           ATCC 49188]
 gi|166220452|sp|A6X0L7|KDSA_OCHA4 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|151561273|gb|ABS14771.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ochrobactrum anthropi
           ATCC 49188]
          Length = 277

 Score =  347 bits (890), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 173/281 (61%), Positives = 223/281 (79%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   N+++ +G+    VTFSN   F LIAGPCQ+E+ +HAF +A +L  +   L I LVY
Sbjct: 1   MATANSSVKIGN----VTFSNSAPFALIAGPCQMETREHAFDMAGRLKEMTDKLGIDLVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL  +RG+GL+K  E+F DLKK++GFP+LTD+HTE+QC A+A  VD+LQI
Sbjct: 57  KSSFDKANRTSLKAERGIGLEKAMEVFADLKKEFGFPVLTDIHTEEQCAAVAPVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLSKITESGNPNVLATERGVSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMRS+PIM  +G PV+FDA+HSVQQPG HG  SGG+R+++  LA+AAVA+G+AG+
Sbjct: 177 NTLVSDMRSLPIMAGLGSPVVFDATHSVQQPGGHGGSSGGQREFVETLARAAVAVGVAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F+ETHQDPDNAPSDGPNM+ +  +P LL +L+A D+I K L
Sbjct: 237 FIETHQDPDNAPSDGPNMVPVDKMPALLEKLMAFDRIAKGL 277


>gi|222148553|ref|YP_002549510.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Agrobacterium vitis S4]
 gi|221735539|gb|ACM36502.1| 3-deoxy-8-phosphooctulonate synthase [Agrobacterium vitis S4]
          Length = 284

 Score =  347 bits (890), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 219/275 (79%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           NA + +G G   V+FSN  +  LI GPCQ+ES +HAFM+A  +  IC  L IGLVYKSSF
Sbjct: 8   NATVTIGEGAKTVSFSNSAKISLICGPCQMESREHAFMMAGGIKEICDKLGIGLVYKSSF 67

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANR+SL   RG+G+++G  IF DLKK++GFP+LTD+H E QC  +A+ VD+LQIPA L
Sbjct: 68  DKANRTSLKAGRGIGIEQGLAIFADLKKEFGFPVLTDIHNEDQCAEVAEVVDVLQIPAFL 127

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
           CRQTDLL AAA+TGR INVKKGQFL+PW+M N+++K+   G  +V+ CERG SFGYNTLV
Sbjct: 128 CRQTDLLIAAAKTGRAINVKKGQFLAPWDMKNVMEKITLSGNPNVMLCERGASFGYNTLV 187

Query: 205 TDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET 264
           +DMRS+PIM  MG PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+F+E+
Sbjct: 188 SDMRSLPIMAGMGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGLFIES 247

Query: 265 HQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           HQDPDNAPSDGPNM+ +KDL +LL +LLA D + K
Sbjct: 248 HQDPDNAPSDGPNMVYLKDLERLLEKLLAFDAVTK 282


>gi|46201419|ref|ZP_00055079.2| COG2877: 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate
           synthase [Magnetospirillum magnetotacticum MS-1]
          Length = 282

 Score =  346 bits (888), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 196/265 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N V   N+   VLIAGPCQ+ES DHA   AE L  +     I L+YKSSFDKANR+SLAG
Sbjct: 11  NDVILGNDLPLVLIAGPCQMESRDHALECAEALKTVASEAGISLIYKSSFDKANRTSLAG 70

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           +RGVGL K   IF ++K K+G P+LTDVHTE+QC   A +VD+LQIPA LCRQTDLL AA
Sbjct: 71  RRGVGLDKALPIFAEIKAKFGLPVLTDVHTEEQCVIAAKAVDVLQIPAFLCRQTDLLVAA 130

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG VINVKKGQFL+PW+M N+  K+ + G   +L  ERG SFGYNTLVTDMR +PIM 
Sbjct: 131 GRTGAVINVKKGQFLAPWDMANVAAKIESTGNSRILLTERGASFGYNTLVTDMRGLPIMG 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVI DA+H+VQ PG  GN SGG+R++   LA+AAVAIG+AG+F+E H DPD+APSD
Sbjct: 191 KTGWPVIMDATHAVQSPGGQGNSSGGDRRFAPVLARAAVAIGVAGVFIECHPDPDHAPSD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNMI +KD+P L+  L+ +D   K
Sbjct: 251 GPNMIALKDMPALVDVLMKLDATAK 275


>gi|319405525|emb|CBI79144.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella sp. AR 15-3]
          Length = 278

 Score =  345 bits (884), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 171/279 (61%), Positives = 216/279 (77%), Gaps = 4/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M  ++  + +G+    V FSNE    LIAGPCQ+ES DHAF +A ++  I   L IG VY
Sbjct: 1   MFKSDITVKVGN----VVFSNEAPLSLIAGPCQMESRDHAFEMAGRIKTITDQLGIGFVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL   RG+GL+K   IF DLKK++G P+LTDVHTE+QC  +A  VD+LQI
Sbjct: 57  KSSYDKANRTSLNATRGIGLEKAIAIFSDLKKEFGCPVLTDVHTEEQCMRVASVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL +AA+TG VIN+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGY
Sbjct: 117 PAFLCRQTDLLVSAARTGCVINIKKGQFLAPWDMENVLEKVTKSGNPNVMLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LV+DMRS+PIM S GVPVIFDA+HSVQ+PG  G+ SGG+RQ++  LA+AAV+IG+AGI
Sbjct: 177 NHLVSDMRSLPIMRSFGVPVIFDATHSVQEPGGRGSSSGGQRQFVEVLARAAVSIGVAGI 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           FLETHQDPDNAPSDG NMI I +L +LL  L+  D++ K
Sbjct: 237 FLETHQDPDNAPSDGLNMIKIDNLYRLLEILIDFDRLAK 275


>gi|58040706|ref|YP_192670.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconobacter oxydans
           621H]
 gi|58003120|gb|AAW62014.1| 2-Dehydro-3-deoxyphosphooctonate aldolase [Gluconobacter oxydans
           621H]
          Length = 274

 Score =  343 bits (879), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 204/263 (77%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T   +Q F LIAGPCQIES +HA  +A+ + ++C+ L IGL+YKSSFDKANRSS+   R
Sbjct: 8   LTVGQDQPFTLIAGPCQIESREHATEMADAISSLCRELGIGLIYKSSFDKANRSSVNAAR 67

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           GVG+  G +I   +++++G P+LTDVHT +QC   A +VD+LQIPA LCRQTDLL AA +
Sbjct: 68  GVGMDAGLDILASIRERFGVPVLTDVHTAEQCAPAAQAVDVLQIPAFLCRQTDLLLAAGK 127

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGR IN+KKGQFL+PW+M N+  K+ + G + ++ C+RGTSFGYNTLV+DMR +PIM   
Sbjct: 128 TGRAINIKKGQFLAPWDMANVAAKIASTGNERIMLCDRGTSFGYNTLVSDMRGLPIMAQT 187

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQQPG  G  +GG+R+++ PLA+AA++IG+A +F+ETHQDPD+APSDGP
Sbjct: 188 GYPVVFDATHSVQQPGGLGASTGGQREFVEPLARAALSIGVAAVFIETHQDPDHAPSDGP 247

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
            M+ + ++  LL++L A D + K
Sbjct: 248 TMVPLSEMSGLLTRLKAFDALAK 270


>gi|17987133|ref|NP_539767.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis bv.
           1 str. 16M]
 gi|148559559|ref|YP_001259055.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ovis ATCC
           25840]
 gi|225627603|ref|ZP_03785640.1| 3-deoxy-8-phosphooctulonate synthase [Brucella ceti str. Cudo]
 gi|225852633|ref|YP_002732866.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis ATCC
           23457]
 gi|254689359|ref|ZP_05152613.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus bv. 6
           str. 870]
 gi|254701876|ref|ZP_05163704.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella suis bv. 5 str.
           513]
 gi|254706682|ref|ZP_05168510.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella pinnipedialis
           M163/99/10]
 gi|254710210|ref|ZP_05172021.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella pinnipedialis
           B2/94]
 gi|254714207|ref|ZP_05176018.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ceti M644/93/1]
 gi|254719196|ref|ZP_05181007.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella sp. 83/13]
 gi|256031704|ref|ZP_05445318.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella pinnipedialis
           M292/94/1]
 gi|256044790|ref|ZP_05447694.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis bv.
           1 str. Rev.1]
 gi|256159863|ref|ZP_05457592.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ceti M490/95/1]
 gi|256255105|ref|ZP_05460641.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ceti B1/94]
 gi|256257605|ref|ZP_05463141.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus bv. 9
           str. C68]
 gi|256263874|ref|ZP_05466406.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis bv.
           2 str. 63/9]
 gi|256369559|ref|YP_003107069.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella microti CCM
           4915]
 gi|260168836|ref|ZP_05755647.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella sp. F5/99]
 gi|260565607|ref|ZP_05836091.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis bv.
           1 str. 16M]
 gi|260754876|ref|ZP_05867224.1| KDO-8-phosphate synthetase [Brucella abortus bv. 6 str. 870]
 gi|260883888|ref|ZP_05895502.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus bv. 9
           str. C68]
 gi|261222300|ref|ZP_05936581.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ceti B1/94]
 gi|261314143|ref|ZP_05953340.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella pinnipedialis
           M163/99/10]
 gi|261317768|ref|ZP_05956965.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella pinnipedialis
           B2/94]
 gi|261321977|ref|ZP_05961174.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ceti M644/93/1]
 gi|261752439|ref|ZP_05996148.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella suis bv. 5 str.
           513]
 gi|261758324|ref|ZP_06002033.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella sp. F5/99]
 gi|265984193|ref|ZP_06096928.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella sp. 83/13]
 gi|265988799|ref|ZP_06101356.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella pinnipedialis
           M292/94/1]
 gi|265991214|ref|ZP_06103771.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis bv.
           1 str. Rev.1]
 gi|265998264|ref|ZP_06110821.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ceti M490/95/1]
 gi|294852473|ref|ZP_06793146.1| 3-deoxy-8-phosphooctulonate synthase [Brucella sp. NVSL 07-0026]
 gi|297248447|ref|ZP_06932165.1| 3-deoxy-8-phosphooctulonate synthase [Brucella abortus bv. 5 str.
           B3196]
 gi|306838189|ref|ZP_07471045.1| 3-deoxy-8-phosphooctulonate synthase [Brucella sp. NF 2653]
 gi|20532106|sp|Q8YHF1|KDSA_BRUME RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|158513785|sp|A5VQQ8|KDSA_BRUO2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|254807736|sp|C0RJA4|KDSA_BRUMB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|17982797|gb|AAL52031.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis bv.
           1 str. 16M]
 gi|148370816|gb|ABQ60795.1| 3-deoxy-8-phosphooctulonate synthase [Brucella ovis ATCC 25840]
 gi|225617608|gb|EEH14653.1| 3-deoxy-8-phosphooctulonate synthase [Brucella ceti str. Cudo]
 gi|225640998|gb|ACO00912.1| 3-deoxy-8-phosphooctulonate synthase [Brucella melitensis ATCC
           23457]
 gi|255999721|gb|ACU48120.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella microti CCM
           4915]
 gi|260151675|gb|EEW86769.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis bv.
           1 str. 16M]
 gi|260674984|gb|EEX61805.1| KDO-8-phosphate synthetase [Brucella abortus bv. 6 str. 870]
 gi|260873416|gb|EEX80485.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus bv. 9
           str. C68]
 gi|260920884|gb|EEX87537.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ceti B1/94]
 gi|261294667|gb|EEX98163.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ceti M644/93/1]
 gi|261296991|gb|EEY00488.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella pinnipedialis
           B2/94]
 gi|261303169|gb|EEY06666.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella pinnipedialis
           M163/99/10]
 gi|261738308|gb|EEY26304.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella sp. F5/99]
 gi|261742192|gb|EEY30118.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella suis bv. 5 str.
           513]
 gi|262552732|gb|EEZ08722.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ceti M490/95/1]
 gi|263001998|gb|EEZ14573.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis bv.
           1 str. Rev.1]
 gi|263094005|gb|EEZ17939.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis bv.
           2 str. 63/9]
 gi|264660996|gb|EEZ31257.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella pinnipedialis
           M292/94/1]
 gi|264662785|gb|EEZ33046.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella sp. 83/13]
 gi|294821062|gb|EFG38061.1| 3-deoxy-8-phosphooctulonate synthase [Brucella sp. NVSL 07-0026]
 gi|297175616|gb|EFH34963.1| 3-deoxy-8-phosphooctulonate synthase [Brucella abortus bv. 5 str.
           B3196]
 gi|306406779|gb|EFM63002.1| 3-deoxy-8-phosphooctulonate synthase [Brucella sp. NF 2653]
 gi|326409152|gb|ADZ66217.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis M28]
 gi|326538861|gb|ADZ87076.1| 3-deoxy-8-phosphooctulonate synthase [Brucella melitensis M5-90]
          Length = 277

 Score =  342 bits (877), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 173/281 (61%), Positives = 221/281 (78%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M+  N+ + +G+    VTFSN     LIAGPCQ+E+ DHAF +A +L  +   L IGLVY
Sbjct: 1   MVTANSTVKVGN----VTFSNSAPLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL   RG+GL+K  E+F DLKK+YGFP+LTD+HTE+QC A+A  VD+LQI
Sbjct: 57  KSSFDKANRTSLKAARGIGLEKALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLAKITESGNPNVLATERGVSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMR++PIM  +G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+
Sbjct: 177 NTLVSDMRALPIMAGLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F+ETH+DPDNAPSDGPNM+ I  +P LL +L+A D+I K L
Sbjct: 237 FIETHEDPDNAPSDGPNMVPIDKMPALLEKLMAFDRIAKAL 277


>gi|221046939|pdb|3FS2|A Chain A, Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctonate
           Aldolase From Bruciella Melitensis At 1.85a Resolution
 gi|221046940|pdb|3FS2|B Chain B, Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctonate
           Aldolase From Bruciella Melitensis At 1.85a Resolution
          Length = 298

 Score =  341 bits (875), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 173/281 (61%), Positives = 220/281 (78%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M+  N+ + +G+    VTFSN     LIAGPCQ+E+ DHAF +A +L  +   L IGLVY
Sbjct: 22  MVTANSTVKVGN----VTFSNSAPLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVY 77

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL   RG+GL+K  E+F DLKK+YGFP+LTD+HTE+QC A+A  VD+LQI
Sbjct: 78  KSSFDKANRTSLKAARGIGLEKALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQI 137

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGY
Sbjct: 138 PAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLAKITESGNPNVLATERGVSFGY 197

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMR++PIM  +G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG 
Sbjct: 198 NTLVSDMRALPIMAGLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGF 257

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F+ETH+DPDNAPSDGPNM+ I  +P LL +L+A D+I K L
Sbjct: 258 FIETHEDPDNAPSDGPNMVPIDKMPALLEKLMAFDRIAKAL 298


>gi|62290046|ref|YP_221839.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus bv. 1
           str. 9-941]
 gi|82699973|ref|YP_414547.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis
           biovar Abortus 2308]
 gi|189024287|ref|YP_001935055.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus S19]
 gi|237815556|ref|ZP_04594553.1| 3-deoxy-8-phosphooctulonate synthase [Brucella abortus str. 2308 A]
 gi|254697492|ref|ZP_05159320.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254730389|ref|ZP_05188967.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus bv. 4
           str. 292]
 gi|260546599|ref|ZP_05822338.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus NCTC
           8038]
 gi|260758093|ref|ZP_05870441.1| KDO-8-phosphate synthetase [Brucella abortus bv. 4 str. 292]
 gi|260761917|ref|ZP_05874260.1| KDO-8-phosphate synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|75496751|sp|Q57D06|KDSA_BRUAB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|123754542|sp|Q2YPU9|KDSA_BRUA2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238689373|sp|B2S5Y4|KDSA_BRUA1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|62196178|gb|AAX74478.1| KdsA, 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus
           bv. 1 str. 9-941]
 gi|82616074|emb|CAJ11112.1| DAHP synthetase I/KDSA superfamily:2-dehydro-3-deoxyphosphooctonate
           aldolase [Brucella melitensis biovar Abortus 2308]
 gi|189019859|gb|ACD72581.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus S19]
 gi|237788854|gb|EEP63065.1| 3-deoxy-8-phosphooctulonate synthase [Brucella abortus str. 2308 A]
 gi|260095649|gb|EEW79526.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus NCTC
           8038]
 gi|260668411|gb|EEX55351.1| KDO-8-phosphate synthetase [Brucella abortus bv. 4 str. 292]
 gi|260672349|gb|EEX59170.1| KDO-8-phosphate synthetase [Brucella abortus bv. 2 str. 86/8/59]
          Length = 277

 Score =  341 bits (875), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 173/281 (61%), Positives = 220/281 (78%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M+  N+ + +G+    VTFSN     LIAGPCQ+E+ DHAF +A +L  +   L IGLVY
Sbjct: 1   MVTANSTVKVGN----VTFSNSAPLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL   RG+GL+K  E+F DLKK+YGFP+LTD+HTE+QC A+A  VD+LQI
Sbjct: 57  KSSFDKANRTSLKAARGIGLEKALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLAKITESGNPNVLATERGVSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMR++PIM  +G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG 
Sbjct: 177 NTLVSDMRALPIMAGLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGF 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F+ETH+DPDNAPSDGPNM+ I  +P LL +L+A D+I K L
Sbjct: 237 FIETHEDPDNAPSDGPNMVPIDKMPALLEKLMAFDRIAKAL 277


>gi|306841858|ref|ZP_07474540.1| 3-deoxy-8-phosphooctulonate synthase [Brucella sp. BO2]
 gi|306843997|ref|ZP_07476592.1| 3-deoxy-8-phosphooctulonate synthase [Brucella sp. BO1]
 gi|306275752|gb|EFM57476.1| 3-deoxy-8-phosphooctulonate synthase [Brucella sp. BO1]
 gi|306288085|gb|EFM59482.1| 3-deoxy-8-phosphooctulonate synthase [Brucella sp. BO2]
          Length = 277

 Score =  341 bits (874), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 173/281 (61%), Positives = 221/281 (78%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M+  N+ + +G+    VTFSN     LIAGPCQ+E+ DHAF +A +L  +   L IGLVY
Sbjct: 1   MVTANSTVKVGN----VTFSNSAPLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL   RG+GL+K  E+F DLKK+YGFP+LTD+HTE+QC A+A  VD+LQI
Sbjct: 57  KSSFDKANRTSLKAARGIGLEKALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLAKITESGNPNVLATERGVSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMR++PIM  +G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+
Sbjct: 177 NTLVSDMRALPIMAGLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F+ETH+DPDNAPSDGPNM+ I  +P LL +L+A D+I K L
Sbjct: 237 FIETHEDPDNAPSDGPNMVPIDKMPVLLEKLMAFDRIAKAL 277


>gi|256061217|ref|ZP_05451368.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella neotomae 5K33]
 gi|261325224|ref|ZP_05964421.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella neotomae 5K33]
 gi|261301204|gb|EEY04701.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella neotomae 5K33]
          Length = 277

 Score =  340 bits (873), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 172/281 (61%), Positives = 220/281 (78%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M+  N+ + +G+    VTFSN     LIAGPCQ+E+ DHAF +A +L  +   L IGLVY
Sbjct: 1   MVTANSTVKVGN----VTFSNSAPLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL   RG+GL+K  E+F DLKK+YGFP+LTD+HTE+QC A+A  VD+LQI
Sbjct: 57  KSSFDKANRTSLKAARGIGLEKALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLAKITESGNPNVLATERGVSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMR++PIM  +G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+
Sbjct: 177 NTLVSDMRALPIMAGLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F+ETH+DPDNAPSDGPNM+ I  +P  L +L+A D+I K L
Sbjct: 237 FIETHEDPDNAPSDGPNMVPIDKMPAFLEKLMAFDRIAKAL 277


>gi|254693843|ref|ZP_05155671.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella abortus bv. 3
           str. Tulya]
 gi|261214127|ref|ZP_05928408.1| KDO-8-phosphate synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|260915734|gb|EEX82595.1| KDO-8-phosphate synthetase [Brucella abortus bv. 3 str. Tulya]
          Length = 277

 Score =  340 bits (873), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 173/281 (61%), Positives = 220/281 (78%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M+  N+ + +G+    VTFSN     LIAGPCQ+E  DHAF +A +L  +   L IGLVY
Sbjct: 1   MVTANSTVKVGN----VTFSNSAPLALIAGPCQMEMRDHAFEMAGRLKEMTDKLGIGLVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL   RG+GL+K  E+F DLKK+YGFP+LTD+HTE+QC A+A  VD+LQI
Sbjct: 57  KSSFDKANRTSLKAARGIGLEKALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLAKITESGNPNVLATERGVSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMR++PIM  +G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+
Sbjct: 177 NTLVSDMRALPIMAGLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F+ETH+DPDNAPSDGPNM+ I  +P LL +L+A D+I K L
Sbjct: 237 FIETHEDPDNAPSDGPNMVPIDKMPALLEKLMAFDRIAKAL 277


>gi|23502011|ref|NP_698138.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella suis 1330]
 gi|161619085|ref|YP_001592972.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella canis ATCC
           23365]
 gi|163843400|ref|YP_001627804.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella suis ATCC
           23445]
 gi|254704422|ref|ZP_05166250.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella suis bv. 3 str.
           686]
 gi|260566331|ref|ZP_05836801.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella suis bv. 4 str.
           40]
 gi|261755099|ref|ZP_05998808.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella suis bv. 3 str.
           686]
 gi|32171477|sp|Q8G0G2|KDSA_BRUSU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|189028407|sp|A9M5E6|KDSA_BRUC2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|189028408|sp|B0CGT3|KDSA_BRUSI RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|23347963|gb|AAN30053.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella suis 1330]
 gi|161335896|gb|ABX62201.1| 3-deoxy-8-phosphooctulonate synthase [Brucella canis ATCC 23365]
 gi|163674123|gb|ABY38234.1| 3-deoxy-8-phosphooctulonate synthase [Brucella suis ATCC 23445]
 gi|260155849|gb|EEW90929.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella suis bv. 4 str.
           40]
 gi|261744852|gb|EEY32778.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella suis bv. 3 str.
           686]
          Length = 277

 Score =  340 bits (871), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 173/281 (61%), Positives = 220/281 (78%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M+  N+ + +G+    VTFSN     LIAGPCQ+E+ DHAF +A  L  +   L IGLVY
Sbjct: 1   MVTANSTVKVGN----VTFSNSAPLALIAGPCQMETRDHAFEMAGHLKEMTDKLGIGLVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL   RG+GL+K  E+F DLKK+YGFP+LTD+HTE+QC A+A  VD+LQI
Sbjct: 57  KSSFDKANRTSLKAARGIGLEKALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLAKITESGNPNVLATERGVSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMR++PIM  +G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+
Sbjct: 177 NTLVSDMRALPIMAGLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F+ETH+DPDNAPSDGPNM+ I  +P LL +L+A D+I K L
Sbjct: 237 FIETHEDPDNAPSDGPNMVPIDKMPALLEKLMAFDRIAKAL 277


>gi|256113696|ref|ZP_05454500.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis bv.
           3 str. Ether]
 gi|265995050|ref|ZP_06107607.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis bv.
           3 str. Ether]
 gi|262766163|gb|EEZ11952.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella melitensis bv.
           3 str. Ether]
          Length = 277

 Score =  339 bits (870), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 172/281 (61%), Positives = 220/281 (78%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M+  N+ + +G+    VTFSN     LIAGPCQ+E+ DHAF +A +L  +   L IGLVY
Sbjct: 1   MVTANSTVKVGN----VTFSNSAPLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL   RG+GL+K  E+F DLKK+YGFP+LTD+HTE+QC A+A  VD+LQI
Sbjct: 57  KSSFDKANRTSLKAARGIGLEKALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLAKITESGNPNVLATERGVSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMR++P M  +G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+
Sbjct: 177 NTLVSDMRALPSMAGLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F+ETH+DPDNAPSDGPNM+ I  +P LL +L+A D+I K L
Sbjct: 237 FIETHEDPDNAPSDGPNMVPIDKMPALLEKLMAFDRIAKAL 277


>gi|83310921|ref|YP_421185.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Magnetospirillum
           magneticum AMB-1]
 gi|82945762|dbj|BAE50626.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthase
           [Magnetospirillum magneticum AMB-1]
          Length = 283

 Score =  339 bits (869), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 193/265 (72%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           + V   N+   VLIAGPCQ+ES DHA   AE L  +     I L+YKSSFDKANR+SLAG
Sbjct: 12  DDVILGNDLPLVLIAGPCQMESRDHAMECAEALKIMAAEAGIALIYKSSFDKANRTSLAG 71

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           +RGVGL K   IF ++K K G P+LTDVHTE+QC   A   D+LQIPA LCRQTDLL AA
Sbjct: 72  QRGVGLDKALPIFAEIKAKLGLPVLTDVHTEEQCVIAAKVADVLQIPAFLCRQTDLLVAA 131

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG VINVKKGQFL+PW+M N+  K+ + G   VL  ERG SFGYNTLVTDMR +PIM 
Sbjct: 132 GRTGAVINVKKGQFLAPWDMANVAAKIESTGNSRVLLTERGASFGYNTLVTDMRGLPIMA 191

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVI DA+H+VQ PG  GN SGG+R++   LA+AAVAIG+AG+F+E H DPD+APSD
Sbjct: 192 RTGWPVIMDATHAVQAPGGQGNSSGGDRRFAPVLARAAVAIGVAGVFVECHPDPDHAPSD 251

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNMI +KD+P L+  L+ +D   K
Sbjct: 252 GPNMIAMKDMPALVEVLMKLDATAK 276


>gi|34580951|ref|ZP_00142431.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia sibirica 246]
 gi|28262336|gb|EAA25840.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia sibirica 246]
          Length = 274

 Score =  338 bits (867), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 197/265 (74%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLI GPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG++KG EI   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGVGIEKGLEILSKVKSEFDCPIVTDVHSESQCTETAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G+ +GGER+Y+  LAKAA ++GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGSSTGGERKYVELLAKAATSVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP M+ + +L  +L +L   DKI K
Sbjct: 248 GPCMMKLDNLESILIKLKKYDKITK 272


>gi|157803247|ref|YP_001491796.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia canadensis
           str. McKiel]
 gi|166220456|sp|A8EXC8|KDSA_RICCK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|157784510|gb|ABV73011.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia canadensis
           str. McKiel]
          Length = 274

 Score =  337 bits (865), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 155/263 (58%), Positives = 199/263 (75%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +   N+  F+LIAGPCQIE  DHA  +AEKL  +   L+I  +YKSSFDKANR+S+ G R
Sbjct: 10  IKIGNDLPFILIAGPCQIEGQDHALFMAEKLVKLTSKLDIPFIYKSSFDKANRTSINGVR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G++KG E+   +K ++  PI+TDVH+E QC   A  VDILQIPA LCRQTDLL AAA+
Sbjct: 70  GLGIEKGLEVLSKVKAEFDCPIVTDVHSESQCTETARVVDILQIPAFLCRQTDLLQAAAK 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+++ VKKGQFL+PW+M N+  KL A GA+++LF ERGT FGYN LV+DMRS+ IM  +
Sbjct: 130 TGKIVKVKKGQFLAPWDMKNVQTKLKAFGAENILFTERGTCFGYNNLVSDMRSLAIMAKL 189

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPVIFDA+HSVQQPG  G+ +GGER+Y+  LAKAA  +GIAG+++E HQDPDNAPSDGP
Sbjct: 190 NVPVIFDATHSVQQPGGLGDSTGGERKYVELLAKAATTVGIAGMYMEVHQDPDNAPSDGP 249

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
            MI + +L  +L +L   DKI K
Sbjct: 250 CMIKLDNLESILIKLKKYDKITK 272


>gi|157964128|ref|YP_001498952.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia massiliae
           MTU5]
 gi|157843904|gb|ABV84405.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia massiliae MTU5]
          Length = 275

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 197/265 (74%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLI GPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 9   NNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHG 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G++KG EI   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 69  IRGLGIEKGLEILSKVKSEFDCPIVTDVHSESQCTETAEVADILQIPAFLCRQTDLLQAA 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 129 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDILFTERGACFGYNNLVSDMRSLAIMA 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G+ +GGER+Y+  LAKAA ++GIAG+++E HQDPDNAPSD
Sbjct: 189 ELNVPVVFDATHSVQQPGGLGSSTGGERKYVELLAKAATSVGIAGMYMEVHQDPDNAPSD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP M+ + +L  +L +L   DKI K
Sbjct: 249 GPCMMKLDNLESILIKLKKYDKITK 273


>gi|15603941|ref|NP_220456.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia prowazekii
           str. Madrid E]
 gi|6647572|sp|Q9ZE84|KDSA_RICPR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|3860632|emb|CAA14533.1| 2-DEHYDRO-3-DEOXYPHOSPHOOCTONATE ALDOLASE (kdsA) [Rickettsia
           prowazekii]
 gi|292571659|gb|ADE29574.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia prowazekii Rp22]
          Length = 275

 Score =  335 bits (858), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 159/267 (59%), Positives = 204/267 (76%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+ +FVLIAGPCQIE  DHA  +AEKL  +   L+I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLQFVLIAGPCQIEGKDHALFMAEKLMKLTSKLSIPFIYKSSFDKANRTSING 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G++KG EI   +K ++  PI+TDVH+E QC   A  VDILQIPA LCRQTDLL AA
Sbjct: 68  IRGLGIEKGLEILSKVKSEFDCPIITDVHSESQCIETAKVVDILQIPAFLCRQTDLLKAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+ +KL   GAKD+LF ERG+ FGYN LV+DMRS+ IM+
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQKKLEVFGAKDILFTERGSCFGYNNLVSDMRSLAIMS 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  SGGER+Y+  LAKAA+++GIAGI++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGRGGSSGGERKYVELLAKAAISVGIAGIYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GP MI + +L  +L +L   DKI K +
Sbjct: 248 GPCMIKLDNLESILIKLKKYDKITKEI 274


>gi|262277256|ref|ZP_06055049.1| 3-deoxy-8-phosphooctulonate synthase [alpha proteobacterium
           HIMB114]
 gi|262224359|gb|EEY74818.1| 3-deoxy-8-phosphooctulonate synthase [alpha proteobacterium
           HIMB114]
          Length = 276

 Score =  334 bits (857), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 199/265 (75%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N+   SN+  F LI+GPCQ+E+ DHA  +AE++  I   L I LVYK+SFDKANR+SL  
Sbjct: 8   NKFNVSNDLPFFLISGPCQLENRDHAMFMAEEIKKITDKLKINLVYKTSFDKANRTSLKS 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           +RG+GL K  ++F ++K+ +  PILTDVH+ +QC  + + VDI+QIPA LCRQTDLL +A
Sbjct: 68  ERGIGLDKSIKVFEEIKRNFNLPILTDVHSPEQCNQVKNVVDIIQIPAFLCRQTDLLVSA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  ++N+KKGQFL+PW+M N+++K+      ++L  ERG SFGYNTLV+DMRSI I+ 
Sbjct: 128 AKTNLIVNIKKGQFLAPWDMKNVIKKISDSNNDNILVTERGVSFGYNTLVSDMRSISILK 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PVIFDA+HSVQQPG  G+ SGGER++I  L+KAA+A+G+AG+FLE H DPDNAPSD
Sbjct: 188 KEQYPVIFDATHSVQQPGGKGDSSGGEREFIYDLSKAAIAVGVAGLFLEVHDDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ + DL   L+ +  ID ++K
Sbjct: 248 GPNMLKLSDLENFLNNIKKIDDLVK 272


>gi|51473281|ref|YP_067038.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia typhi str.
           Wilmington]
 gi|59798219|sp|Q68XT6|KDSA_RICTY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|51459593|gb|AAU03556.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia typhi str.
           Wilmington]
          Length = 274

 Score =  334 bits (857), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 202/265 (76%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+ +FVLIAGPCQIE  DHA  +AEKL  +   L+I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLQFVLIAGPCQIEDEDHALFMAEKLIQLTSKLSIPFIYKSSFDKANRTSING 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G++KG EI   +K ++  PI+TDVH+E QC   A  VDILQIPA LCRQTDLL AA
Sbjct: 68  IRGLGIEKGLEILSKVKSEFNCPIITDVHSESQCTDTAKVVDILQIPAFLCRQTDLLKAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A GAKD+LF ERG+ FGYN L++DMRS+ IM+
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGAKDILFTERGSCFGYNNLISDMRSLAIMS 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  SGGER+Y+  LAKAA+++GIAGI++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGRGGSSGGERKYVELLAKAAISVGIAGIYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP MI +  L  +L +L   DKI K
Sbjct: 248 GPCMIKLDHLESILIKLKKYDKITK 272


>gi|330994539|ref|ZP_08318463.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter sp.
           SXCC-1]
 gi|329758393|gb|EGG74913.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter sp.
           SXCC-1]
          Length = 282

 Score =  333 bits (855), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 153/273 (56%), Positives = 200/273 (73%), Gaps = 4/273 (1%)

Query: 27  AIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDK 86
           A+ +GS    +T  N+  F LIAGPCQIES  HA  +A+ L+ I   L IGL+YKSSFDK
Sbjct: 6   ALSIGS----LTVGNQSPFTLIAGPCQIESASHAMEVADALHGIATRLGIGLIYKSSFDK 61

Query: 87  ANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCR 146
           ANR+S+ G RGVG+ +G +I   ++ ++G P+LTDVH   QC A+A++VD+LQIPA LCR
Sbjct: 62  ANRTSINGARGVGMAQGLDILGQVRARFGMPVLTDVHLPDQCAAVAETVDVLQIPAFLCR 121

Query: 147 QTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTD 206
           QTDLL AA QTG  IN+KKGQFL+PW+M N+  K+ + G + ++ CERGTSFGYNTLV D
Sbjct: 122 QTDLLLAAGQTGAAINIKKGQFLAPWDMANVAAKVASTGNERIMLCERGTSFGYNTLVND 181

Query: 207 MRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQ 266
           MR +PIM   G PVIFDA+HSVQQPG  G  SGG+R +   LA+AA+A+G+AG+F+ETH 
Sbjct: 182 MRGLPIMAGTGYPVIFDATHSVQQPGGLGTSSGGQRVFAPILARAALAVGVAGVFIETHP 241

Query: 267 DPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           DPD APSDG  M+ +  +  LL+ LL  D++ K
Sbjct: 242 DPDTAPSDGTTMLPLACMEDLLTTLLRYDRLTK 274


>gi|304391758|ref|ZP_07373700.1| 3-deoxy-8-phosphooctulonate synthase [Ahrensia sp. R2A130]
 gi|303295987|gb|EFL90345.1| 3-deoxy-8-phosphooctulonate synthase [Ahrensia sp. R2A130]
          Length = 280

 Score =  333 bits (853), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 165/281 (58%), Positives = 208/281 (74%), Gaps = 5/281 (1%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +   A++ +G     VTF+ +  F LIAGPCQ+E   HAF +A  +  IC  L IGLVYK
Sbjct: 4   VEPQASVKVG----DVTFAQDAPFSLIAGPCQMEGRQHAFDMAGGMKEICGKLGIGLVYK 59

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SSFDKANR+SL+  RG+GL+   EIF DLKK++G P +TDVHT +QC  +A  VD+LQIP
Sbjct: 60  SSFDKANRTSLSASRGIGLEASLEIFSDLKKEFGLPTVTDVHTAEQCALVAAHVDVLQIP 119

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A LCRQTDLL AAA+TG VINVKKGQFL+PW+M N+L KL   G  +VL  ERGTSFGYN
Sbjct: 120 AFLCRQTDLLVAAAETGAVINVKKGQFLAPWDMKNVLGKLTGAGNGNVLMTERGTSFGYN 179

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV D R +P M SMG PV+FDA+HSVQQPG  G  +GG+R+++  L++AAVA+G+AG+F
Sbjct: 180 TLVNDFRGLPEMASMGAPVVFDATHSVQQPGGQGGSTGGQREFVATLSRAAVAVGVAGLF 239

Query: 262 LETHQDPDN-APSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           +ETH DPDN   SDGPNM+ +  +P LL QL+A D+I K L
Sbjct: 240 IETHDDPDNTTSSDGPNMVPLDQMPALLEQLMAFDRIAKGL 280


>gi|328543848|ref|YP_004303957.1| 2-dehydro-3-deoxyphosphooctonate aldolase [polymorphum gilvum
           SL003B-26A1]
 gi|326413592|gb|ADZ70655.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polymorphum gilvum
           SL003B-26A1]
          Length = 347

 Score =  332 bits (851), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 167/294 (56%), Positives = 215/294 (73%), Gaps = 4/294 (1%)

Query: 6   PQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAE 65
           P++ +    R     M   ++ + +GS    V FSN+  F LIAGPCQ+ES  HA  +A 
Sbjct: 54  PRSPDAGCSRQGSLSMAQPSSTVPVGS----VFFSNDAPFSLIAGPCQMESRAHALEMAA 109

Query: 66  KLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTE 125
            +  I  SL IG+V+KSSFDKANR+SL G+RG+GL     +F +++   G P+LTDVH  
Sbjct: 110 AVKEIAGSLGIGVVFKSSFDKANRTSLNGRRGIGLVDALPVFAEIRDTLGLPVLTDVHAA 169

Query: 126 QQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHG 185
           +QC A+A+ VD+LQIPA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G
Sbjct: 170 EQCAAVAEVVDVLQIPAFLCRQTDLLVAAARTGRVVNVKKGQFLAPWDMKNVLAKVVESG 229

Query: 186 AKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYI 245
             +VL  ERG SFGYNTLVTDMR++PIM + G PVIFDA+HSVQQPG  G  +GG+R ++
Sbjct: 230 NPNVLLTERGVSFGYNTLVTDMRALPIMAATGAPVIFDATHSVQQPGGQGASTGGDRSFV 289

Query: 246 VPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
             LA+AAVA+G+AG+F+ETH DPDNAPSDGPNM+ +KDL  LL QL  ID +IK
Sbjct: 290 PVLARAAVAVGVAGLFIETHDDPDNAPSDGPNMVPLKDLAGLLRQLKDIDAVIK 343


>gi|157825218|ref|YP_001492938.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia akari str.
           Hartford]
 gi|166220454|sp|A8GM05|KDSA_RICAH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|157799176|gb|ABV74430.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia akari str.
           Hartford]
          Length = 274

 Score =  330 bits (845), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 199/265 (75%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLIAGPCQIE  DHA  +AEKL  +   L+I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLIAGPCQIEGKDHALFMAEKLVKLTSKLDIAFIYKSSFDKANRTSVNG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG++KG EI   +K ++  PI+TD+H+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGVGIEKGLEILSKVKSEFDCPIVTDIHSESQCTETAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLQAFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VP++FDA+HSVQQPG  G  +GG+R+Y+  LAKAA+A+GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPIVFDATHSVQQPGGLGGSTGGDRKYVELLAKAAIAVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP M+ + +L  +L +L   DKI K
Sbjct: 248 GPCMMKLDNLESILIKLKKYDKITK 272


>gi|110633985|ref|YP_674193.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Mesorhizobium sp. BNC1]
 gi|123162317|sp|Q11HU7|KDSA_MESSB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|110284969|gb|ABG63028.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Chelativorans sp. BNC1]
          Length = 276

 Score =  328 bits (842), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 211/264 (79%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
           Q  F+N+    LIAGPCQ+ES +HAF +A +L  + + L +G VYK+SFDKANR+SL GK
Sbjct: 11  QAVFANDAPLALIAGPCQLESREHAFEMAGRLKEMAEKLGLGFVYKTSFDKANRTSLLGK 70

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL     IF DL+++ G P+LTDVHTE QCE +AD+VD+LQIPA LCRQTDLL AAA
Sbjct: 71  RGAGLDAALPIFADLRRELGVPVLTDVHTEGQCEILADAVDVLQIPAFLCRQTDLLVAAA 130

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+V+NVKKGQFL+PW+M N++ K+ A G  +VL  ERG SFGYNTLVTDMR++PIM  
Sbjct: 131 KTGKVVNVKKGQFLAPWDMKNVVAKITASGNPNVLTTERGVSFGYNTLVTDMRALPIMAE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           +G PVIFDA+HSVQQPG  G+ SGG+R+++  LA+AAVA+G+AG+F+ETHQDPDNAPSDG
Sbjct: 191 IGAPVIFDATHSVQQPGGQGSSSGGDRRFVETLARAAVAVGVAGVFIETHQDPDNAPSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +  +P LL +L+A D+I K
Sbjct: 251 PNMVQLDKMPALLERLMAFDRIAK 274


>gi|15892013|ref|NP_359727.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia conorii str.
           Malish 7]
 gi|20532118|sp|Q92JH7|KDSA_RICCN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|15619129|gb|AAL02628.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia conorii str.
           Malish 7]
          Length = 274

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 156/265 (58%), Positives = 196/265 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLI GPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG++KG EI   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGVGIEKGLEILSKVKSEFDCPIVTDVHSESQCTETAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  +GGER+Y+  LAKAA ++GIAGI++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLAKAATSVGIAGIYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP M+ + +L  +L +L   DKI K
Sbjct: 248 GPCMMKLDNLESILIKLKKYDKITK 272


>gi|90419618|ref|ZP_01227528.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336555|gb|EAS50296.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 278

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 158/268 (58%), Positives = 204/268 (76%), Gaps = 1/268 (0%)

Query: 32  SGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSS 91
           + +N V F N + F LIAGPCQ+ES DHA MIAEK+  I   L IG V+K+SFDKANR+S
Sbjct: 9   AARNTV-FDNYRPFALIAGPCQMESRDHAMMIAEKMKRITDDLGIGYVFKASFDKANRTS 67

Query: 92  LAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLL 151
           L G+RG+GL     +F ++ + +  P+LTDVHTE+QC       DILQIPA LCRQTDLL
Sbjct: 68  LQGRRGIGLADALPVFEEVARTFDLPVLTDVHTEEQCREAGTVCDILQIPAFLCRQTDLL 127

Query: 152 TAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIP 211
            AAA TGRV+N+KKGQFL+PW+M N+L K+   G  +VL  ERG SFGYNTLV+D R++P
Sbjct: 128 IAAAGTGRVVNIKKGQFLAPWDMSNVLAKVTESGNPNVLLTERGASFGYNTLVSDFRALP 187

Query: 212 IMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
           IM  MG PV+FDA+HSVQQPG  G  SGGER+++  L++AAVA+G+AG+F+ETH+DPDNA
Sbjct: 188 IMAGMGAPVVFDATHSVQQPGGQGGSSGGERRFVETLSRAAVAVGVAGLFIETHEDPDNA 247

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PSDGPNM+ +  +P+LL +L A+D + K
Sbjct: 248 PSDGPNMVPLDRMPELLKRLQALDAVAK 275


>gi|67458505|ref|YP_246129.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia felis
           URRWXCal2]
 gi|75537028|sp|Q4UN94|KDSA_RICFE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|67004038|gb|AAY60964.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia felis URRWXCal2]
          Length = 274

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 156/265 (58%), Positives = 197/265 (74%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLIAGPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLIAGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVNG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G++KG EI   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGLGIEKGLEILSKVKSEFDCPIVTDVHSESQCTETAEIADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ I+ 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDILFTERGACFGYNNLVSDMRSLAIIA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  +GGER+Y+  LAKAA A+GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLAKAATAVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP MI + +L  +L +L   DKI K
Sbjct: 248 GPCMIKLDNLESILIKLKKYDKITK 272


>gi|144898640|emb|CAM75504.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 281

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 149/271 (54%), Positives = 199/271 (73%), Gaps = 1/271 (0%)

Query: 29  HLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKAN 88
           H+  G+  V   N+   VLIAGPCQ+ES +HA   A  L  +C+   IGL+YKSSFDKAN
Sbjct: 5   HVAVGRTLV-LGNDLPLVLIAGPCQMESREHALECAGALKDMCEKAGIGLIYKSSFDKAN 63

Query: 89  RSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQT 148
           R+SL+G+RG+GL+    +F ++++  G P+LTD+H E+QC  +A +VD+LQIPA LCRQT
Sbjct: 64  RTSLSGRRGLGLEAALPVFAEIRESLGLPVLTDIHNEEQCIPVAKAVDVLQIPAFLCRQT 123

Query: 149 DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMR 208
           DLL AA +TG VINVKKGQFL+P +M N+  K+ + G   +L  ERG  FGY  LV DMR
Sbjct: 124 DLLVAAGRTGAVINVKKGQFLAPSQMANVAAKVESTGNSRILLTERGACFGYGDLVADMR 183

Query: 209 SIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP 268
           +IPIM S G PVI DA+H+VQ PG  G  SGG+R++   LA+AAV++G+AG+F+ETH DP
Sbjct: 184 AIPIMASTGFPVIMDATHAVQSPGGQGASSGGDRRFAPVLARAAVSLGLAGVFIETHPDP 243

Query: 269 DNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           D+APSDGPNMI + D+P L+S L+A D++ K
Sbjct: 244 DHAPSDGPNMIRLADMPALISSLMAFDRLAK 274


>gi|157827964|ref|YP_001494206.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165932652|ref|YP_001649441.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia rickettsii
           str. Iowa]
 gi|166220457|sp|A8GQM3|KDSA_RICRS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|189028413|sp|B0BW09|KDSA_RICRO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|157800445|gb|ABV75698.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165907739|gb|ABY72035.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia rickettsii
           str. Iowa]
          Length = 274

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 196/265 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLI GPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG++KG EI   +K ++  PI+TDVH+E QC A A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGVGIEKGLEILSKVKSEFDCPIVTDVHSESQCTATAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL   G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLETFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  +GGER+Y+  LAKAA ++GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLAKAATSVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP M+ + +L  +L +L   DKI K
Sbjct: 248 GPCMMKLDNLESILIKLKKYDKITK 272


>gi|229586302|ref|YP_002844803.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia africae
           ESF-5]
 gi|259494407|sp|C3PMA0|KDSA_RICAE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|228021352|gb|ACP53060.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia africae ESF-5]
          Length = 274

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 196/265 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLI GPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG++KG EI   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGVGIEKGLEILSKVKSEFDCPIVTDVHSESQCTETAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  +GGER+Y+  LAKAA ++GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLAKAATSVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP M+ + +L  +L +L   DKI K
Sbjct: 248 GPCMMKLDNLESILIKLKKYDKITK 272


>gi|239946975|ref|ZP_04698728.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921251|gb|EER21275.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 274

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 196/265 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLIAGPCQIE  DH   +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLIAGPCQIEGKDHTLFMAEKLVKLTSKLEIQFIYKSSFDKANRTSVNG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G++KG EI   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGLGIEKGLEILSKVKSEFDCPIVTDVHSESQCTETAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  +GGER+Y+  LAKAA ++GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLAKAATSVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP MI + +L  +L +L   DKI K
Sbjct: 248 GPCMIKLDNLEPVLIKLKKYDKITK 272


>gi|162147713|ref|YP_001602174.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542337|ref|YP_002274566.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786290|emb|CAP55872.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530014|gb|ACI49951.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 278

 Score =  326 bits (835), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 153/273 (56%), Positives = 202/273 (73%), Gaps = 4/273 (1%)

Query: 27  AIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDK 86
           ++ LGS    +T  N++ FVLIAGPCQIES  HA   A+ L+ I +   +GL+YKSSFDK
Sbjct: 6   SVSLGS----LTVGNDRPFVLIAGPCQIESEAHAMETADALHGIARETGVGLIYKSSFDK 61

Query: 87  ANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCR 146
           ANR+SL   RGVG+  G EI   +++++G P+LTDVH   QC   A +VD+LQIPA LCR
Sbjct: 62  ANRTSLGAARGVGMAAGLEILARVRERFGVPVLTDVHAADQCAPTAAAVDVLQIPAFLCR 121

Query: 147 QTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTD 206
           QTDLL AA +TG  INVKKGQFL+PW+M N+  K+ + G + ++ CERGTSFGYNTLV D
Sbjct: 122 QTDLLLAAGETGAAINVKKGQFLAPWDMTNVAAKIASTGNERIMLCERGTSFGYNTLVND 181

Query: 207 MRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQ 266
           MR +PIM + G PV++DA+HSVQQPG  G  SGG+R++   LA+ A+AIG+A +F+ETHQ
Sbjct: 182 MRGLPIMAATGYPVVYDATHSVQQPGGLGGSSGGQREFAPILARGALAIGVAAVFIETHQ 241

Query: 267 DPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           DPD+APSDGPNMI I+D+  L+ +L   D++ K
Sbjct: 242 DPDSAPSDGPNMIPIRDMKALVQRLAQYDRLTK 274


>gi|254469946|ref|ZP_05083351.1| 3-deoxy-8-phosphooctulonate synthase [Pseudovibrio sp. JE062]
 gi|211961781|gb|EEA96976.1| 3-deoxy-8-phosphooctulonate synthase [Pseudovibrio sp. JE062]
          Length = 282

 Score =  325 bits (834), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 153/280 (54%), Positives = 205/280 (73%), Gaps = 5/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   N+ + +G+      FSN++ F LIAGPCQ+ES  HA  +A  +  I + LNIGLV+
Sbjct: 1   MSQPNSEVSVGNA----VFSNDKPFSLIAGPCQMESRAHALEMAHAVKEIAEELNIGLVF 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+S+DKANR+SL+  RG+G+K G E+F ++K+ YG P++TDVH    C  + +  D+LQI
Sbjct: 57  KASYDKANRTSLSASRGMGMKGGLEVFAEIKETYGLPVITDVHEPSHCAPVGEVCDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGR +NVKKGQFL+PW+M N++ K+   G  +V+ CERG +FGY
Sbjct: 117 PAYLCRQTDLLVAAAKTGRALNVKKGQFLAPWDMKNVMTKVVESGNSNVMLCERGATFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+DMR++PIM  MG PV+FDA+HSVQQPG  G  SGG+R+++  LA+AA+A+GIAG+
Sbjct: 177 NTLVSDMRALPIMAEMGAPVVFDATHSVQQPGGLGGSSGGQREFVATLARAAIAVGIAGL 236

Query: 261 FLETHQDPDN-APSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+ETH DPDN   SDGPNMI +  L  LL  L   D+I K
Sbjct: 237 FVETHDDPDNTTSSDGPNMIPLNRLKDLLKWLQEFDRIAK 276


>gi|294013368|ref|YP_003546828.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingobium japonicum
           UT26S]
 gi|292676698|dbj|BAI98216.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingobium japonicum
           UT26S]
          Length = 276

 Score =  325 bits (833), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 197/265 (74%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +T  N+  F+LI+GPCQIES DHA M+AE+L    +   +  ++KSSFDKANR+S++G
Sbjct: 11  GSLTVGNDLPFILISGPCQIESRDHAMMMAERLSGAAERAGVPFIFKSSFDKANRTSVSG 70

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           +RGVG+  G  I  ++K  +G+P+LTDVH   Q  A A++VDILQIPA LCRQTDLL AA
Sbjct: 71  RRGVGIDAGLAILAEVKAAFGWPVLTDVHEAGQVGAAAEAVDILQIPAFLCRQTDLLLAA 130

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG V+NVKKGQFL+PW+M  + QK+ + G + +L  ERG SFGYNTLV+DMR++P+M 
Sbjct: 131 GRTGAVVNVKKGQFLAPWDMAAVAQKVASTGNERILLTERGASFGYNTLVSDMRALPVMA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G+ SGG+R +   LA++AVA G+A IF E H DPDNAPSD
Sbjct: 191 QTGYPVVFDATHSVQQPGGLGSASGGQRDFAPVLARSAVAAGVAAIFAEAHDDPDNAPSD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP M+ ++ +  LL +L AID+++K
Sbjct: 251 GPVMLPVEWVGPLLEKLKAIDEVVK 275


>gi|163793241|ref|ZP_02187217.1| 2-dehydro-3-deoxyphosphooctonate aldolase [alpha proteobacterium
           BAL199]
 gi|159181887|gb|EDP66399.1| 2-dehydro-3-deoxyphosphooctonate aldolase [alpha proteobacterium
           BAL199]
          Length = 281

 Score =  325 bits (833), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 206/278 (74%), Gaps = 4/278 (1%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           + T+  + +GS    +T +N++ F LIAGPCQIES DHA  +AE L AIC    + L+YK
Sbjct: 1   MTTSKPVTVGS----ITIANDRPFTLIAGPCQIESRDHAMEVAEVLAAICGKAGVPLIYK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SS+DKANR+S+AG+RG+G+  G +I  D+++++G P+LTDVH   QC A A+ VD+LQIP
Sbjct: 57  SSYDKANRTSVAGQRGIGMTAGLQILADVRERFGCPVLTDVHEPPQCAAAAEYVDVLQIP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A LCRQTDLL AA  TG+V+NVKKGQFL+PWEM N+  K+ + G + +L  ERG SFGYN
Sbjct: 117 AFLCRQTDLLLAAGATGKVVNVKKGQFLAPWEMKNVADKVASTGNQRILLTERGVSFGYN 176

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV+DMRS+P M   G PV+FDA+HSV QPG  G  SGG+R++   LA+AA+A+G A +F
Sbjct: 177 TLVSDMRSLPEMAKTGYPVVFDATHSVAQPGGKGTSSGGQREFAPVLARAALAVGAAAVF 236

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +E H DPDNAPSDGPNM+ + DLP LL   +A D+I K
Sbjct: 237 MECHPDPDNAPSDGPNMVRLADLPALLDTFVAFDRIAK 274


>gi|238650528|ref|YP_002916380.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia peacockii
           str. Rustic]
 gi|259494408|sp|C4K181|KDSA_RICPU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238624626|gb|ACR47332.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia peacockii
           str. Rustic]
          Length = 274

 Score =  322 bits (825), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 153/265 (57%), Positives = 195/265 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLI GPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG++KG +I   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGVGIEKGLDILSKVKSEFDCPIVTDVHSESQCIETAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL   G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLETFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  +GGER+Y+  LAKAA ++GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLAKAATSVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP M+ + +L  +L +L   DKI K
Sbjct: 248 GPCMMKLDNLESILIKLKKYDKITK 272


>gi|154253594|ref|YP_001414418.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Parvibaculum
           lavamentivorans DS-1]
 gi|154157544|gb|ABS64761.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Parvibaculum
           lavamentivorans DS-1]
          Length = 277

 Score =  321 bits (823), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 151/276 (54%), Positives = 199/276 (72%), Gaps = 5/276 (1%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           N  + +G+    +  +N++ FVLIAGPCQ+E+  HAF +A  +  I   L IG +YK+SF
Sbjct: 4   NQTVRIGN----LEIANDKPFVLIAGPCQLETRQHAFDMAGAVKEITDRLGIGFIYKTSF 59

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANR+S    RG+GL+    IF DLKK+ G P+LTDVH   QC  +A  VD+LQIPA L
Sbjct: 60  DKANRTSRNATRGLGLELALPIFEDLKKELGLPVLTDVHERDQCAEVASVVDVLQIPAFL 119

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
           CRQTDLL AAAQTG+V+NVKKGQFL+PW+M N++ K+   G  +VL  ERG SFGYNTLV
Sbjct: 120 CRQTDLLEAAAQTGKVVNVKKGQFLAPWDMKNVVNKVVDAGNPNVLATERGVSFGYNTLV 179

Query: 205 TDMRSIPIMTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
            DMR++PIM      PV+ DA+HSVQQPG  G  SGG+R+ +  +A AAV++G+A +F+E
Sbjct: 180 NDMRALPIMKEQCRCPVVIDATHSVQQPGGQGTASGGDRRMVPHIATAAVSLGVAAVFIE 239

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           THQDPDNAPSDGPNM+ + +L  LL++L   D++ K
Sbjct: 240 THQDPDNAPSDGPNMVKLDELEALLARLRKFDELAK 275


>gi|258542322|ref|YP_003187755.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633400|dbj|BAH99375.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636459|dbj|BAI02428.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639512|dbj|BAI05474.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642568|dbj|BAI08523.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645623|dbj|BAI11571.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648676|dbj|BAI14617.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651729|dbj|BAI17663.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654720|dbj|BAI20647.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 277

 Score =  321 bits (823), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 150/259 (57%), Positives = 194/259 (74%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N+Q FVLIAGPCQIES  HA   A  L  ICQ   IGL+YKSSFDKANR+S++  RG+G+
Sbjct: 18  NDQPFVLIAGPCQIESAAHAMETATALKEICQKAGIGLIYKSSFDKANRTSISSARGIGM 77

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            +G +I  +++     P+LTDVH  +QC  +A++VD+LQIPA LCRQTDLL AA +TG  
Sbjct: 78  AEGLDILANVRNTLDIPVLTDVHAPEQCAPVAEAVDVLQIPAFLCRQTDLLLAAGKTGAA 137

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +NVKKGQFL+PW+M ++  K+ + G   ++ CERGTSFGYNTLV DMR +PIM   G PV
Sbjct: 138 VNVKKGQFLAPWDMKHVAAKIASTGNNRIMLCERGTSFGYNTLVNDMRGLPIMAQTGYPV 197

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQQPG  G  SGG+R++   L++AA+AIG+A +F+ETH++PD APSDGPNM+ 
Sbjct: 198 VFDATHSVQQPGGLGGASGGQREFAPVLSRAALAIGVASLFIETHENPDQAPSDGPNMLP 257

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           IK LP LL Q   ID +IK
Sbjct: 258 IKTLPALLEQFKQIDALIK 276


>gi|114327493|ref|YP_744650.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Granulibacter
           bethesdensis CGDNIH1]
 gi|122327535|sp|Q0BTX5|KDSA_GRABC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|114315667|gb|ABI61727.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 282

 Score =  321 bits (823), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 147/263 (55%), Positives = 196/263 (74%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V F N+  FVLIAGPCQIES  HA  +A +L+AIC  L+I LV+K+S+DKANR+S+ G R
Sbjct: 18  VRFGNDLPFVLIAGPCQIESRAHAEGVAAELHAICARLDIPLVFKASYDKANRTSVGGAR 77

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           GVG+++G +I   +++++  P+LTD+H   QC+  A++VDILQIPA LCRQTDLL AA +
Sbjct: 78  GVGMERGLDILAGIRERFDIPVLTDIHDIGQCKPAAEAVDILQIPAFLCRQTDLLLAAGE 137

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGR INVKKGQFL+PW+M N+  K+ + G  ++L  ERG SFGYNTLVTD R++PIM   
Sbjct: 138 TGRTINVKKGQFLAPWDMRNVAAKIASTGNHNLLLTERGASFGYNTLVTDFRALPIMAQT 197

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQQPG  G  SGG+R +   LA+AA+A+G+A +F+E H DPD APSDGP
Sbjct: 198 GYPVVFDATHSVQQPGGQGTASGGDRTFAPILARAALAVGVASVFIECHPDPDRAPSDGP 257

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  + + L +L   D + K
Sbjct: 258 NMIPLDQMEETLRRLKQFDVLGK 280


>gi|329113485|ref|ZP_08242266.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acetobacter pomorum
           DM001]
 gi|326697310|gb|EGE48970.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acetobacter pomorum
           DM001]
          Length = 277

 Score =  320 bits (820), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 149/259 (57%), Positives = 194/259 (74%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N+Q FVLIAGPCQIES  HA   A  L  ICQ   +GL+YKSSFDKANR+S++  RG+G+
Sbjct: 18  NDQPFVLIAGPCQIESAVHAMETATALKEICQKAGVGLIYKSSFDKANRTSISSARGIGM 77

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            +G +I  +++     P+LTDVH  +QC  +A++VD+LQIPA LCRQTDLL AA +TG  
Sbjct: 78  AEGLDILANVRNTLDIPVLTDVHAPEQCAPVAEAVDVLQIPAFLCRQTDLLLAAGKTGAA 137

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +NVKKGQFL+PW+M ++  K+ + G   ++ CERGTSFGYNTLV DMR +PIM   G PV
Sbjct: 138 VNVKKGQFLAPWDMKHVAAKIASTGNNRIMLCERGTSFGYNTLVNDMRGLPIMAQTGYPV 197

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQQPG  G  SGG+R++   L++AA+AIG+A +F+ETH++PD APSDGPNM+ 
Sbjct: 198 VFDATHSVQQPGGLGGASGGQREFAPVLSRAALAIGVASLFIETHENPDQAPSDGPNMLP 257

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           IK LP LL Q   ID +IK
Sbjct: 258 IKSLPALLEQFKKIDALIK 276


>gi|91763326|ref|ZP_01265290.1| 2-dehydro-3-deoxy-phosphooctonate aldolase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91717739|gb|EAS84390.1| 2-dehydro-3-deoxy-phosphooctonate aldolase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 274

 Score =  320 bits (820), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 154/263 (58%), Positives = 201/263 (76%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  SN+ +  +IAGPCQ+E+  HA  +A K+  I + L +G +YK+SFDKANR+SL G+R
Sbjct: 11  IEISNDNKICIIAGPCQLETEQHAMDMAGKIQEITKKLGLGFIYKTSFDKANRTSLKGQR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+    +F  +KK+   PILTD+H  +QC  + D VDILQIPA LCRQTDLL AAA+
Sbjct: 71  GAGLEASLPVFDKIKKELNVPILTDIHNAEQCSLLKDHVDILQIPAFLCRQTDLLIAAAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T ++INVKKGQFL+PW+M N+ +K+   G +++L  ERG SFGYNTLV+DMRS+PIM   
Sbjct: 131 TNKIINVKKGQFLAPWDMVNVTKKIADSGNENILVTERGASFGYNTLVSDMRSLPIMAKN 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETHQDPDNAPSDGP
Sbjct: 191 GYPVIFDATHSVQQPGGLGETSGGQREFVEYLARAAVAVGVAGVFIETHQDPDNAPSDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +  L KLLSQL  ID +IK
Sbjct: 251 NMVPLDKLEKLLSQLFEIDNLIK 273


>gi|71083634|ref|YP_266354.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|71062747|gb|AAZ21750.1| 2-dehydro-3-deoxy-phosphooctonate aldolase [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 274

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 154/263 (58%), Positives = 200/263 (76%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  SN+ +  +IAGPCQ+E+  HA  +A K+  I + L +G +YK+SFDKANR+SL G+R
Sbjct: 11  IEISNDNKICIIAGPCQLETEQHAMDMAGKIQEITKKLGLGFIYKTSFDKANRTSLKGQR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+    +F  +KK+   PILTD+H  +QC  + D VDILQIPA LCRQTDLL AAA+
Sbjct: 71  GAGLEASLPVFDKIKKELNVPILTDIHNAEQCSLLKDHVDILQIPAFLCRQTDLLIAAAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T ++INVKKGQFL+PW+M N+ +K+   G  ++L  ERG SFGYNTLV+DMRS+PIM   
Sbjct: 131 TNKIINVKKGQFLAPWDMVNVTKKISDSGNNNILVTERGASFGYNTLVSDMRSLPIMAKN 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETHQDPDNAPSDGP
Sbjct: 191 GYPVIFDATHSVQQPGGLGETSGGQREFVEYLARAAVAVGVAGVFIETHQDPDNAPSDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +  L KLLSQL  ID +IK
Sbjct: 251 NMVPLDKLEKLLSQLFEIDNLIK 273


>gi|148260242|ref|YP_001234369.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidiphilium cryptum
           JF-5]
 gi|326403428|ref|YP_004283509.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidiphilium multivorum
           AIU301]
 gi|146401923|gb|ABQ30450.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidiphilium cryptum
           JF-5]
 gi|325050289|dbj|BAJ80627.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidiphilium multivorum
           AIU301]
          Length = 275

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 197/265 (74%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
            ++   N+  F LIAGPCQIES +HA  +A  L A+ + L IGL++KSS+DKANR+SL  
Sbjct: 9   GELRVGNDLPFTLIAGPCQIESAEHAGEVAGALAAMTRELGIGLIFKSSYDKANRTSLTA 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG+ +G +I  D++ K+G P+LTDVH   QC   A++VD+LQIPA LCRQTDLL AA
Sbjct: 69  GRGVGMAQGLQILADIRAKFGIPVLTDVHDAAQCAPAAEAVDVLQIPAFLCRQTDLLLAA 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
             TGR INVKKGQFL+PW+M N+  K+ + G + +L  ERG SFGYNTLV+D+R++PIM 
Sbjct: 129 GHTGRAINVKKGQFLAPWDMRNVAAKIASTGNERILLTERGASFGYNTLVSDLRALPIMA 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G  SGG+R++   LA+AA+A+G A +F+E H DPD+APSD
Sbjct: 189 QTGYPVVFDATHSVQQPGGQGTASGGQREFAPILARAALAVGCAAVFIECHPDPDHAPSD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNMI + ++P LL++L   D++ K
Sbjct: 249 GPNMIRLAEMPALLARLQQFDRLAK 273


>gi|299134968|ref|ZP_07028159.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Afipia sp. 1NLS2]
 gi|298589945|gb|EFI50149.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Afipia sp. 1NLS2]
          Length = 295

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 201/264 (76%), Gaps = 1/264 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           VTF N+    +IAGPCQ+ES  HA  +A  L  I   LNIGLVYK+SFDKANR+S++ +R
Sbjct: 18  VTFGNDLPLSVIAGPCQLESRAHALEVASALKEIAARLNIGLVYKTSFDKANRTSVSSER 77

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+GL K   IF ++++  G P+LTDVH   QC  +A +VD+LQIPA LCRQTDLL AAA 
Sbjct: 78  GIGLAKALPIFAEIRETLGLPVLTDVHDATQCAEVAQAVDVLQIPAFLCRQTDLLLAAAA 137

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT-S 215
           TG+V+NVKKGQFL+PW+M N++ K+ + G  +VL  ERG SFGYNTLV+DMR++PI+  +
Sbjct: 138 TGKVVNVKKGQFLAPWDMKNVVAKITSGGNANVLVTERGASFGYNTLVSDMRALPILART 197

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+AG+F+ETH DPD+APSDG
Sbjct: 198 TGAPVIFDATHSVQQPGGQGTSSGGEREFVPVLARAAVAVGVAGVFIETHPDPDHAPSDG 257

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +KD   L+  L+A D + K
Sbjct: 258 PNMVPLKDFEPLVRNLMAFDALAK 281


>gi|85716531|ref|ZP_01047502.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitrobacter sp. Nb-311A]
 gi|85696720|gb|EAQ34607.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitrobacter sp. Nb-311A]
          Length = 287

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 155/282 (54%), Positives = 207/282 (73%), Gaps = 5/282 (1%)

Query: 19  NHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGL 78
           N  +     + +GS    VTF  +Q   +IAGPCQ+ES  HA  +A  L  I   LNIGL
Sbjct: 2   NQSVSAAPVVSVGS----VTFGQDQPLSIIAGPCQMESRAHALEVAGALKEIAARLNIGL 57

Query: 79  VYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDIL 138
           V+KSSFDKANR+S +G RG+GLK+   +F +++   G P+LTD+H   QC  +A++VD+L
Sbjct: 58  VFKSSFDKANRTSASGARGIGLKQALPVFAEIRSSLGLPVLTDIHEAAQCAEVAEAVDVL 117

Query: 139 QIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSF 198
           QIPA LCRQTDLL AAA TG+V+NVKKGQFL+PW+M N++ K+   G ++VL  ERG SF
Sbjct: 118 QIPAFLCRQTDLLLAAAATGKVVNVKKGQFLAPWDMGNVVAKITGGGNRNVLVTERGVSF 177

Query: 199 GYNTLVTDMRSIPIMT-SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGI 257
           GYNTLV+DMR++PI+  + G PVIFDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+
Sbjct: 178 GYNTLVSDMRALPILARTTGAPVIFDATHSVQQPGGKGTSSGGEREFVPVLARAAVAVGV 237

Query: 258 AGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           AG+F+ETH DPD+APSDGPNM+ ++D   L+ +L A D + K
Sbjct: 238 AGVFIETHPDPDHAPSDGPNMVPLRDFEALVRRLTAFDALAK 279


>gi|296116174|ref|ZP_06834792.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977280|gb|EFG84040.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 278

 Score =  316 bits (809), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 149/275 (54%), Positives = 200/275 (72%), Gaps = 2/275 (0%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           NA + +  G   +   N++ F LIAGPCQIES  HA   A+ L A+ + L IGL+YKSSF
Sbjct: 3   NAQVEIRVG--DLVIGNDRPFTLIAGPCQIESESHAVETADFLQAVTRRLGIGLIYKSSF 60

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANR+SL   RG+G  +G EI   +++++  P+LTDVH  +QC   A++VD+LQIPA L
Sbjct: 61  DKANRTSLTSARGIGANRGLEILARVRERFSIPVLTDVHLPEQCAPAAEAVDVLQIPAFL 120

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
           CRQTDLL AA +TG  INVKKGQFL+PW+M N+  K+ + G + ++ CERGTSFGYNTLV
Sbjct: 121 CRQTDLLLAAGETGAAINVKKGQFLAPWDMANVAAKIASTGNERIMLCERGTSFGYNTLV 180

Query: 205 TDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET 264
            DMR +PIM   G PV++DA+HSVQQPG  G+ SGG+R++   L++AA+AIG+A +F+ET
Sbjct: 181 NDMRGLPIMARTGFPVVYDATHSVQQPGGLGSSSGGQREFAPVLSRAALAIGVAAVFIET 240

Query: 265 HQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           H+DPD APSDGPNMI +  +  LL+ L   D++ K
Sbjct: 241 HEDPDKAPSDGPNMIALSQMEGLLANLQRYDRLTK 275


>gi|94496641|ref|ZP_01303217.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingomonas sp. SKA58]
 gi|94424001|gb|EAT09026.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingomonas sp. SKA58]
          Length = 275

 Score =  316 bits (809), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 189/263 (71%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T  N+  FVLI+GPCQIES DHA  +A+ L    +   +  ++KSSFDKANR+S++GKR
Sbjct: 12  ITIGNDLPFVLISGPCQIESRDHALFMADALARAAEQAGVPFIFKSSFDKANRTSVSGKR 71

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           GVG+  G  I  ++K   G P+LTD+H   Q EA A +VDILQIPA LCRQTDLL AA +
Sbjct: 72  GVGIDAGLAILAEVKASLGCPVLTDIHGPDQVEAAAQAVDILQIPAFLCRQTDLLLAAGR 131

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           +G VINVKKGQFL+PW+M  + QK+ + G   +L  ERG SFGYNTLV+DMR++P+M   
Sbjct: 132 SGAVINVKKGQFLAPWDMAAVAQKVASTGNDRILLTERGASFGYNTLVSDMRALPVMAQT 191

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVIFDA+HSVQQPG  G+ SGG+R Y   LA++AVA G+A IF E H DPDNAPSDGP
Sbjct: 192 GYPVIFDATHSVQQPGGLGSASGGQRDYAPLLARSAVAAGVAAIFAEAHDDPDNAPSDGP 251

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
            M+ +  +  +L +L AID I K
Sbjct: 252 VMLPLDWVGPMLDKLKAIDAIAK 274


>gi|288958215|ref|YP_003448556.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Azospirillum sp. B510]
 gi|288910523|dbj|BAI72012.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Azospirillum sp. B510]
          Length = 275

 Score =  315 bits (807), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 153/278 (55%), Positives = 213/278 (76%), Gaps = 4/278 (1%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           + T  A+ +G     +T +N++ FVLIAGPCQ+ES DHA   A  L  + ++L +GL+YK
Sbjct: 1   MTTPRAVQIG----DLTIANDRPFVLIAGPCQMESRDHALETASALVEMTRALGMGLIYK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SSFDKANR+S+   RG+G+ +   IF ++++++G P++TDVH   QC  +A++VD+LQIP
Sbjct: 57  SSFDKANRTSITTARGLGIDRALPIFAEIRERFGCPVITDVHESSQCVPVAEAVDVLQIP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A LCRQTDLL AAAQTGR +NVKKGQFL+PW+M N+  KL A G + VL CERG SFGYN
Sbjct: 117 AFLCRQTDLLIAAAQTGRAVNVKKGQFLAPWDMRNVAAKLVASGNERVLLCERGASFGYN 176

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV+DMR++PIM   G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AA+A+G+A +F
Sbjct: 177 TLVSDMRALPIMAETGFPVVFDATHSVQQPGGQGTTSGGQREFVPVLARAAIAVGVAAVF 236

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +ETH++PD APSDGPNM+ + ++P LL++L A D++ K
Sbjct: 237 METHENPDCAPSDGPNMVPLAEMPALLAKLQAFDRLAK 274


>gi|260432909|ref|ZP_05786880.1| 3-deoxy-8-phosphooctulonate synthase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416737|gb|EEX09996.1| 3-deoxy-8-phosphooctulonate synthase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 277

 Score =  315 bits (807), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 196/263 (74%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T  N+    +IAGPCQ+E+ DHA MIA ++  IC       V+K+S+DKANR+SL+G+R
Sbjct: 9   LTVGNDLPLTVIAGPCQLETADHAQMIAGRMKDICDKAGAQYVFKASYDKANRTSLSGRR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+  G ++  D++K  G P+LTDVHTE QC   A++VDILQIPA LCRQTD+L AA +
Sbjct: 69  GMGIDAGLKVLDDIRKTMGVPVLTDVHTEAQCAIAAEAVDILQIPAFLCRQTDMLLAAGE 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +NVKKGQFL+PWEM NI++K+ + G +++L  ERGTSFGYNTLV DMRS+P M   
Sbjct: 129 TGKAVNVKKGQFLAPWEMPNIVEKIESTGNRNILLTERGTSFGYNTLVADMRSLPQMAQT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++GI  +F+ETHQDPDNAPSDGP
Sbjct: 189 GYPVVMDATHSVQQPGGRGGSSGGQREFAPVMARAAVSLGIGAVFIETHQDPDNAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +  L+  L+  D + K
Sbjct: 249 NMIPLDQMEDLIGTLMQFDALAK 271


>gi|254293925|ref|YP_003059948.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hirschia baltica ATCC
           49814]
 gi|254042456|gb|ACT59251.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hirschia baltica ATCC
           49814]
          Length = 286

 Score =  315 bits (806), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 146/283 (51%), Positives = 203/283 (71%), Gaps = 1/283 (0%)

Query: 17  DKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNI 76
           D + +   N+ + +   +  +    +       GPC +ES +HA  ++  +  I   L  
Sbjct: 3   DTSSVKALNSTVEIACPRGNIKIGPDAPLTFFLGPCALESREHALFMSNAILEIADKLGA 62

Query: 77  GLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD 136
            +VYK+SFDKANR+S++G RG+ L +  +IF ++K K G P+LTDVH   QCE +A  VD
Sbjct: 63  QVVYKTSFDKANRTSMSGYRGLELDEALDIFAEVKDKTGLPMLTDVHLPDQCEKVAKVVD 122

Query: 137 ILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGT 196
           +LQIPA LCRQTD+L AAA+TG V+ VKKGQFL+PW+M N++ KL + GAKDVL  ERG+
Sbjct: 123 VLQIPAFLCRQTDMLQAAAETGAVVKVKKGQFLAPWDMKNVVNKLISMGAKDVLLTERGS 182

Query: 197 SFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIG 256
           SFGYN LVTDMR +P M +M  PV+ DA+HSVQQPG  G  +GG+R+Y+  +AKAAVA+G
Sbjct: 183 SFGYNALVTDMRGLPEMAAMA-PVVIDATHSVQQPGGKGGSTGGQREYVPVIAKAAVAVG 241

Query: 257 IAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           ++G+FLETHQDPDNAPSDGPNM+ + +L KL+S+L+ I+ ++K
Sbjct: 242 VSGVFLETHQDPDNAPSDGPNMVILSELEKLMSELIQINALVK 284


>gi|163737727|ref|ZP_02145144.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Phaeobacter
           gallaeciensis BS107]
 gi|161389253|gb|EDQ13605.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Phaeobacter
           gallaeciensis BS107]
          Length = 277

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 142/263 (53%), Positives = 199/263 (75%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           ++  N++   LIAGPCQ+ES DHA MIA ++   C       V+K+S+DKANR+SL+GKR
Sbjct: 9   LSIGNDRPLTLIAGPCQLESLDHARMIAGQMKEACAKYGAQYVFKASYDKANRTSLSGKR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+ +G ++ + + K++  P+LTDVHTE QC   A++VDILQIPA LCRQTD+L AA +
Sbjct: 69  GLGVDEGLKVLQTIAKEFDVPVLTDVHTEAQCAVAAEAVDILQIPAFLCRQTDMLLAAGK 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +N+KKGQFL+PW+M N++ K+ + G +++L  ERGTSFGYNTLV DMRS+P M   
Sbjct: 129 TGKAVNIKKGQFLAPWDMANVVAKVESTGNQNILLTERGTSFGYNTLVADMRSLPQMAQG 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  G  +GG+R++   +A+AAV++GIA +F+ETH+DPDNAPSDGP
Sbjct: 189 GYPVVMDATHSVQQPGGKGGSTGGQREFAPLMARAAVSLGIASVFIETHEDPDNAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +PKL+  L+  D + K
Sbjct: 249 NMIYLDQMPKLIETLMRFDALAK 271


>gi|209885417|ref|YP_002289274.1| 3-deoxy-8-phosphooctulonate synthase [Oligotropha carboxidovorans
           OM5]
 gi|209873613|gb|ACI93409.1| 3-deoxy-8-phosphooctulonate synthase [Oligotropha carboxidovorans
           OM5]
          Length = 279

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 153/264 (57%), Positives = 198/264 (75%), Gaps = 1/264 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           VTF N+    +IAGPCQ+ES  HA  +A  L  I   L IGLV+K+SFDKANR+S + +R
Sbjct: 13  VTFGNDLPLAVIAGPCQLESRAHALEVAGALKEIAARLKIGLVFKTSFDKANRTSASAER 72

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+GL K   IF +++   G P+LTDVH  +QC  +A +VD+LQIPA LCRQTDLL AAA 
Sbjct: 73  GIGLAKALPIFAEIRDSLGLPVLTDVHEVEQCAEVAQAVDVLQIPAFLCRQTDLLLAAAA 132

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT-S 215
           TG+V+NVKKGQFL+PW+M N++ K+   G  +VL  ERG SFGYNTLV+DMR++PIM  +
Sbjct: 133 TGKVVNVKKGQFLAPWDMQNVVSKITNGGNANVLVTERGASFGYNTLVSDMRALPIMART 192

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+AG+F+ETH DPD+APSDG
Sbjct: 193 TGAPVVFDATHSVQQPGGKGTSSGGEREFVPVLARAAVAVGVAGVFIETHPDPDHAPSDG 252

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +KD   LL  L+A D + K
Sbjct: 253 PNMVPLKDFEGLLQTLMAFDAVAK 276


>gi|260428720|ref|ZP_05782698.1| 3-deoxy-8-phosphooctulonate synthase [Citreicella sp. SE45]
 gi|260420314|gb|EEX13566.1| 3-deoxy-8-phosphooctulonate synthase [Citreicella sp. SE45]
          Length = 278

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 150/265 (56%), Positives = 202/265 (76%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            VTF+N+    LIAGPCQ+ES +HA M+A ++ A  ++  +  V+K SFDKANRSSL+GK
Sbjct: 14  SVTFANDAPLALIAGPCQLESLEHARMLAGRIAAAAEAARMPWVFKGSFDKANRSSLSGK 73

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G++ G  I   +  ++G P+LTD+H  +QC  +A +VDILQIPA L RQTDLL AA 
Sbjct: 74  RGLGMEAGLSILSKIGAEFGVPVLTDIHGPEQCATVAQAVDILQIPAFLSRQTDLLLAAG 133

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG  INVKKGQFL+PW+M N+  K+ + G + ++ CERG SFGYN LV+DMRS+PIM  
Sbjct: 134 ETGAAINVKKGQFLAPWDMANVAAKIASTGNQRLMLCERGASFGYNMLVSDMRSLPIMAE 193

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+RQ++  LA+AAVA+G AG+F+ETH+DPDNAPSDG
Sbjct: 194 TGYPVVFDATHSVQLPGGQGSSSGGQRQFVGTLARAAVAVGCAGVFIETHEDPDNAPSDG 253

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNM+ I  L  LL++L A+D+++KP
Sbjct: 254 PNMVPIDGLAPLLARLHALDEVVKP 278


>gi|254450944|ref|ZP_05064381.1| 3-deoxy-8-phosphooctulonate synthase [Octadecabacter antarcticus
           238]
 gi|198265350|gb|EDY89620.1| 3-deoxy-8-phosphooctulonate synthase [Octadecabacter antarcticus
           238]
          Length = 277

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 149/272 (54%), Positives = 199/272 (73%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           + +GS    VT SN++   +IAGPCQ+ES  HA MIAE++  +C +     V+K S+DKA
Sbjct: 4   VQIGS----VTASNDRPLTIIAGPCQLESLAHARMIAEEMSKVCDAHGAQFVFKGSYDKA 59

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NR+SL+GKRG+G+ +G  I   +K ++G P+LTD+HT  QC  +A+ VDILQIPA LCRQ
Sbjct: 60  NRTSLSGKRGLGMDEGLAIHAAIKAEFGCPVLTDIHTADQCAPVAEVVDILQIPAFLCRQ 119

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDLL AA +TG  +N+KKGQFL+PW+M N++ K+ + G   +L  ERG SFGYN LVTDM
Sbjct: 120 TDLLLAAGETGAAVNIKKGQFLAPWDMANVVSKVESTGNTRILLTERGVSFGYNALVTDM 179

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
           RS+P M   G PV+ DA+H+V QPG  G  SGG+R++   LA+AAVAIGI  +FLETH+D
Sbjct: 180 RSLPEMMKTGYPVVMDATHAVAQPGGLGGSSGGQREFAPVLARAAVAIGIGAVFLETHED 239

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNAPSDGPNMI ++D+  +L  L+A+D I K
Sbjct: 240 PDNAPSDGPNMIALRDMDGVLKTLMALDAIAK 271


>gi|149202423|ref|ZP_01879396.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseovarius sp. TM1035]
 gi|149144521|gb|EDM32552.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseovarius sp. TM1035]
          Length = 277

 Score =  312 bits (800), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 194/265 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N     N++   LIAGPCQ+ES DHA MIA  L   C +   GL++K SFDKANR+SL+G
Sbjct: 7   NGWAIGNDRPLTLIAGPCQLESADHAQMIAGTLQEACAAHGAGLIFKGSFDKANRTSLSG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G+ +G ++ + +K   G P+LTD+HT  QC  +A+  D+LQIPA LCRQTDLL AA
Sbjct: 67  KRGLGVDEGLKVLQSVKDTLGLPVLTDIHTADQCAPVAEVADVLQIPAFLCRQTDLLIAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG VINVKKGQFL+PW+M N++ K+ + G   +L  ERGTSFGYNTLV DMRS+P M 
Sbjct: 127 GETGAVINVKKGQFLAPWDMPNVISKIESTGNTRILLTERGTSFGYNTLVADMRSLPQMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAVA+G+A +F+ETH+DPDNAPSD
Sbjct: 187 ATGYPVVMDATHSVQQPGGRGGSSGGQREFAPVMARAAVALGVACVFIETHEDPDNAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNMI +  +  L+  L+  D++ K
Sbjct: 247 GPNMIPLTQMSALIDTLMQFDRLAK 271


>gi|254466542|ref|ZP_05079953.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacterales bacterium
           Y4I]
 gi|206687450|gb|EDZ47932.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacterales bacterium
           Y4I]
          Length = 277

 Score =  312 bits (800), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 141/263 (53%), Positives = 197/263 (74%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T  N++   +IAGPCQ+E+ DHA MIA  L   C       V+K+S+DKANR+SL+GKR
Sbjct: 9   LTVGNDRPLTIIAGPCQLETADHARMIAGALKEACGKAGAQFVFKASYDKANRTSLSGKR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+ +G ++   +++++  P+LTDVHTE QC   A++VDILQIPA LCRQTD+L AA  
Sbjct: 69  GLGIDEGLKVLDTIRREFDVPVLTDVHTEAQCAVAAEAVDILQIPAFLCRQTDMLLAAGN 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +N+KKGQFL+PW+M N++ K+ + G +++L  ERGTSFGYNTLV DMRS+P M   
Sbjct: 129 TGKAVNIKKGQFLAPWDMANVVAKVESTGNQNILLTERGTSFGYNTLVADMRSLPQMAQG 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  G  +GG+R++   +A+AAV++GIA +F+ETHQDPDNAPSDGP
Sbjct: 189 GYPVVMDATHSVQQPGGKGGSTGGQREFAPLMARAAVSLGIAAVFIETHQDPDNAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +P+L+  L+  D + K
Sbjct: 249 NMIYLDQMPQLIDSLMRFDALAK 271


>gi|254486746|ref|ZP_05099951.1| 3-deoxy-8-phosphooctulonate synthase [Roseobacter sp. GAI101]
 gi|214043615|gb|EEB84253.1| 3-deoxy-8-phosphooctulonate synthase [Roseobacter sp. GAI101]
          Length = 277

 Score =  312 bits (799), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 144/263 (54%), Positives = 194/263 (73%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V    ++   +IAGPCQ+ES  HA MIA ++   C +     V+K+S+DKANR+SL+GKR
Sbjct: 9   VVIGIDRPLTVIAGPCQLESETHAQMIAGQMKEACDAAGAQFVFKASYDKANRTSLSGKR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+ +G  + + + K  G P+LTDVHTE QC   A++VDILQIPA LCRQTD+L AA  
Sbjct: 69  GLGIDEGLAVLQSVGKSIGVPVLTDVHTEAQCAIAAEAVDILQIPAFLCRQTDMLLAAGN 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+V+NVKKGQFL+PW+M N++ K+ + G K +L  ERGTSFGYNTLV DMRS+P M   
Sbjct: 129 TGKVVNVKKGQFLAPWDMANVVSKIESTGNKRILLTERGTSFGYNTLVADMRSLPQMAKT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAVAIG+  +F+ETH+DPDNAPSDGP
Sbjct: 189 GYPVVMDATHSVQQPGGMGGSSGGQREFAPVMARAAVAIGVGAVFIETHEDPDNAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI++  +P L++ L+  D + K
Sbjct: 249 NMIHLDQMPALIASLMEFDALAK 271


>gi|92117285|ref|YP_577014.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitrobacter hamburgensis
           X14]
 gi|123387112|sp|Q1QMJ3|KDSA_NITHX RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|91800179|gb|ABE62554.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitrobacter hamburgensis
           X14]
          Length = 287

 Score =  311 bits (798), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 154/282 (54%), Positives = 205/282 (72%), Gaps = 5/282 (1%)

Query: 19  NHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGL 78
           N  +     +  GS    VTF  ++   +IAGPCQ+ES  HA  +A  L  I   LNIGL
Sbjct: 2   NQSVSAAPVVSAGS----VTFGQDRPLSIIAGPCQMESRAHALEVAGALKEIAARLNIGL 57

Query: 79  VYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDIL 138
           V+K+SFDKANR+S +G RG+GLK+   +F ++    G P+LTDVH   QC  +A +VD+L
Sbjct: 58  VFKTSFDKANRTSASGARGLGLKQALPVFAEIGSSLGLPVLTDVHEAAQCTEVAQAVDVL 117

Query: 139 QIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSF 198
           QIPA LCRQTDLL AAA TG+V+NVKKGQFL+PW+M N++ K+   G  +VL  ERG SF
Sbjct: 118 QIPAFLCRQTDLLLAAAATGKVVNVKKGQFLAPWDMANVVAKITGGGNPNVLVTERGASF 177

Query: 199 GYNTLVTDMRSIPIMT-SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGI 257
           GYNTLV+DMRS+PI+  + G PVIFDA+HSVQQPG +G  SGGER+++  LA+AAVA+G+
Sbjct: 178 GYNTLVSDMRSLPILARTTGAPVIFDATHSVQQPGGNGTSSGGEREFVPVLARAAVAVGV 237

Query: 258 AGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           AG+F+ETH DPD+APSDGPNM+ +++   L+ +L+A D + K
Sbjct: 238 AGVFIETHPDPDHAPSDGPNMVPLREFEALVRRLMAFDALAK 279


>gi|83593221|ref|YP_426973.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodospirillum rubrum
           ATCC 11170]
 gi|83576135|gb|ABC22686.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodospirillum rubrum
           ATCC 11170]
          Length = 280

 Score =  311 bits (798), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 202/272 (74%), Gaps = 3/272 (1%)

Query: 29  HLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKAN 88
           H+  G   VTF N+   VLIAGPCQ+ES +HA   A  L A+C  L +  +YK+SFDKAN
Sbjct: 5   HVAVGP--VTFGNDLPMVLIAGPCQMESREHALETASILVALCADLGVPFIYKTSFDKAN 62

Query: 89  RSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQT 148
           R+SL+G+RGVG++K   IF ++++  G P+LTDVH   QC  +A++VD+LQIPA LCRQT
Sbjct: 63  RTSLSGQRGVGMEKALPIFAEIRETLGCPVLTDVHDAGQCAPVAEAVDVLQIPAFLCRQT 122

Query: 149 DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMR 208
           DLL AAA TGRVINVKKGQFL+PW+M N+  K+ + G + VL  ERG SFGYNTLVTDMR
Sbjct: 123 DLLLAAAATGRVINVKKGQFLAPWDMKNVANKVMSAGNERVLLTERGASFGYNTLVTDMR 182

Query: 209 SIPIMT-SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
           S+PIM    G P+I DA+HSVQQPG  G  SGG+R++   +A+AA+A+G+AG+FLETH D
Sbjct: 183 SLPIMARDTGCPIIIDATHSVQQPGGQGGSSGGQREFAPVIARAALAVGVAGVFLETHAD 242

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PD+APSDGPNMI +  +P L++ L  +D   K
Sbjct: 243 PDHAPSDGPNMIALDAMPALIAVLRDLDAFAK 274


>gi|90423977|ref|YP_532347.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris BisB18]
 gi|90105991|gb|ABD88028.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris BisB18]
          Length = 296

 Score =  311 bits (798), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 152/264 (57%), Positives = 200/264 (75%), Gaps = 1/264 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V F N     +IAGPCQ+ES  HA   A  L  I Q L IGLVYK+SFDKANR+S   +R
Sbjct: 31  VRFGNALPLAVIAGPCQLESRAHALETASALKEIAQKLGIGLVYKTSFDKANRTSATSQR 90

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+GL++   IF ++++ +G P+LTDVH  +QC   A++VDILQIPA LCRQTDLL AAA 
Sbjct: 91  GLGLEQALPIFAEIRESFGLPVLTDVHESEQCARAAEAVDILQIPAFLCRQTDLLLAAAA 150

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT-S 215
           TG+V+NVKKGQFL+PW+M N++QKL + G  +VL  ERG SFGYNTLV+DMR++PI+  +
Sbjct: 151 TGKVVNVKKGQFLAPWDMANVVQKLTSAGNANVLVTERGVSFGYNTLVSDMRALPILART 210

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+AG+F+ETH DPD+APSDG
Sbjct: 211 TGAPVIFDATHSVQQPGGKGTSSGGEREFVPVLARAAVAVGVAGVFIETHPDPDHAPSDG 270

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +++   L+ +L+  D + K
Sbjct: 271 PNMVPLREFEALMQRLMQFDALAK 294


>gi|329890013|ref|ZP_08268356.1| 3-deoxy-8-phosphooctulonate synthase [Brevundimonas diminuta ATCC
           11568]
 gi|328845314|gb|EGF94878.1| 3-deoxy-8-phosphooctulonate synthase [Brevundimonas diminuta ATCC
           11568]
          Length = 300

 Score =  311 bits (797), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 201/285 (70%), Gaps = 1/285 (0%)

Query: 14  RRIDKNHMIHTNAAIHLGSG-KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQ 72
           + ++   +   NA I L  G K  V      R V IAGPCQ++S  HA   A  L  I +
Sbjct: 2   KPVESAAVTSPNAVITLSEGLKTPVVIGGGARIVFIAGPCQMQSRQHALETAHALKEIGE 61

Query: 73  SLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIA 132
            LN+G++YK+SFDKANR+S +  RG+GLK    IF ++++  G P LTDVH+E QC  + 
Sbjct: 62  RLNLGIIYKTSFDKANRTSASAARGIGLKDALPIFAEIREVTGLPTLTDVHSEAQCGPVG 121

Query: 133 DSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFC 192
           + VD+LQIPA L RQTDLL AAA TG+ IN+KKGQFL+PW+M N++ K+   G  +V+ C
Sbjct: 122 EYVDVLQIPAFLSRQTDLLLAAAATGKAINIKKGQFLAPWDMKNVIAKVTGAGNPNVMAC 181

Query: 193 ERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAA 252
           ERG SFGYNTLV+DMR++PI+  +G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AA
Sbjct: 182 ERGASFGYNTLVSDMRALPILREIGCPVVFDATHSVQQPGGQGTSSGGQREFVPVLARAA 241

Query: 253 VAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKI 297
           V++G+  +F+ETH+DPDNAPSDGPNM+ +     L ++L+A D +
Sbjct: 242 VSVGVDAVFMETHEDPDNAPSDGPNMVPLSQFEALAAELIAFDDL 286


>gi|114770366|ref|ZP_01447904.1| 2-dehydro-3-deoxyphosphooctonate aldolase [alpha proteobacterium
           HTCC2255]
 gi|114549203|gb|EAU52086.1| 2-dehydro-3-deoxyphosphooctonate aldolase [alpha proteobacterium
           HTCC2255]
          Length = 278

 Score =  311 bits (797), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 193/265 (72%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N    SN+    +I+GPCQ+ES DH+  IAE L   C   +   ++K SFDKANR+S+ G
Sbjct: 8   NNFEISNDSPLTIISGPCQLESIDHSLNIAETLMKACSKFDANFIFKGSFDKANRTSMNG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G+++G  + +++K   G P +TDVHT +QC  +A  VD+LQIPA LCRQTDLL AA
Sbjct: 68  KRGLGIEEGLRVMQEVKSNLGCPTITDVHTAEQCSQVAKIVDVLQIPAFLCRQTDLLLAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KKGQFL+PW+MHN+L+K+   G   ++ CERGTSFGYNTLV DMR +P M 
Sbjct: 128 AKTNAIINIKKGQFLAPWDMHNVLEKVSTSGNNKIMACERGTSFGYNTLVADMRGLPEMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G+PVI DA+HSVQQPG +G  SGG+R++   +A+ AV++GIAG+F+E H+DP+NAPSD
Sbjct: 188 RNGIPVIMDATHSVQQPGGNGGSSGGQREFAPVMARCAVSLGIAGVFIECHEDPNNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNMI +  +P L+  L+  D + K
Sbjct: 248 GPNMIELNRMPDLIKSLMEFDILAK 272


>gi|84501337|ref|ZP_00999542.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanicola batsensis
           HTCC2597]
 gi|84390628|gb|EAQ03116.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanicola batsensis
           HTCC2597]
          Length = 273

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 201/262 (76%)

Query: 40  SNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVG 99
           SN   ++LIAGPCQ+ES +H+ M+AEK+ A  ++     V+K+S+DKANRSSL+GKRG+G
Sbjct: 12  SNAHPYMLIAGPCQMESLEHSRMLAEKIAAAAEAAGRPWVFKASYDKANRSSLSGKRGLG 71

Query: 100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGR 159
           ++KG  I  D+ K++G P+LTDVH   QC   A+ VDILQIPA L RQTDLL AA +TG+
Sbjct: 72  MEKGLRILGDIAKEFGCPVLTDVHEPGQCAVAAEVVDILQIPAFLSRQTDLLLAAGETGK 131

Query: 160 VINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
            +NVKKGQFL+PW+M N++ K+ + G ++++ CERG SFGYN LV+D RS+PIM   G P
Sbjct: 132 ALNVKKGQFLAPWDMQNVVDKIASTGNENIMLCERGASFGYNMLVSDFRSLPIMAQTGCP 191

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           V+FDA+HSVQ PG  G  +GG+R+++ PLA+AA+A+G A +F+ETH DPDNAPSDGPNM+
Sbjct: 192 VVFDATHSVQLPGGLGGSTGGQREFVEPLARAAMAVGTAAVFIETHDDPDNAPSDGPNMV 251

Query: 280 NIKDLPKLLSQLLAIDKIIKPL 301
            I DLP+LL  L AID + K L
Sbjct: 252 PIADLPRLLKGLAAIDDLTKGL 273


>gi|75676022|ref|YP_318443.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitrobacter winogradskyi
           Nb-255]
 gi|123759310|sp|Q3SRK0|KDSA_NITWN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|74420892|gb|ABA05091.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitrobacter winogradskyi
           Nb-255]
          Length = 287

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 151/282 (53%), Positives = 207/282 (73%), Gaps = 5/282 (1%)

Query: 19  NHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGL 78
           N  +  +  + +GS    VTF  ++   +IAGPCQ+ES  HA  +A  L  I   LN+GL
Sbjct: 2   NQPVSASPVVSVGS----VTFGQDRPLSIIAGPCQMESRAHALEVAGALKDIAARLNVGL 57

Query: 79  VYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDIL 138
           V+K+SFDKANR+S +G RG+GLK+   +F D++   G P+LTDVH   QC  +A  VD+L
Sbjct: 58  VFKTSFDKANRTSASGARGIGLKQALPVFADIRSSLGLPVLTDVHEAAQCAEVAQVVDVL 117

Query: 139 QIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSF 198
           QIPA LCRQTDLL AAA TG+V+NVKKGQFL+PW+M N++ K+   G +++L  ERG SF
Sbjct: 118 QIPAFLCRQTDLLLAAAATGKVVNVKKGQFLAPWDMGNVVAKITGGGNRNILVTERGASF 177

Query: 199 GYNTLVTDMRSIPIMT-SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGI 257
           GYNTLV+DMR++PI+  + G PVIFDA+HSVQQPG  G  +GGER+++  LA+AAVA+G+
Sbjct: 178 GYNTLVSDMRALPILARTTGAPVIFDATHSVQQPGGKGASTGGEREFVPVLARAAVAVGV 237

Query: 258 AGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           AG+F+ETH DPD+APSDGPNM+ +++   L+ +L+A D + K
Sbjct: 238 AGVFIETHPDPDHAPSDGPNMVPLREFEALVRRLMAFDALAK 279


>gi|85704155|ref|ZP_01035258.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseovarius sp. 217]
 gi|85671475|gb|EAQ26333.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseovarius sp. 217]
          Length = 277

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 143/265 (53%), Positives = 193/265 (72%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N     N++    IAGPCQ+ES DHA MIA  L   C +   GL++K SFDKANR+SL+G
Sbjct: 7   NGWAIGNDRPLTFIAGPCQLESADHAQMIAGTLQEACAAFGAGLIFKGSFDKANRTSLSG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G+ +G ++ + +K   G P+LTD+HT  QC  +A+ VD+LQIPA L RQTDLL AA
Sbjct: 67  KRGLGIDEGLKVLQSVKDAVGLPVLTDIHTADQCAPVAEVVDVLQIPAFLSRQTDLLIAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG VINVKKGQFL+PW+M N++ K+ + G   ++  ERGTSFGYNTLV DMRS+P M 
Sbjct: 127 GETGAVINVKKGQFLAPWDMPNVISKIESTGNTRIMLTERGTSFGYNTLVADMRSLPQMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++G+A +F+ETH+DPDNAPSD
Sbjct: 187 ATGYPVVMDATHSVQQPGGRGGSSGGQREFAPVMARAAVSLGVASVFIETHEDPDNAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNMI +  +  L+  L+  D++ K
Sbjct: 247 GPNMIPLTQMSALIDTLMQFDRLAK 271


>gi|259419343|ref|ZP_05743260.1| 3-deoxy-8-phosphooctulonate synthase [Silicibacter sp. TrichCH4B]
 gi|259345565|gb|EEW57419.1| 3-deoxy-8-phosphooctulonate synthase [Silicibacter sp. TrichCH4B]
          Length = 277

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 196/265 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T  N+    +IAGPCQ+ES DHA MIA KL   C ++    V+K+S+DKANR+SL+G
Sbjct: 7   NGLTIGNDCPLTVIAGPCQLESADHAQMIAGKLKEACDAVGAQFVFKASYDKANRTSLSG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G+ KG ++   ++  +G P+LTDVHTE QC    D VDILQIPA LCRQTD+L AA
Sbjct: 67  KRGLGIDKGLDVLAGVRDTFGVPVLTDVHTEAQCIVAGDVVDILQIPAFLCRQTDMLLAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
             TG+ +N+KKGQFL+PW+M N++ K+ + G   +L  ERGTSFGYN LV DMR +P M 
Sbjct: 127 GNTGKAVNIKKGQFLAPWDMDNVVSKVESTGNDKILLTERGTSFGYNALVADMRGLPRMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+ DA+HSVQQPG  G  +GG+R++   +A+AAV++GIA +F+ETH+DPDNAPSD
Sbjct: 187 QTGYPVVMDATHSVQQPGGQGGSTGGQREFAPVMARAAVSLGIAAVFIETHEDPDNAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNMI +KD+P+L+  L+  DK+ K
Sbjct: 247 GPNMIYLKDMPQLIDTLMGFDKLAK 271


>gi|84683740|ref|ZP_01011643.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84668483|gb|EAQ14950.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacterales
           bacterium HTCC2654]
          Length = 276

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 143/265 (53%), Positives = 195/265 (73%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T   E     I GPCQ+ES DHA M+AEK+ A C+S     ++KSS+DKANRSS++ KR
Sbjct: 10  LTVGGENPVAFILGPCQLESLDHARMMAEKIAAACESAGAKFIFKSSYDKANRSSISTKR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+ +G  I   ++ ++G P+LTDVH   QC  + ++VD+LQIPA LCRQTDLL AA +
Sbjct: 70  GLGMDEGLTILSKIRDEFGVPVLTDVHDAHQCGPVGEAVDVLQIPAFLCRQTDLLLAAGE 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGR INVKKGQFL+PW++ N+  K+ + G + ++ C+RGTSFGYNTLVTD R +PIM   
Sbjct: 130 TGRAINVKKGQFLAPWDIGNVADKIASTGNEKIMLCDRGTSFGYNTLVTDFRGLPIMAQT 189

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQQPG  G  SGG+R++   LA+AA A+G++ +FLETH+DPDNAPSDGP
Sbjct: 190 GYPVVFDATHSVQQPGGQGTTSGGQREFAPILARAACAVGVSAVFLETHEDPDNAPSDGP 249

Query: 277 NMINIKDLPKLLSQLLAIDKIIKPL 301
           NMI + +L  +L+ L+  D + + L
Sbjct: 250 NMIPVDELAGVLTALVRYDALTREL 274


>gi|269119023|ref|YP_003307200.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sebaldella termitidis
           ATCC 33386]
 gi|268612901|gb|ACZ07269.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sebaldella termitidis
           ATCC 33386]
          Length = 281

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 186/265 (70%), Gaps = 1/265 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           +++T  N  R  L+AGPC IES D    +A KL  I   L I  V+KSSFDKANR+S+ G
Sbjct: 14  DKITIGN-SRITLLAGPCVIESEDLVMEVAAKLKEITDKLGINFVFKSSFDKANRTSIHG 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G++KG EI   +K+KYG P++TD+H   QCEA A  +DI+QIPA L RQTDLL AA
Sbjct: 73  FRGPGIEKGLEILNKVKEKYGVPLVTDIHEPWQCEAAAKVIDIIQIPAFLSRQTDLLVAA 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           AQTG+ +NVKKGQFL+PW+M N++ K    G  +++ CERG SFGYN LV DMRS+  M 
Sbjct: 133 AQTGKAVNVKKGQFLAPWDMKNVVSKFEEAGNTNIMLCERGASFGYNNLVVDMRSLLEMR 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G+ + G R+Y+ PL KAAV+IG+  +F E H DPD   SD
Sbjct: 193 KFGYPVVFDATHSVQIPGGKGSATDGNREYVYPLMKAAVSIGVDAVFAEVHPDPDKGMSD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ + D+ ++L+ +L ID ++K
Sbjct: 253 GPNMLRLDDMEEILTNILKIDDLVK 277


>gi|89056149|ref|YP_511600.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Jannaschia sp. CCS1]
 gi|88865698|gb|ABD56575.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Jannaschia sp. CCS1]
          Length = 277

 Score =  309 bits (792), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 146/263 (55%), Positives = 193/263 (73%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           ++ SN    ++IAGPCQ+ES DHA MIA  +  +C  +    V+K S+DKANR+SL GKR
Sbjct: 9   LSVSNTAPLLVIAGPCQLESLDHARMIAGHMSQVCAQVGAQFVFKGSYDKANRTSLDGKR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+  G EI   ++ + G P+LTDVHT +QC+ +A +VDILQIPA LCRQTDLL AA +
Sbjct: 69  GLGMTAGLEILATIRDELGCPVLTDVHTPEQCDPVAGAVDILQIPAFLCRQTDLLLAAGK 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG  INVKKGQFL+PW+M N+ QK+ + G + ++  ERG SFGYN LV DMRS+P M   
Sbjct: 129 TGAAINVKKGQFLAPWDMANVAQKVASTGNERLMLTERGVSFGYNALVADMRSLPEMAKT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVI DA+H+V QPG  G  SGG+R++   LA++AVA+GI G+FLETH+DPD APSDGP
Sbjct: 189 GYPVIMDATHAVAQPGGLGGSSGGQREFAPVLARSAVALGIGGVFLETHEDPDTAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI + D+  +L  L+A+DK+ K
Sbjct: 249 NMIRLDDMEGVLGTLMALDKVAK 271


>gi|310814634|ref|YP_003962598.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ketogulonicigenium
           vulgare Y25]
 gi|308753369|gb|ADO41298.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ketogulonicigenium
           vulgare Y25]
          Length = 277

 Score =  309 bits (792), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 191/263 (72%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           ++  N Q   LIAGPCQ+ES DHA MIA  L  ICQ      ++K S+DKANR+SL+G R
Sbjct: 9   LSVGNNQPLTLIAGPCQLESADHAQMIAGTLAEICQRTGAQFIFKGSYDKANRTSLSGTR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G++ G +I   ++  +G P+LTD+H  +QC  +A  VD+LQIPA LCRQTDLL AA +
Sbjct: 69  GLGMEAGLKILEGVRAAFGCPVLTDIHEREQCAEVASVVDVLQIPAFLCRQTDLLIAAGE 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG  IN+KKGQFL+PW+M N+  K+ + G   ++  ERG SFGYNTLVTDMRS+P M   
Sbjct: 129 TGAAINIKKGQFLAPWDMANVASKVASTGNNRIMLTERGVSFGYNTLVTDMRSLPTMART 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  GN SGG+R++   +A+ AV++GIA +F+ETHQDPDNAPSDGP
Sbjct: 189 GYPVVMDATHSVQQPGGQGNSSGGQREFAPVMARTAVSLGIAAVFIETHQDPDNAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  + +L++ L+A D + K
Sbjct: 249 NMIYLDQMDRLMTSLMAFDALAK 271


>gi|209963462|ref|YP_002296377.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodospirillum centenum
           SW]
 gi|209956928|gb|ACI97564.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodospirillum centenum
           SW]
          Length = 280

 Score =  309 bits (791), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 149/263 (56%), Positives = 206/263 (78%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T +N++ F LIAGPCQ+ES  HA  ++  L  I + L IGL+YK+SFDKANR+S++  R
Sbjct: 12  LTVANDRPFTLIAGPCQLESRQHALEMSGALVEITRRLGIGLIYKTSFDKANRTSVSTAR 71

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G++K   I  ++++ +G P+LTDVH  +QC A+A+ VD+LQIPA LCRQTDLL AA +
Sbjct: 72  GLGMEKSLPILAEVRETFGIPVLTDVHAPEQCAAVAEVVDVLQIPAFLCRQTDLLLAAGE 131

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGR +NVKKGQFL+PW+M N+  K+ + G  ++L CERG SFGYNTLV+DMRS+PIM + 
Sbjct: 132 TGRPVNVKKGQFLAPWDMKNVAAKIASTGNDNILLCERGASFGYNTLVSDMRSLPIMAAT 191

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVAIG+A +F+ETHQDPD+APSDGP
Sbjct: 192 GYPVVFDATHSVQQPGGQGTSSGGQREFVPVLARAAVAIGVAAVFMETHQDPDHAPSDGP 251

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ + +L  +L  ++A+D+I K
Sbjct: 252 NMVPVSELESILEVMVALDRIAK 274


>gi|91977290|ref|YP_569949.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris BisB5]
 gi|123749001|sp|Q136E1|KDSA_RHOPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|91683746|gb|ABE40048.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris BisB5]
          Length = 287

 Score =  309 bits (791), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 153/264 (57%), Positives = 193/264 (73%), Gaps = 1/264 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V F N     +IAGPCQ+ES  HA  +A  L  I   L IGLVYK+SFDKANR+S A  R
Sbjct: 16  VKFGNSLPLSVIAGPCQLESRAHALEVASALKEIATRLGIGLVYKTSFDKANRTSAASAR 75

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+GL     IF +++   G P+LTDVH  +QC   A++VDILQIPA LCRQTDLL AAA 
Sbjct: 76  GIGLDAALAIFAEIRDSVGLPVLTDVHEAEQCARAAEAVDILQIPAFLCRQTDLLLAAAA 135

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT-S 215
           TGR++NVKKGQFL+PW+M N++ K+   G + VL  ERG SFGYNTLV+DMR++PIM  +
Sbjct: 136 TGRIVNVKKGQFLAPWDMGNVVAKITTAGNQKVLVTERGASFGYNTLVSDMRALPIMART 195

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+AG+F+ETH DPD+APSDG
Sbjct: 196 TGAPVIFDATHSVQQPGGKGTSSGGEREFVPVLARAAVAVGVAGVFIETHPDPDHAPSDG 255

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ ++D   LL  L+  D + K
Sbjct: 256 PNMVPLRDFEALLRTLMEFDALAK 279


>gi|310779337|ref|YP_003967670.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ilyobacter polytropus
           DSM 2926]
 gi|309748660|gb|ADO83322.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ilyobacter polytropus
           DSM 2926]
          Length = 280

 Score =  308 bits (789), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 136/258 (52%), Positives = 184/258 (71%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           + RF LIAGPC IES + +  +A+K+  IC+SL I  ++KSS+DKANRSS+   RG+G++
Sbjct: 21  KNRFTLIAGPCAIESEEMSLRVAKKIKDICESLEIDYIFKSSYDKANRSSVFSARGIGME 80

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG  I + ++++ G P++TD+H   Q    A  VD+LQIPA LCRQTDL+ AAA+TG  +
Sbjct: 81  KGLNILKKVREEVGVPVITDIHEPWQAAEAAKFVDMLQIPAFLCRQTDLIVAAAKTGLPV 140

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  NI+ K    G   +L CERGT+FGYN  V DMRS   M   G PV+
Sbjct: 141 NVKKGQFLAPWDAKNIVTKFEEVGNNKLLLCERGTTFGYNNFVVDMRSFLEMRKFGYPVV 200

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG  G C+GG R+Y+ PL +AA+A+G+  IF E H+DPDNAP DGPNM+ +
Sbjct: 201 FDATHSVQIPGGQGTCTGGNREYVFPLMRAALAVGVDAIFAEVHEDPDNAPCDGPNMLKL 260

Query: 282 KDLPKLLSQLLAIDKIIK 299
           +DL ++L   + ID I+K
Sbjct: 261 EDLEEILKAAIEIDDIVK 278


>gi|158424688|ref|YP_001525980.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Azorhizobium caulinodans
           ORS 571]
 gi|158331577|dbj|BAF89062.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Azorhizobium caulinodans
           ORS 571]
          Length = 285

 Score =  308 bits (789), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 150/265 (56%), Positives = 194/265 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
            +V   N     LIAGPCQ+ES DHA   A  L  I   L IGL+YK+SFDKANR+S+  
Sbjct: 15  GKVRIGNSLPLALIAGPCQMESRDHALETAAALKEITDRLGIGLIYKTSFDKANRTSVNA 74

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+GL+K   +F ++ +++G P LTDVH   QC  + + VD+LQIPA LCRQTDLL AA
Sbjct: 75  ARGMGLEKALPVFAEIGERFGLPTLTDVHEIHQCAPVGEVVDVLQIPAFLCRQTDLLVAA 134

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TGRV+NVKKGQFL+PW+M N++ KL   G   VL  ERG SFGYNTLV+DMR +P+M 
Sbjct: 135 ARTGRVVNVKKGQFLAPWDMVNVVAKLTQSGNGRVLLTERGASFGYNTLVSDMRGLPVMA 194

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+A +F+ETH DPD+APSD
Sbjct: 195 QTGAPVVFDATHSVQQPGGKGASSGGQREFVPVLARAAVAVGVAAVFIETHPDPDHAPSD 254

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ +KDL  L++ L  ID++ K
Sbjct: 255 GPNMVPLKDLESLVALLQEIDRVAK 279


>gi|89068526|ref|ZP_01155923.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanicola granulosus
           HTCC2516]
 gi|89045945|gb|EAR52005.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanicola granulosus
           HTCC2516]
          Length = 277

 Score =  308 bits (789), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 196/263 (74%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           VTF N++  V+IAGPCQ+ES DHA  IAE++   C +   G V+K+S+DKANR+SL G+R
Sbjct: 9   VTFGNDRPLVVIAGPCQLESRDHALRIAEEMARACAAAGAGYVFKASYDKANRTSLEGRR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+ +G  +  D++   G P+LTD+H E  C   A++VDILQIPA LCRQTDLL AA +
Sbjct: 69  GLGMDEGLRVLADVRAALGCPVLTDIHAEAHCAPAAEAVDILQIPAFLCRQTDLLLAAGR 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG  INVKKGQFL+PW+M N+  K+ + G + +L  ERG SFGYN LVTDMR++PIM   
Sbjct: 129 TGAAINVKKGQFLAPWDMANVAAKVASTGNERILLTERGVSFGYNALVTDMRALPIMART 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+H+VQQPG  G  SGG+R++   LA+AAV++GIA +F+ETH+DPDNAPSDGP
Sbjct: 189 GYPVVMDATHAVQQPGGRGGSSGGQREFAPVLARAAVSLGIASVFIETHEDPDNAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +  L+++L+A D + K
Sbjct: 249 NMIPLGQMEALVARLMAFDALAK 271


>gi|188582149|ref|YP_001925594.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacterium populi
           BJ001]
 gi|179345647|gb|ACB81059.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacterium populi
           BJ001]
          Length = 284

 Score =  308 bits (788), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 152/265 (57%), Positives = 196/265 (73%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           VTF+N     LIAGPCQ+E   HA  +A  L  + Q L IGLV+KSSFDKANR+S    R
Sbjct: 17  VTFANHLPLALIAGPCQLEGRTHALEVASALKEMAQKLGIGLVFKSSFDKANRTSGRSAR 76

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           GVGL +   +F ++++  G P+LTDVH  +QC   A +VDILQIPA LCRQTDLL AAA 
Sbjct: 77  GVGLDEALPVFAEIRESLGLPVLTDVHEAEQCARAAQAVDILQIPAFLCRQTDLLLAAAA 136

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGRV+NVKKGQFL+PW+M ++  K+   G  +V+  ERG SFGYNTLV+DMR++PIM  +
Sbjct: 137 TGRVVNVKKGQFLAPWDMAHVASKVTQAGNPNVIVTERGASFGYNTLVSDMRALPIMARV 196

Query: 217 --GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETH DPD APSD
Sbjct: 197 TGGAPVVFDATHSVQQPGGQGATSGGQREFVAVLARAAVAVGVAGVFIETHPDPDRAPSD 256

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ + DLP L+  L+A D++ K
Sbjct: 257 GPNMVALADLPALVETLMAFDRLAK 281


>gi|300022977|ref|YP_003755588.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299524798|gb|ADJ23267.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 307

 Score =  308 bits (788), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 202/263 (76%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V F+N+    ++AGPCQ+ES  HA   A  L    ++L IGLVYKSSFDKANR+SL+G+R
Sbjct: 38  VLFANDAPISVLAGPCQMESRAHALETAAALAEAAKNLGIGLVYKSSFDKANRTSLSGRR 97

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+GL     IF ++++++G P++TDVH  +QC  +A+ VD+LQIPA LCRQTDLL AAA 
Sbjct: 98  GIGLDAALPIFAEIRERFGLPVVTDVHETEQCARVAEVVDVLQIPAFLCRQTDLLIAAAT 157

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGRVI +KKGQFL+PW+M N++ K+   G  +VL  ERG+SFGYNTLV DMR++P M   
Sbjct: 158 TGRVIKIKKGQFLAPWDMKNVVAKVTGSGNPNVLVTERGSSFGYNTLVVDMRALPQMAET 217

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVIFDA+H+VQQPG  G  SGG+R+++  LA+AAVA G+AG+F+ETH DPD+APSDGP
Sbjct: 218 GAPVIFDATHAVQQPGGQGTSSGGDRRFVPVLARAAVAAGVAGLFIETHPDPDHAPSDGP 277

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +KD   L+S+L AID+++K
Sbjct: 278 NMVPLKDFAALISELQAIDRVVK 300


>gi|27379911|ref|NP_771440.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bradyrhizobium japonicum
           USDA 110]
 gi|32171439|sp|Q89KV0|KDSA_BRAJA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|27353064|dbj|BAC50065.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bradyrhizobium japonicum
           USDA 110]
          Length = 282

 Score =  308 bits (788), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 150/265 (56%), Positives = 198/265 (74%), Gaps = 1/265 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
           +V F N+    +IAGPCQ+ES  HA  +A  L  I   LNIGLVYK+SFDKANR+S +  
Sbjct: 15  RVKFGNDLPISIIAGPCQLESRQHALEVASALKEIAARLNIGLVYKTSFDKANRTSASAA 74

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+GL +   IF +++   G P+LTDVH   QC  +A +VDILQIPA LCRQTDLL AAA
Sbjct: 75  RGLGLAQSLPIFAEIRSSLGLPVLTDVHEATQCAEVAQAVDILQIPAFLCRQTDLLLAAA 134

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT- 214
            TG+V+NVKKGQFL+PW+M N++ K+ +    +VL  ERG SFGYNTLV+DMR++PI+  
Sbjct: 135 ATGKVVNVKKGQFLAPWDMANVVTKITSANNPNVLVTERGASFGYNTLVSDMRALPILAR 194

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PVIFDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+AG+F+ETH DPD+APSD
Sbjct: 195 TTGAPVIFDATHSVQQPGGKGTSSGGEREFVPVLARAAVAVGVAGVFIETHPDPDSAPSD 254

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ +++   L+ +L+A D + K
Sbjct: 255 GPNMVPLREFEGLIRRLMAFDALAK 279


>gi|99080494|ref|YP_612648.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ruegeria sp. TM1040]
 gi|99036774|gb|ABF63386.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ruegeria sp. TM1040]
          Length = 277

 Score =  308 bits (788), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 194/265 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T  N+    +IAGPCQ+ES DHA MIA KL   C +     ++K+S+DKANR+SL+G
Sbjct: 7   NGLTIGNDCPLTVIAGPCQLESADHAQMIAGKLKEACDAAGAQFIFKASYDKANRTSLSG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G+ KG E+   ++  +G P+LTDVHTE QC    D VD+LQIPA LCRQTD+L AA
Sbjct: 67  KRGLGIDKGLEVLAGVRDTFGVPVLTDVHTEAQCIVAGDVVDVLQIPAFLCRQTDMLLAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
             TG+ +N+KKGQFL+PW+M N++ K+ + G   +L  ERGTSFGYN LV DMR +P M 
Sbjct: 127 GNTGKAVNIKKGQFLAPWDMDNVVAKVESTGNDKILLTERGTSFGYNALVADMRGLPRMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+ DA+HSVQQPG  G  +GG+R++   +A+AAV++GIA +F+ETH+DPDNAPSD
Sbjct: 187 QTGYPVVMDATHSVQQPGGQGGSTGGQREFAPVMARAAVSLGIASVFIETHEDPDNAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNMI +KD+P+L+  L+  D + K
Sbjct: 247 GPNMIYLKDMPQLIETLMGFDALAK 271


>gi|313204154|ref|YP_004042811.1| 2-dehydrO-3-deoxyphosphooctonate aldolase [Paludibacter
           propionicigenes WB4]
 gi|312443470|gb|ADQ79826.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Paludibacter
           propionicigenes WB4]
          Length = 456

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 141/267 (52%), Positives = 189/267 (70%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N+       RFVLIAGPC IES +   M+A KL  IC+ L+I L++KSSFDKANRSS+  
Sbjct: 12  NRFEIGGSNRFVLIAGPCAIESEEMTMMVAAKLKEICEELDIHLIFKSSFDKANRSSVKA 71

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G+K+G EI + +K +   PI+TDVH   QC  +A   D+LQIPA L RQTDLL AA
Sbjct: 72  PRGLGMKRGLEILQRVKTELDLPIVTDVHEAWQCAEVAKVADMLQIPAFLSRQTDLLVAA 131

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           AQTG+++NVKKGQF++PW+M N++ KL   G +++L CERG+SFGYN LV DM  +  M 
Sbjct: 132 AQTGKIVNVKKGQFMAPWDMKNVIDKLRDSGNENILLCERGSSFGYNNLVVDMTGLVEMR 191

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PV+FDA+H+VQ+PG  G  +GG R+ +  L +AA+A+G+  IF E H DPD+A SD
Sbjct: 192 SYGFPVVFDATHAVQKPGGQGTSTGGNREMVPYLMRAALAVGVDAIFAEVHPDPDHAFSD 251

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GPN I++  + ++L Q +AID I K L
Sbjct: 252 GPNQIHLSRIKEILEQAIAIDNITKQL 278


>gi|254441710|ref|ZP_05055203.1| 3-deoxy-8-phosphooctulonate synthase [Octadecabacter antarcticus
           307]
 gi|198251788|gb|EDY76103.1| 3-deoxy-8-phosphooctulonate synthase [Octadecabacter antarcticus
           307]
          Length = 277

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 144/272 (52%), Positives = 199/272 (73%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           + +GS    +T SN++   +IAGPCQ+ES  HA MIAE++  +C +     V+K S+DKA
Sbjct: 4   VQIGS----ITASNDRPLTVIAGPCQLESLAHARMIAEQMAKVCDAHGAQFVFKGSYDKA 59

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NR+SL+G+RG+G+ +G  I   +K ++G P+LTD+HT  QC  +A+ VDILQIPA LCRQ
Sbjct: 60  NRTSLSGRRGLGIDEGLAIHAAIKAEFGCPVLTDIHTANQCAPVAEVVDILQIPAFLCRQ 119

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDLL AA +TG  +N+KKGQFL+PW+M N++ K+ + G   +L  ERG SFGYN LVTDM
Sbjct: 120 TDLLLAAGETGAAVNIKKGQFLAPWDMANVVSKVESTGNTRILLTERGVSFGYNALVTDM 179

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
           RS+P M   G PV+ DA+H+V QPG  G  SGG+R++   LA+AAVA+GI  +FLETH++
Sbjct: 180 RSLPEMMKTGYPVVMDATHAVAQPGGLGGSSGGQREFAPVLARAAVAVGIGAVFLETHEN 239

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNAPSDGPNMI ++D+  +L  L+A+D + K
Sbjct: 240 PDNAPSDGPNMIALRDMDGVLKTLMALDLVAK 271


>gi|312113149|ref|YP_004010745.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311218278|gb|ADP69646.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 278

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 193/263 (73%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V   N     L AGPCQ+ES  HA  +A  L  I   L IGLVYK+SFDKANR+S   KR
Sbjct: 15  VRLGNALPLALFAGPCQLESRAHALEMASALKEIAGRLGIGLVYKTSFDKANRTSANAKR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+GL     IF ++++  G PI+TDVH   QC  +A++VD+LQIPA LCRQTDLL AAA+
Sbjct: 75  GLGLDAALPIFAEIRESLGLPIVTDVHEASQCARVAEAVDVLQIPAFLCRQTDLLIAAAE 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGRV+ VKKGQFL+PW+M N++ K+ A G  +VL  ERG SFGYNTLVTDMR++PI+   
Sbjct: 135 TGRVVKVKKGQFLAPWDMKNVVAKVLAAGNPNVLVTERGASFGYNTLVTDMRALPILAET 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+A +F+ETHQDPD+APSDGP
Sbjct: 195 GAPVVFDATHSVQQPGGQGTATGGDRRFVPVLARAAVAVGVAAVFIETHQDPDHAPSDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ + +L  LL  L A D++ K
Sbjct: 255 NMVPLGELEALLRNLQAFDRLAK 277


>gi|329847846|ref|ZP_08262874.1| 3-deoxy-8-phosphooctulonate synthase [Asticcacaulis biprosthecum
           C19]
 gi|328842909|gb|EGF92478.1| 3-deoxy-8-phosphooctulonate synthase [Asticcacaulis biprosthecum
           C19]
          Length = 271

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 141/263 (53%), Positives = 192/263 (73%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +    ++ F LIAGPCQIES DHA M+AE++   C       +YKSS+DKANRSS+   R
Sbjct: 7   IQIGGDEPFALIAGPCQIESRDHALMMAERIAEACAPTGTKFIYKSSYDKANRSSIGTAR 66

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+ +G +I  D++ ++G P+LTDVH   QC  +   VD++QIPA LCRQTDLL AA +
Sbjct: 67  GIGMDEGLQILADVRAQFGCPVLTDVHDAYQCPPVGQVVDVIQIPAFLCRQTDLLLAAGE 126

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ INVKKGQFL+PW+M N+ +K+ + G + V+ C+RGTSFGYNTLVTD R +PIM   
Sbjct: 127 TGKAINVKKGQFLAPWDMANVAKKIASTGNERVMLCDRGTSFGYNTLVTDFRGLPIMAQT 186

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G P++FDA+HSVQQPG  G  SGG+R++   LA+AA AIG++ +F+ETH++PD APSDGP
Sbjct: 187 GYPIVFDATHSVQQPGGQGTTSGGQREFAPVLARAACAIGVSAVFIETHENPDCAPSDGP 246

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI I+ + +L+  L A D + K
Sbjct: 247 NMIPIEQMRELIGVLRAFDDLAK 269


>gi|254420742|ref|ZP_05034466.1| 3-deoxy-8-phosphooctulonate synthase [Brevundimonas sp. BAL3]
 gi|196186919|gb|EDX81895.1| 3-deoxy-8-phosphooctulonate synthase [Brevundimonas sp. BAL3]
          Length = 283

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 190/264 (71%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
           +  V      R   IAGPCQ+ES  HA   A  L  I + LN+G++YK+SFDKANR+S +
Sbjct: 6   RTPVVIGGGARIAFIAGPCQMESRQHALETAHALKEIGERLNVGIIYKTSFDKANRTSAS 65

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RG+GLK    IF ++++  G P LTDVH+E QC  + + VD+LQIPA L RQTDLL A
Sbjct: 66  AARGIGLKDAMPIFAEIRETVGLPTLTDVHSEAQCGPVGEVVDVLQIPAFLSRQTDLLLA 125

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
           AA TG+ IN+KKGQFL+PW+M N++ K+   G  +V+ CERG SFGYNTLV+DMR++P++
Sbjct: 126 AAATGKAINIKKGQFLAPWDMKNVIAKVVGAGNPNVMACERGASFGYNTLVSDMRALPVL 185

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
             +G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAV++G+  +F+ETH DPDNAPS
Sbjct: 186 REIGCPVVFDATHSVQQPGGQGTSSGGQREFVPVLARAAVSVGVDAVFMETHPDPDNAPS 245

Query: 274 DGPNMINIKDLPKLLSQLLAIDKI 297
           DGPNM+ +     L +QL+A D +
Sbjct: 246 DGPNMVPLDQFEALAAQLIAFDDL 269


>gi|220909562|ref|YP_002484873.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cyanothece sp. PCC 7425]
 gi|254807738|sp|B8HXG7|KDSA_CYAP4 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|219866173|gb|ACL46512.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cyanothece sp. PCC 7425]
          Length = 273

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 188/258 (72%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           ++  + Q F LI GPC IES D    +A+++  IC  L I  ++KSSFDKANR+S+   R
Sbjct: 10  LSIGDGQPFALIGGPCVIESEDFCLKMADQIRQICDRLQISYIFKSSFDKANRTSIDSFR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G  L+ G +  + +K+K G P+LTD+H   Q   +A+ VD+LQIPA LCRQTDLL AAA 
Sbjct: 70  GQSLEDGLQTLQRVKEKIGVPVLTDIHESYQAAIVAEVVDVLQIPAFLCRQTDLLLAAAA 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGRVINVKKGQFL+PW+M N+++KL   GA+++L  ERG+SFGYNTLV D RS+P M ++
Sbjct: 130 TGRVINVKKGQFLAPWDMQNVVKKLEQGGAQNILLTERGSSFGYNTLVVDFRSLPQMRAL 189

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQ PG  GN SGG+R+++  LA+AAVA+GI  +F+E H++P+ A SDGP
Sbjct: 190 GYPVVFDATHSVQMPGGKGNSSGGQREFVPYLARAAVAVGIDALFMEIHENPEQALSDGP 249

Query: 277 NMINIKDLPKLLSQLLAI 294
           NM+ +  L   L QLLAI
Sbjct: 250 NMVYLSQLEAYLQQLLAI 267


>gi|163747509|ref|ZP_02154859.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanibulbus indolifex
           HEL-45]
 gi|161379187|gb|EDQ03606.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanibulbus indolifex
           HEL-45]
          Length = 277

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 192/263 (73%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T  N++   +IAGPCQ+ES DHA MIA  L   C +     ++K+S+DKANR+SL+GKR
Sbjct: 9   LTVGNDRPLTVIAGPCQLESEDHAQMIAGVLKEACNAAGAQFIFKASYDKANRTSLSGKR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G++KG ++ + + +    P+LTDVH E QC    + VD+LQIPA LCRQTD+L AA +
Sbjct: 69  GLGIEKGLQVLQSVARANDVPVLTDVHNEAQCAQAGEVVDVLQIPAFLCRQTDILLAAGE 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +NVKKGQFL+PWEM NI+ K+ + G K++L  ERGT+FGYNTLV DMRS+P M   
Sbjct: 129 TGKAVNVKKGQFLAPWEMQNIVDKIESTGNKNILLTERGTTFGYNTLVADMRSLPQMAQT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSV QPG  G  SGG+R++   +A+AA +IG+A IF+ETH+DPD APSDGP
Sbjct: 189 GYPVVMDATHSVAQPGGKGGSSGGQREFAPVMARAAASIGVAAIFMETHEDPDRAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +P L++ L+  D + K
Sbjct: 249 NMIYLDQMPGLINLLMQFDALAK 271


>gi|255261577|ref|ZP_05340919.1| 3-deoxy-8-phosphooctulonate synthase [Thalassiobium sp. R2A62]
 gi|255103912|gb|EET46586.1| 3-deoxy-8-phosphooctulonate synthase [Thalassiobium sp. R2A62]
          Length = 277

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 139/263 (52%), Positives = 193/263 (73%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           ++ SN    ++IAGPCQ+ES DHA MIA  +   C +     V+K S+DKANR+SL+GKR
Sbjct: 9   LSVSNAAPLMVIAGPCQLESVDHAQMIAGTMQEACAAAGAQFVFKGSYDKANRTSLSGKR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+ +G ++ + +K+ +G P+LTD+HT +QC  +A  VD+LQIPA LCRQTDLL AA +
Sbjct: 69  GLGMDQGLKVLQSVKETFGVPVLTDIHTPEQCATVASVVDVLQIPAFLCRQTDLLIAAGE 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VINVKKGQFL+PW+M N+  K+ + G + ++  ERG SFGYN LV DMR++P M   
Sbjct: 129 TGAVINVKKGQFLAPWDMANVADKVASTGNEKIMLTERGVSFGYNALVADMRALPEMAKT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+H+V QPG  G  SGG+R++   LA++AVA+GIA +FLETH+ P+ APSDGP
Sbjct: 189 GYPVVMDATHAVAQPGGLGGSSGGQREFAPVLARSAVALGIASVFLETHEAPNTAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI + D+P L+  L+A D++ K
Sbjct: 249 NMIALADMPHLMQTLMAFDRVAK 271


>gi|83854719|ref|ZP_00948249.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfitobacter sp.
           NAS-14.1]
 gi|83941242|ref|ZP_00953704.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfitobacter sp. EE-36]
 gi|83842562|gb|EAP81729.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfitobacter sp.
           NAS-14.1]
 gi|83847062|gb|EAP84937.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfitobacter sp. EE-36]
          Length = 277

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 194/263 (73%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V   N++   +IAGPCQ+ES  HA MIA ++   C ++    V+K+S+DKANR+SL GKR
Sbjct: 9   VVIGNDRPLTVIAGPCQLESETHAQMIAGQMKEACDAVGAQFVFKASYDKANRTSLGGKR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+ +G  + + + K  G P+LTDVHTE QC   A++VDILQIPA LCRQTD+L AA  
Sbjct: 69  GLGIDEGLAVLQSVGKSIGVPVLTDVHTEAQCAIAAEAVDILQIPAFLCRQTDMLLAAGN 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+V+NVKKGQFL+PW+M N++ K+ + G K +L  ERGTSFGYNTLV DMRS+P M   
Sbjct: 129 TGKVVNVKKGQFLAPWDMPNVVAKIESTGNKRILLTERGTSFGYNTLVADMRSLPQMAQT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAVAIG+  +F+ETH+DPDNAPSDGP
Sbjct: 189 GYPVVMDATHSVQQPGGQGGSSGGQREFAPVMARAAVAIGVGAVFIETHEDPDNAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +P L++ L+  D + K
Sbjct: 249 NMIYLDQMPALVASLMKFDALAK 271


>gi|254503717|ref|ZP_05115868.1| 3-deoxy-8-phosphooctulonate synthase [Labrenzia alexandrii DFL-11]
 gi|222439788|gb|EEE46467.1| 3-deoxy-8-phosphooctulonate synthase [Labrenzia alexandrii DFL-11]
          Length = 283

 Score =  305 bits (781), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 206/280 (73%), Gaps = 5/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   N  +++GS    V+F+N   F LIAGPCQ+ES DHA   A  +  I   L I +VY
Sbjct: 1   MTEANRTVNVGS----VSFNNSAPFSLIAGPCQLESRDHALECAAAVKEIAGGLGIPVVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL+  RG+GL +   IF ++K+ +G P+LTD+H  +QC  +A+ VD+LQI
Sbjct: 57  KSSFDKANRTSLSATRGIGLNEALPIFAEIKETFGLPVLTDIHNAEQCAPVAEVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG VINVKKGQFL+PW+M N+L+K+   G  +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLVAAAETGAVINVKKGQFLAPWDMKNVLRKITDSGNPNVLLTERGASFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLVTDMR++PIM   G PV+FDA+HSVQQPG  G  SGG+R+ +  LA+AA A+G+ G+
Sbjct: 177 NTLVTDMRALPIMAQTGAPVVFDATHSVQQPGGLGGSSGGDREMVAVLARAAAAVGVGGV 236

Query: 261 FLETHQDPDN-APSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+ETH DP+N   SDGPNMI +++L  LL++L AID ++K
Sbjct: 237 FIETHPDPENTTSSDGPNMIALRNLGALLAELKAIDAVVK 276


>gi|39935944|ref|NP_948220.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris CGA009]
 gi|48428285|sp|P61657|KDSA_RHOPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|39649798|emb|CAE28320.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris CGA009]
          Length = 287

 Score =  305 bits (780), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 152/265 (57%), Positives = 192/265 (72%), Gaps = 1/265 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            V F N     +IAGPCQ+ES  HA  +A  L  I   L IGLVYK+SFDKANR+S A  
Sbjct: 15  NVKFGNALPLSVIAGPCQLESRAHALEVASALKEIATRLGIGLVYKTSFDKANRTSAASA 74

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+GL     IF +++   G P+LTDVH  +QC   A++VDILQIPA LCRQTDLL AAA
Sbjct: 75  RGLGLDAALPIFAEIRDHLGLPVLTDVHENEQCARAAEAVDILQIPAFLCRQTDLLLAAA 134

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT- 214
            TGR++NVKKGQFL+PW+M N++ K+   G   VL  ERG SFGYNTLV+DMR++PIM  
Sbjct: 135 ATGRIVNVKKGQFLAPWDMGNVVSKITHAGNSKVLVTERGVSFGYNTLVSDMRALPIMAK 194

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PVIFDA+HSVQQPG  G  SGGER+Y+  LA+AAVA+G+AG+F+ETH DPD+APSD
Sbjct: 195 TTGAPVIFDATHSVQQPGGKGTSSGGEREYVPVLARAAVAVGVAGVFIETHPDPDHAPSD 254

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ +++   L+  L+  D + K
Sbjct: 255 GPNMVPLREFEALIKTLMEFDALAK 279


>gi|294678396|ref|YP_003579011.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacter capsulatus SB
           1003]
 gi|294477216|gb|ADE86604.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacter capsulatus SB
           1003]
          Length = 277

 Score =  305 bits (780), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 145/264 (54%), Positives = 193/264 (73%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
           ++T +N+    +IAGPCQ+ES  HA MIAE +   C +     V+K SFDKANR+SL GK
Sbjct: 8   RLTVANDLPLTVIAGPCQLESLPHALMIAEVMAEACAAAGAQFVFKGSFDKANRTSLKGK 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RGVGL+ G  I   ++ K G P+LTD+H  +Q    A  VD++QIPA LCRQTDLL AA 
Sbjct: 68  RGVGLEAGLAILDTVRAKLGCPVLTDIHDPEQARIAAQVVDVIQIPAFLCRQTDLLIAAG 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TGRV+N+KKGQFL+PW+M N+ +K+ + G + +L  ERGTSFGYNTLV DMR +P+M  
Sbjct: 128 ETGRVVNIKKGQFLAPWDMPNVAEKVASTGNEKILLTERGTSFGYNTLVADMRGLPVMAK 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVI DA+HSVQQPG  G  SGG+R+    +A+AAV++GIAG+F+ETH+ PD APSDG
Sbjct: 188 TGYPVIMDATHSVQQPGGLGGASGGQREMAPVMARAAVSLGIAGVFIETHEAPDTAPSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNMI +  +PKL++ L+A D++ K
Sbjct: 248 PNMIPLDQMPKLIATLMAFDRLAK 271


>gi|192291595|ref|YP_001992200.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris TIE-1]
 gi|238692565|sp|B3Q6L6|KDSA_RHOPT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|192285344|gb|ACF01725.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris TIE-1]
          Length = 287

 Score =  304 bits (779), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 152/265 (57%), Positives = 192/265 (72%), Gaps = 1/265 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            V F N     +IAGPCQ+ES  HA  +A  L  I   L IGLVYK+SFDKANR+S A  
Sbjct: 15  NVKFGNALPLSVIAGPCQLESRAHALEVASALKEIATRLGIGLVYKTSFDKANRTSAASA 74

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+GL     IF +++   G P+LTDVH  +QC   A++VDILQIPA LCRQTDLL AAA
Sbjct: 75  RGLGLDAALPIFAEIRDHLGLPVLTDVHENEQCARAAEAVDILQIPAFLCRQTDLLLAAA 134

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT- 214
            TGR++NVKKGQFL+PW+M N++ K+   G   VL  ERG SFGYNTLV+DMR++PIM  
Sbjct: 135 ATGRIVNVKKGQFLAPWDMGNVVSKITHAGNAKVLVTERGVSFGYNTLVSDMRALPIMAK 194

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PVIFDA+HSVQQPG  G  SGGER+Y+  LA+AAVA+G+AG+F+ETH DPD+APSD
Sbjct: 195 TTGAPVIFDATHSVQQPGGKGTSSGGEREYVPVLARAAVAVGVAGVFIETHPDPDHAPSD 254

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ +++   L+  L+  D + K
Sbjct: 255 GPNMVPLREFEALIKTLMEFDALAK 279


>gi|91206160|ref|YP_538515.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia bellii
           RML369-C]
 gi|157826538|ref|YP_001495602.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia bellii OSU
           85-389]
 gi|123266174|sp|Q1RGT8|KDSA_RICBR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166220455|sp|A8GUR8|KDSA_RICB8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|91069704|gb|ABE05426.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia bellii RML369-C]
 gi|157801842|gb|ABV78565.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia bellii OSU
           85-389]
          Length = 274

 Score =  304 bits (779), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 199/259 (76%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N+  F LIAGPCQIE  DHA  +AE+L  +   LNI  +YKSSFDKANR+S+ G RG+G+
Sbjct: 14  NDLPFTLIAGPCQIEGLDHALFMAEELVKLTTRLNIPFIYKSSFDKANRTSVNGARGLGI 73

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG E+  ++K+ +  PI+TDVH+E QC  +A  VD+LQIPA LCRQTDLL AAA TG++
Sbjct: 74  DKGLEVLAEVKRAFNCPIVTDVHSENQCAEVAKIVDMLQIPAFLCRQTDLLQAAAATGKI 133

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +NVKKGQFL+PW+M N+ +KL + GAKD+L  ERGT FGYN LV+DMR + IM  +  PV
Sbjct: 134 VNVKKGQFLAPWDMKNVHKKLESFGAKDILLTERGTCFGYNNLVSDMRGLAIMAELNTPV 193

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           IFDA+HSVQQPG  G  +GGER+Y+  LAKAAVA+G+AG+++E HQDPDNAPSDGP MI 
Sbjct: 194 IFDATHSVQQPGGLGGSTGGERKYVELLAKAAVAVGVAGLYMEVHQDPDNAPSDGPCMIR 253

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           + +L ++L++L   D+I K
Sbjct: 254 LDNLERVLTKLKKYDEITK 272


>gi|86749901|ref|YP_486397.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris HaA2]
 gi|123292545|sp|Q2IWC4|KDSA_RHOP2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|86572929|gb|ABD07486.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris HaA2]
          Length = 287

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 152/266 (57%), Positives = 193/266 (72%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             V F N     +IAGPCQ+ES  HA  +A  L  I + L IG+VYK+SFDKANR+S A 
Sbjct: 14  GDVKFGNALPLSVIAGPCQLESRAHALEVAAALQEIGKRLGIGIVYKTSFDKANRTSAAS 73

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+GL     IF +++   G P+LTDVH   QC   A++VDILQIPA LCRQTDLL AA
Sbjct: 74  ARGIGLDGALPIFAEIRDSIGLPVLTDVHEAGQCARAAEAVDILQIPAFLCRQTDLLLAA 133

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A TGR++NVKKGQFL+PW+M N++ K+ + G   VL  ERG SFGYNTLV+DMR++PIM 
Sbjct: 134 AATGRIVNVKKGQFLAPWDMGNVVAKITSAGNPKVLVTERGVSFGYNTLVSDMRALPIMA 193

Query: 215 -SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
            + G PVIFDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+AG+F+ETH DPD+APS
Sbjct: 194 KTTGAPVIFDATHSVQQPGGKGTSSGGEREFVPVLARAAVAVGVAGVFIETHPDPDHAPS 253

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGPNM+ ++D   LL  L+  D + K
Sbjct: 254 DGPNMVPLRDFESLLRTLMEFDALAK 279


>gi|316933962|ref|YP_004108944.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris DX-1]
 gi|315601676|gb|ADU44211.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris DX-1]
          Length = 287

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 151/265 (56%), Positives = 193/265 (72%), Gaps = 1/265 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            V F N     +IAGPCQ+ES  HA  +A  L  I   L IGLVYK+SFDKANR+S A  
Sbjct: 15  NVKFGNALPLSVIAGPCQLESRAHALEVASALKEIATRLGIGLVYKTSFDKANRTSAASA 74

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+GL     IF +++ + G P+LTDVH  +QC   A++VDILQIPA LCRQTDLL AAA
Sbjct: 75  RGLGLDAALPIFAEIRDELGLPVLTDVHESEQCARAAEAVDILQIPAFLCRQTDLLLAAA 134

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT- 214
            TG+++NVKKGQFL+PW+M N++ K+   G   VL  ERG SFGYNTLV+DMR++PIM  
Sbjct: 135 ATGKIVNVKKGQFLAPWDMGNVVAKITHAGNPKVLVTERGVSFGYNTLVSDMRALPIMAK 194

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PVIFDA+HSVQQPG  G  SGGER+Y+  LA+AAVA+G+AG+F+ETH DPD+APSD
Sbjct: 195 TTGAPVIFDATHSVQQPGGKGTSSGGEREYVPVLARAAVAVGVAGVFIETHPDPDHAPSD 254

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ +++   L+  L+  D + K
Sbjct: 255 GPNMVPLREFEGLMKTLMEFDALAK 279


>gi|221634580|ref|YP_002523268.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           KD131]
 gi|221163453|gb|ACM04415.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           KD131]
          Length = 669

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 188/257 (73%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             LI GPCQ+ES DHA M+AE++   C       ++K+S+DKANRSSL+  RG+G++KG 
Sbjct: 412 IALITGPCQLESLDHARMMAERIAEACAPTGTKFIFKASYDKANRSSLSTARGLGMEKGL 471

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           EI   +++++G P+LTDVH    C   A+  D+LQIPA LCRQTDLL AA +TGR +NVK
Sbjct: 472 EILGRIREEFGVPVLTDVHEPGHCATAAEVCDVLQIPAFLCRQTDLLLAAGETGRAVNVK 531

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+PW+M N+  K+ + G + +L CERGTSFGYNTLVTD R +P M + G PV+FDA
Sbjct: 532 KGQFLAPWDMKNVADKVASTGNRRILLCERGTSFGYNTLVTDFRGLPTMAATGWPVVFDA 591

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQQPG  G  SGG+R++   LA+AA A+G++ +F+ETH+DPD APSDGPNMI +  +
Sbjct: 592 THSVQQPGGLGGSSGGQREFAPVLARAACAVGVSALFIETHEDPDRAPSDGPNMIPVDRM 651

Query: 285 PKLLSQLLAIDKIIKPL 301
            +L++ L A D + K L
Sbjct: 652 GRLIADLCAFDALAKSL 668


>gi|125654618|ref|YP_001033812.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           2.4.1]
 gi|126464811|ref|YP_001041787.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           ATCC 17029]
 gi|332561303|ref|ZP_08415618.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           WS8N]
 gi|77386278|gb|ABA81707.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           2.4.1]
 gi|126106626|gb|ABN79151.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           ATCC 17029]
 gi|332274102|gb|EGJ19419.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           WS8N]
          Length = 278

 Score =  302 bits (774), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 139/255 (54%), Positives = 188/255 (73%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LI GPCQ+ES DHA M+AE++   C       ++K+S+DKANRSSL+  RG+G++KG EI
Sbjct: 23  LITGPCQLESLDHARMMAERIAEACAPTGTKFIFKASYDKANRSSLSTARGLGMEKGLEI 82

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
              +++++G P+LTDVH    C   A+  D+LQIPA LCRQTDLL AA +TGR +NVKKG
Sbjct: 83  LGRIREEFGVPVLTDVHEPGHCATAAEVCDVLQIPAFLCRQTDLLLAAGETGRAVNVKKG 142

Query: 167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASH 226
           QFL+PW+M N+  K+ + G + +L CERGTSFGYNTLVTD R +P M + G PV+FDA+H
Sbjct: 143 QFLAPWDMKNVADKVASTGNRRILLCERGTSFGYNTLVTDFRGLPTMAATGWPVVFDATH 202

Query: 227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPK 286
           SVQQPG  G  SGG+R++   LA+AA A+G++ +F+ETH+DPD APSDGPNMI +  + +
Sbjct: 203 SVQQPGGLGGSSGGQREFAPVLARAACAVGVSALFIETHEDPDRAPSDGPNMIPVDRMGR 262

Query: 287 LLSQLLAIDKIIKPL 301
           L++ L A D + K L
Sbjct: 263 LIADLCAFDALAKSL 277


>gi|256027899|ref|ZP_05441733.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. D11]
 gi|289765848|ref|ZP_06525226.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. D11]
 gi|289717403|gb|EFD81415.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. D11]
          Length = 278

 Score =  302 bits (774), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 186/264 (70%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   
Sbjct: 13  NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIFKASFDKANRSSIYSY 72

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL+KG ++    K+K+  P++TDVH   QCE +A   DILQIPA LCRQTDLL AAA
Sbjct: 73  RGPGLEKGMKMLAKTKEKFNVPVITDVHEAWQCEEVAKVADILQIPAFLCRQTDLLIAAA 132

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ IN+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGYN +V DMRS+  M  
Sbjct: 133 ETGKAINIKKGQFLAPWDMKNIVVKMEESGNKNIMLCERGSTFGYNNMVVDMRSLLEMRK 192

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P+ A SDG
Sbjct: 193 FNYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPEEAKSDG 252

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +KDL ++L   + IDKI+K
Sbjct: 253 PNMLYLKDLEEILKTAIEIDKIVK 276


>gi|114570040|ref|YP_756720.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Maricaulis maris MCS10]
 gi|114340502|gb|ABI65782.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Maricaulis maris MCS10]
          Length = 282

 Score =  302 bits (774), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 147/280 (52%), Positives = 208/280 (74%), Gaps = 1/280 (0%)

Query: 21  MIHTNAAIHLG-SGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLV 79
           M   N+ I +   G++ +   N+++  +IAGPCQ+ES  H   ++ +L  I   L++GL+
Sbjct: 1   MSQVNSVISIPRPGQSPIEIGNDRKLSIIAGPCQLESRQHGLDVSARLREIADRLDVGLI 60

Query: 80  YKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQ 139
           YK+SFDKANR+S + +RG+GL+    +F ++++  G P+LTDVH+E+Q    A +VD+LQ
Sbjct: 61  YKTSFDKANRTSASAQRGLGLEASLPVFEEIRETSGLPVLTDVHSEEQARIAATAVDVLQ 120

Query: 140 IPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFG 199
           IPA LCRQTDLL AAA+TG+ INVKKGQFL+PW+M N+++K+ A G  D++ CERG SFG
Sbjct: 121 IPAFLCRQTDLLIAAAKTGKPINVKKGQFLAPWDMKNVIEKIAAAGNPDIMACERGASFG 180

Query: 200 YNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
           YNTLV+DMRS+PIM   G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+A 
Sbjct: 181 YNTLVSDMRSLPIMAQFGAPVVFDATHSVQQPGGQGTSSGGQREFVPTLARAAVAVGVAA 240

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +F+ETH DPDNAPSDGPNM+ + +   L+ +LL  D + K
Sbjct: 241 VFIETHPDPDNAPSDGPNMVPLGEFEALVKRLLEFDALAK 280


>gi|126727430|ref|ZP_01743264.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacterales
           bacterium HTCC2150]
 gi|126703210|gb|EBA02309.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacterales
           bacterium HTCC2150]
          Length = 277

 Score =  302 bits (774), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 141/263 (53%), Positives = 190/263 (72%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V   N+   + I+GPCQ+ES DHA MIA ++  IC       V+K+S+DKANRSSL G R
Sbjct: 9   VQVGNDLPLLFISGPCQLESADHAQMIAGRMKEICAEFGASYVFKASYDKANRSSLGGVR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+  G +  + ++   G P++TDVH   QC  +A+ VDILQIPA LCRQTDLL AA  
Sbjct: 69  GMGMAAGLKALQSVRDTIGVPVITDVHGPDQCAEVAEVVDILQIPAFLCRQTDLLLAAGN 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +NVKKGQFL+PWEM N++ K+ + G +++L  ERGTSFGYNTLV DMRS+P M   
Sbjct: 129 TGKAVNVKKGQFLAPWEMPNVVDKVASTGNQNILLTERGTSFGYNTLVADMRSLPQMMKT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PVI DA+HSVQQPG  G  SGG+R++   +A+ AV++G+AG+F+ETH+DPDNAPSDGP
Sbjct: 189 EYPVIMDATHSVQQPGGLGGSSGGQREFAPVMARCAVSMGLAGLFIETHEDPDNAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           N I +  +P+L+  L+A D++ K
Sbjct: 249 NTIALDQMPRLVESLMAFDRLAK 271


>gi|83858275|ref|ZP_00951797.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853098|gb|EAP90950.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanicaulis alexandrii
           HTCC2633]
          Length = 286

 Score =  302 bits (774), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 146/261 (55%), Positives = 195/261 (74%)

Query: 39  FSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGV 98
             NE+   +IAGPCQ+ES +H   +++ L  I     + LVYK+SFDKANR+SL+GKRG+
Sbjct: 19  MGNEKPLTIIAGPCQLESREHGLEVSQALKEIADRTGVKLVYKTSFDKANRTSLSGKRGL 78

Query: 99  GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTG 158
           GL    ++F ++++  G P+LTD+HTE+QC  +A++ DILQIPA LCRQTDLL AAA+TG
Sbjct: 79  GLSASMDVFNEIRETTGLPLLTDIHTEEQCAIVAEAADILQIPAFLCRQTDLLIAAAKTG 138

Query: 159 RVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGV 218
           +VINVKKGQFL+PW+M N++ K+   G  +V+  ERG SFGYNTLV DMRS PIM   G 
Sbjct: 139 KVINVKKGQFLAPWDMPNVIGKITGAGNANVIATERGASFGYNTLVVDMRSFPIMKQTGA 198

Query: 219 PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNM 278
           PV+ DA+H+VQQPG  G  SGG+RQY   LA+A+V++GIAG+F+ETH DPDNAPSDGPNM
Sbjct: 199 PVVMDATHAVQQPGGQGGSSGGQRQYAPHLARASVSLGIAGVFMETHPDPDNAPSDGPNM 258

Query: 279 INIKDLPKLLSQLLAIDKIIK 299
           I +    +++  L+A D + K
Sbjct: 259 IPLNRFEEVVRDLMAFDALAK 279


>gi|332705741|ref|ZP_08425817.1| 3-deoxy-8-phosphooctulonate synthase [Lyngbya majuscula 3L]
 gi|332355533|gb|EGJ34997.1| 3-deoxy-8-phosphooctulonate synthase [Lyngbya majuscula 3L]
          Length = 280

 Score =  302 bits (774), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 183/250 (73%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             LI GPC IES D    +AE++  +C  LNI L++KSSFDKANR+S+   RG  L +G 
Sbjct: 18  LTLIGGPCVIESEDFTLKMAEEIRKVCDRLNIPLIFKSSFDKANRTSINSFRGQTLDRGL 77

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           EI + +K+K G P+LTD+H   Q   +A+ VD+LQIPA LCRQTDLL AAA TG+ INVK
Sbjct: 78  EILQKVKQKVGVPVLTDIHGSHQAATVAEVVDVLQIPAFLCRQTDLLIAAAATGKAINVK 137

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+PW+M +++ KL A GAK++L  ERGTSFGYNTLV D RS+P M  +G PV+FDA
Sbjct: 138 KGQFLAPWDMKHVVSKLEAGGAKNILLTERGTSFGYNTLVVDFRSLPQMRELGYPVVFDA 197

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G+ SGG+R ++  LA+AA A+GI  +F+E H++PD APSDGPNM+ + +L
Sbjct: 198 THSVQMPGGKGDKSGGQRHFVPYLARAAAAVGIDALFMEIHENPDIAPSDGPNMVPLAEL 257

Query: 285 PKLLSQLLAI 294
             +L  +L +
Sbjct: 258 ENVLKGILNV 267


>gi|115524608|ref|YP_781519.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris BisA53]
 gi|115518555|gb|ABJ06539.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopseudomonas
           palustris BisA53]
          Length = 305

 Score =  302 bits (773), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 196/266 (73%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             V+F N     +IAGPCQ+ES  HA  +A  L  I   L IGLV+K+SFDKANR+S + 
Sbjct: 33  GNVSFGNALPLSIIAGPCQLESRAHALEVAGALKEISTRLGIGLVFKTSFDKANRTSASA 92

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVGL     +F ++++  G P+LTDVH  +QC   A++VD+LQIPA LCRQTDLL AA
Sbjct: 93  ARGVGLNDALPVFAEIRETLGLPVLTDVHEIEQCARAAEAVDVLQIPAFLCRQTDLLLAA 152

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A TG+V+NVKKGQFL+PW+M N++ KL   G  +VL  ERG SFGYNTLV+DMR++PIM 
Sbjct: 153 AATGKVVNVKKGQFLAPWDMANVVAKLVGAGNPNVLVTERGASFGYNTLVSDMRALPIMA 212

Query: 215 -SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
            + G PVIFDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+AG+F+ETH DPD+APS
Sbjct: 213 RTTGAPVIFDATHSVQQPGGKGTSSGGEREFVPVLARAAVAVGVAGVFIETHPDPDHAPS 272

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGPNM+ +++   L+ +L+  D + K
Sbjct: 273 DGPNMVPLREFEALVRRLMQFDALAK 298


>gi|240139530|ref|YP_002964006.1| 3-deoxy-8-phosphooctulonate synthase [Methylobacterium extorquens
           AM1]
 gi|240009503|gb|ACS40729.1| 3-deoxy-8-phosphooctulonate synthase [Methylobacterium extorquens
           AM1]
          Length = 282

 Score =  302 bits (773), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 150/265 (56%), Positives = 193/265 (72%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V F+N     LIAGPCQ+E  +HA  IA  L  +   L IGLV+KSSFDKANR+S    R
Sbjct: 17  VAFANHLPLALIAGPCQLEGRNHALEIAAALKEMAAKLGIGLVFKSSFDKANRTSGRTAR 76

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           GVGL +   +F ++++  G P+LTDVH  + C   A +VDILQIPA LCRQTDLL AAA 
Sbjct: 77  GVGLDEALPVFAEIRESLGLPVLTDVHEAEHCARAAQAVDILQIPAFLCRQTDLLLAAAA 136

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGR +NVKKGQFL+PW+M ++  K+   G  +V+  ERG SFGYNTLV+DMRS+PIM  +
Sbjct: 137 TGRAVNVKKGQFLAPWDMAHVAAKVTEAGNPNVIVTERGASFGYNTLVSDMRSLPIMARV 196

Query: 217 --GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETH DPD APSD
Sbjct: 197 TGGAPVVFDATHSVQQPGGQGATSGGQREFVAVLARAAVAVGVAGVFIETHPDPDRAPSD 256

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ + DLP L+  L+A D++ K
Sbjct: 257 GPNMVALADLPALIETLMAFDRLAK 281


>gi|260459507|ref|ZP_05807762.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Mesorhizobium
           opportunistum WSM2075]
 gi|259035061|gb|EEW36317.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Mesorhizobium
           opportunistum WSM2075]
          Length = 286

 Score =  301 bits (772), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 158/276 (57%), Positives = 210/276 (76%), Gaps = 5/276 (1%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           N+A+ +G+    V F N+    LIAGPCQ ES  HAF +A  L  +   L IGLVYK+S+
Sbjct: 13  NSAVAVGN----VVFDNKAALALIAGPCQFESRQHAFDMAGALKELTGKLGIGLVYKTSY 68

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANR+SL+  RG G++    +F +L+K++  P+LTDVHTE+QC  +A  VD+LQIPA L
Sbjct: 69  DKANRTSLSATRGAGMEAALPVFDELRKEFSLPVLTDVHTEEQCAIVAPHVDVLQIPAFL 128

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
            RQTD+L AAA+TG+VINVKKGQFL+PW+M N++ K+   G  +VL  ERG SFGYNTLV
Sbjct: 129 SRQTDMLVAAARTGKVINVKKGQFLAPWDMKNVVAKITGSGNPNVLTTERGASFGYNTLV 188

Query: 205 TDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET 264
           +DMR++PIM  +G PVIFDA+HSVQQPG  G  SGGER+++  L++AAVA+G+AG+F+ET
Sbjct: 189 SDMRALPIMAEIGAPVIFDATHSVQQPGGQGGSSGGERRFVETLSRAAVAVGVAGVFIET 248

Query: 265 HQDPDNA-PSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           HQDPDN+  SDGPNM+ +KD+P LL +L+A D+I K
Sbjct: 249 HQDPDNSTSSDGPNMVPLKDMPALLERLMAFDRIAK 284


>gi|294083772|ref|YP_003550529.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663344|gb|ADE38445.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 271

 Score =  301 bits (772), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 188/260 (72%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            V+  +    +LIAGPCQIES DHA   AEKL        +G VYKSS+DKANR+S    
Sbjct: 7   NVSCGDNHPLLLIAGPCQIESLDHALYCAEKLSKAAADAGMGFVYKSSYDKANRTSAGAA 66

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I   +K  +G P+L+DVH   QC   A+ +D+LQIPA LCRQTDLL AAA
Sbjct: 67  RGIGMDEGLAIMAKVKDTFGCPVLSDVHLPDQCATAAEVLDVLQIPAFLCRQTDLLLAAA 126

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           QTG V+N+KKGQFL+PW+M ++  K+   G   V+  ERGTSFGYNTLV+DMR +P M S
Sbjct: 127 QTGAVVNIKKGQFLAPWDMKHVAAKVTGAGNDRVMLTERGTSFGYNTLVSDMRGLPEMAS 186

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           +G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+ G+F+E+HQDPDNAPSDG
Sbjct: 187 LGHPVIFDATHSVQQPGGKGGSSGGQREFVPVLARAAVAVGVNGLFMESHQDPDNAPSDG 246

Query: 276 PNMINIKDLPKLLSQLLAID 295
           PNM+ +  +  +L+ L+ ID
Sbjct: 247 PNMLPLDAMSDILAALMRID 266


>gi|163852200|ref|YP_001640243.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacterium
           extorquens PA1]
 gi|163663805|gb|ABY31172.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacterium
           extorquens PA1]
          Length = 282

 Score =  301 bits (772), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 150/265 (56%), Positives = 193/265 (72%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V F+N     LIAGPCQ+E  +HA  IA  L  +   L IGLV+KSSFDKANR+S    R
Sbjct: 17  VAFANHLPLALIAGPCQLEGRNHALEIAAALKEMAAKLGIGLVFKSSFDKANRTSGRTAR 76

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           GVGL +   +F ++++  G P+LTDVH  + C   A +VDILQIPA LCRQTDLL AAA 
Sbjct: 77  GVGLDEALPVFAEIRESLGLPVLTDVHEAEHCARAAQAVDILQIPAFLCRQTDLLLAAAA 136

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGR +NVKKGQFL+PW+M ++  K+   G  +V+  ERG SFGYNTLV+DMRS+PIM  +
Sbjct: 137 TGRAVNVKKGQFLAPWDMAHVAAKVTEAGNPNVIVTERGASFGYNTLVSDMRSLPIMARV 196

Query: 217 --GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETH DPD APSD
Sbjct: 197 TGGAPVVFDATHSVQQPGGQGATSGGQREFVAVLARAAVAVGVAGVFIETHPDPDRAPSD 256

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ + DLP L+  L+A D++ K
Sbjct: 257 GPNMVALADLPALIETLMAFDRLAK 281


>gi|253701219|ref|YP_003022408.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sp. M21]
 gi|259494404|sp|C6E0M6|KDSA_GEOSM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|251776069|gb|ACT18650.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sp. M21]
          Length = 273

 Score =  301 bits (772), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 135/254 (53%), Positives = 185/254 (72%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             L+AGPC IE+       AE+L +IC  + I L++K+S+DKANR+S+   RG G+K+G 
Sbjct: 18  LALVAGPCVIENETATLRCAERLMSICNGVGISLIFKASYDKANRTSVTAFRGPGMKEGL 77

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            I   +K+  G P+L+D+H+ +Q E  AD +D+LQIPA LCRQTDLL AAA TG+VINVK
Sbjct: 78  RILAKVKEALGVPVLSDIHSIEQVEPAADVLDVLQIPAFLCRQTDLLVAAANTGKVINVK 137

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+PW+M N++ K+ + G ++++  ERG SFGYN LV DMRS PIM S G PVIFDA
Sbjct: 138 KGQFLAPWDMKNVVGKISSCGNENIILTERGASFGYNNLVVDMRSFPIMRSTGYPVIFDA 197

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G  SGG+R+Y+  L++AAVA G+ GIF+E H++P+ A  DGPN + + D+
Sbjct: 198 THSVQLPGGEGTSSGGQREYVEFLSRAAVAAGVDGIFMEVHEEPEQALCDGPNSVRLDDM 257

Query: 285 PKLLSQLLAIDKII 298
           P LL +L +ID I+
Sbjct: 258 PALLKKLKSIDAIV 271


>gi|319783382|ref|YP_004142858.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169270|gb|ADV12808.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 281

 Score =  301 bits (771), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 212/284 (74%), Gaps = 5/284 (1%)

Query: 19  NHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGL 78
           N  +  N+A+ +G+    V F N+    LIAGPCQ ES  HAF +A  L  +   L IGL
Sbjct: 2   NKPVAPNSAVIVGN----VVFDNKAALSLIAGPCQFESRQHAFDMAGALKELTGRLGIGL 57

Query: 79  VYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDIL 138
           VYK+S+DKANR+SL+  RG G+     +F +L+K++  P+LTDVHTE+QC  +A  VD+L
Sbjct: 58  VYKTSYDKANRTSLSATRGAGMDAALPVFDELRKEFSLPVLTDVHTEEQCAIVAPHVDVL 117

Query: 139 QIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSF 198
           QIPA L RQTD+L AAA+TG+VINVKKGQFL+PW+M N++ K+   G  +VL  ERG SF
Sbjct: 118 QIPAFLSRQTDMLVAAAKTGKVINVKKGQFLAPWDMKNVVAKITGSGNANVLTTERGASF 177

Query: 199 GYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIA 258
           GYNTLV+DMR++P+M  +G PVIFDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+A
Sbjct: 178 GYNTLVSDMRALPVMAEIGAPVIFDATHSVQQPGGQGGSSGGERRFVETLARAAVAVGVA 237

Query: 259 GIFLETHQDPDNA-PSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           G+F+ETHQDPDN+  SDGPNM+ +KD+P LL +L+A D+I K L
Sbjct: 238 GVFIETHQDPDNSTSSDGPNMLPLKDMPALLERLMAFDRIAKGL 281


>gi|170742875|ref|YP_001771530.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacterium sp.
           4-46]
 gi|168197149|gb|ACA19096.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacterium sp.
           4-46]
          Length = 283

 Score =  301 bits (770), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 195/267 (73%), Gaps = 2/267 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V F N     LIAGPC +ES  HA  +A  L  I   L +GLV+KSSFDKANR+S    R
Sbjct: 17  VRFGNHLPLSLIAGPCALESRGHALEVAAALKEIVAPLGLGLVFKSSFDKANRTSAGSAR 76

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+GL +   IF +++++ G P+LTDVH   QC   A++VD+LQIPA LCRQTDLL AAA 
Sbjct: 77  GLGLDEALPIFAEIRERLGLPVLTDVHEAGQCAPTAEAVDVLQIPAFLCRQTDLLLAAAA 136

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGR +NVKKGQFL+PW+M ++  K+   G   V+  ERG SFGYNTLV+DMR++PIM  +
Sbjct: 137 TGRAVNVKKGQFLAPWDMAHVAAKITGAGNSKVIVTERGASFGYNTLVSDMRALPIMAQV 196

Query: 217 --GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETH DPD APSD
Sbjct: 197 TGGAPVVFDATHSVQQPGGQGATSGGQREFVPVLARAAVAVGVAGVFIETHPDPDRAPSD 256

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GPNM+ ++ +P LL++L+A D++ K L
Sbjct: 257 GPNMVPLRAMPDLLARLVAFDRLAKGL 283


>gi|254462119|ref|ZP_05075535.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacterales bacterium
           HTCC2083]
 gi|206678708|gb|EDZ43195.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 277

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 196/263 (74%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           ++  N     +IAGPCQ+ES DHA MIA K+   C ++    ++K+S+DKANR+SL+G+R
Sbjct: 9   LSVGNAAPLTIIAGPCQLESADHAQMIAGKMKEACDAVGAQYMFKASYDKANRTSLSGER 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+ +G ++  DL+K  G PILTDVH E QC   AD+VD+LQIPA LCRQTD+L AA  
Sbjct: 69  GLGIDQGLKVLSDLRKAMGVPILTDVHNEVQCPLAADAVDVLQIPAFLCRQTDMLLAAGN 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VINVKKGQFL+PWEM NI+ KL + G K ++  ERGTSFGYNTLV DMR +P M   
Sbjct: 129 TGAVINVKKGQFLAPWEMPNIVAKLESTGNKRIMLTERGTSFGYNTLVADMRGLPQMAQT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAVA+G+A +F+ETHQDPDNAP DGP
Sbjct: 189 GYPVVMDATHSVQQPGGRGGSSGGQREFAPVMARAAVAVGVAAVFMETHQDPDNAPCDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +P LLS L+ +D ++K
Sbjct: 249 NMIYLDQMPNLLSTLMKLDAVVK 271


>gi|83949991|ref|ZP_00958724.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseovarius nubinhibens
           ISM]
 gi|83837890|gb|EAP77186.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseovarius nubinhibens
           ISM]
          Length = 277

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 192/259 (74%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N++   +IAGPCQ+ES DHA MIA ++   C +     V+K+SFDKANR+S++GKRG+G+
Sbjct: 13  NDRPLTVIAGPCQLESADHAQMIAGRMKEACAAAGAQYVFKASFDKANRTSVSGKRGLGI 72

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
             G ++  DL +    P+LTDVHTE QC   A++VDILQIPA LCRQTDLL AA  TG V
Sbjct: 73  DAGLKVLSDLGRALDVPVLTDVHTEAQCAPAAEAVDILQIPAFLCRQTDLLLAAGNTGAV 132

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +NVKKGQFL+PW+M N++ K+ + G K +L  ERGTSFGYNTLV DMR++P M   G PV
Sbjct: 133 VNVKKGQFLAPWDMENVITKIESTGNKKILLTERGTSFGYNTLVADMRALPQMARSGYPV 192

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           + DA+HSVQQPG  G  SGG+R++   +A+AAV++G+A +F+ETH+DPD APSDGPNMI 
Sbjct: 193 VMDATHSVQQPGGQGGSSGGQREFAPVMARAAVSLGVAAVFIETHEDPDRAPSDGPNMIP 252

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  +P L++ L+  D + K
Sbjct: 253 LDQMPALVASLMRFDALAK 271


>gi|126733712|ref|ZP_01749459.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter sp. CCS2]
 gi|126716578|gb|EBA13442.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter sp. CCS2]
          Length = 277

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 142/263 (53%), Positives = 190/263 (72%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  SN+   ++IAGPCQ+E  DHA MIA K+  IC       V+K S+DKANR+SL GKR
Sbjct: 9   LAVSNDLPLLVIAGPCQLEGADHAQMIAGKMAEICAEHGAQFVFKGSYDKANRTSLGGKR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+ +G ++ + +K   G P+LTD+H   QC  +A+  DILQIPA LCRQTDLL AA +
Sbjct: 69  GLGMDEGLKVMQSVKDSIGCPVLTDIHAPDQCATVAEVCDILQIPAFLCRQTDLLLAAGE 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VINVKKGQFL+PW+M N++ K+ + G K +L  ERG SFGYNTLV DMRS+P M   
Sbjct: 129 TGAVINVKKGQFLAPWDMPNVVSKIESTGNKRILLTERGASFGYNTLVADMRSLPTMART 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++GIA +F+ETH+DPD+APSDGP
Sbjct: 189 GYPVVMDATHSVQQPGGMGGSSGGQREFAPVMARAAVSLGIAAVFIETHEDPDHAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +  ++  L+A D + K
Sbjct: 249 NMIPLDQMHGVIKSLMAFDGLAK 271


>gi|322418946|ref|YP_004198169.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sp. M18]
 gi|320125333|gb|ADW12893.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sp. M18]
          Length = 274

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 137/263 (52%), Positives = 190/263 (72%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +    ++  VL+AGPC IE+       AE+L +IC  + I L++K+S+DKANR+S+   R
Sbjct: 10  IKIGGDRPLVLVAGPCVIENETATLRHAERLMSICNGVGIPLIFKASYDKANRTSVTAFR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+K+G  I   +K+  G P+L+D+H+ +Q E  AD +D+LQIPA LCRQTDLL AAA 
Sbjct: 70  GPGVKEGLRILSKVKESLGVPVLSDIHSIEQVEPAADVLDVLQIPAFLCRQTDLLVAAAN 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+VINVKKGQFL+PW+M N++ K+ +   ++++  ERG SFGYN LV DMRS PIM S 
Sbjct: 130 TGKVINVKKGQFLAPWDMKNVVGKIRSCENENIILTERGASFGYNNLVVDMRSFPIMRST 189

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVIFDA+HSVQ PG  G  SGG+R+++  L++AAVA G+ GIF+E H++P+ A  DGP
Sbjct: 190 GYPVIFDATHSVQLPGGEGTSSGGQREFVEFLSRAAVAAGVDGIFMEVHEEPEQALCDGP 249

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           N + + DLP LL++L AID I+K
Sbjct: 250 NSVRLDDLPVLLNRLKAIDAIVK 272


>gi|20532130|sp|Q98MZ6|KDSA_RHILO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
          Length = 277

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 157/276 (56%), Positives = 208/276 (75%), Gaps = 5/276 (1%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           N+++ +G+    V F N     LIAGPCQ ES  HAF +A  L  +   L IGLVYK+S+
Sbjct: 4   NSSVTVGN----VVFDNNAALALIAGPCQFESRQHAFDMAGALKELTARLGIGLVYKTSY 59

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANR+SL+  RG G+     +F +L+K++  P+LTDVHTE+QC  +A  VD+LQIPA L
Sbjct: 60  DKANRTSLSATRGAGMDAALPVFDELRKEFSLPVLTDVHTEEQCAIVAPHVDVLQIPAFL 119

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
            RQTD+L AAA+TG+VINVKKGQFL+PW+M N++ K+   G  +VL  ERG SFGYNTLV
Sbjct: 120 SRQTDMLVAAAKTGKVINVKKGQFLAPWDMKNVVAKITGSGNPNVLTTERGASFGYNTLV 179

Query: 205 TDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET 264
           +DMR++P+M  +G PVIFDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+AG+F+ET
Sbjct: 180 SDMRALPVMAEIGAPVIFDATHSVQQPGGQGGSSGGERRFVETLARAAVAVGVAGVFIET 239

Query: 265 HQDPDNA-PSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           HQDPDN+  SDGPNM+ +KD+P LL +L+A D+I K
Sbjct: 240 HQDPDNSTSSDGPNMLPLKDMPALLERLMAFDRIAK 275


>gi|13470612|ref|NP_102181.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Mesorhizobium loti
           MAFF303099]
 gi|14021354|dbj|BAB47967.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Mesorhizobium loti
           MAFF303099]
          Length = 286

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 157/276 (56%), Positives = 208/276 (75%), Gaps = 5/276 (1%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           N+++ +G+    V F N     LIAGPCQ ES  HAF +A  L  +   L IGLVYK+S+
Sbjct: 13  NSSVTVGN----VVFDNNAALALIAGPCQFESRQHAFDMAGALKELTARLGIGLVYKTSY 68

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANR+SL+  RG G+     +F +L+K++  P+LTDVHTE+QC  +A  VD+LQIPA L
Sbjct: 69  DKANRTSLSATRGAGMDAALPVFDELRKEFSLPVLTDVHTEEQCAIVAPHVDVLQIPAFL 128

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
            RQTD+L AAA+TG+VINVKKGQFL+PW+M N++ K+   G  +VL  ERG SFGYNTLV
Sbjct: 129 SRQTDMLVAAAKTGKVINVKKGQFLAPWDMKNVVAKITGSGNPNVLTTERGASFGYNTLV 188

Query: 205 TDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET 264
           +DMR++P+M  +G PVIFDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+AG+F+ET
Sbjct: 189 SDMRALPVMAEIGAPVIFDATHSVQQPGGQGGSSGGERRFVETLARAAVAVGVAGVFIET 248

Query: 265 HQDPDNA-PSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           HQDPDN+  SDGPNM+ +KD+P LL +L+A D+I K
Sbjct: 249 HQDPDNSTSSDGPNMLPLKDMPALLERLMAFDRIAK 284


>gi|254455657|ref|ZP_05069086.1| 3-deoxy-8-phosphooctulonate synthase [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082659|gb|EDZ60085.1| 3-deoxy-8-phosphooctulonate synthase [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 274

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 150/264 (56%), Positives = 199/264 (75%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  SN+ +  +IAGPCQ+E+  HA  +A K+  I +  N+G +YK+SFDKANR+SL G+
Sbjct: 10  NIEISNDNKICIIAGPCQLETEQHAMDMAGKIKEITKKFNLGFIYKTSFDKANRTSLKGE 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL+    +F  +KK+   PILTD+H  +QC  +A+ VDILQIPA LCRQTDLL +AA
Sbjct: 70  RGAGLEASLPVFDKIKKELDVPILTDIHNAEQCSILANHVDILQIPAFLCRQTDLLISAA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +T ++INVKKGQFL+PW+M N+ +K+   G +++L  ERG SFGYNTLV+DMRS+PIM  
Sbjct: 130 KTNKIINVKKGQFLAPWDMVNVTKKISDSGNENILVTERGASFGYNTLVSDMRSLPIMAK 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETH DPDNAPSDG
Sbjct: 190 NGYPVIFDATHSVQQPGGQGESSGGQREFVEYLARAAVAVGVAGVFIETHHDPDNAPSDG 249

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +  L  LL QL  ID +IK
Sbjct: 250 PNMVPLDKLENLLKQLNDIDNLIK 273


>gi|294785202|ref|ZP_06750490.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 3_1_27]
 gi|294486916|gb|EFG34278.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 3_1_27]
          Length = 286

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 187/263 (71%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   R
Sbjct: 22  IVFGGKKRFVLIAGPCVMESQELMDEVAGGIKKICDKLGIEYIFKASFDKANRSSIYSYR 81

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++    K+K+  P++TDVH   QC+ ++   DILQIPA LCRQTDLL AAA+
Sbjct: 82  GPGLEEGMKMLAKTKEKFNVPVITDVHEAWQCKEVSKVADILQIPAFLCRQTDLLIAAAE 141

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +N+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGYN +V DMRS+  M   
Sbjct: 142 TGKAVNIKKGQFLAPWDMKNIVVKMEEAGNKNIMLCERGSTFGYNNMVVDMRSLLEMRKF 201

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P+ A SDGP
Sbjct: 202 NYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPEEAKSDGP 261

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +KDL K+L  ++ IDKI+K
Sbjct: 262 NMLYLKDLEKILKTVVEIDKIVK 284


>gi|260494181|ref|ZP_05814312.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 3_1_33]
 gi|260198327|gb|EEW95843.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 3_1_33]
          Length = 286

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 133/263 (50%), Positives = 186/263 (70%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           + F  ++RFVLIAGPC +ES +    +A ++  IC  L I  ++K+SFDKANRSS+   R
Sbjct: 22  IVFGGKKRFVLIAGPCVMESQELMDEVAGEIKEICDRLGIEYIFKASFDKANRSSIYSYR 81

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++    K+K+  P++TDVH   QC+ +A   DILQIPA LCRQTDLL AAA+
Sbjct: 82  GPGLEEGMKMLAKTKEKFNIPVITDVHEAWQCKEVAKVADILQIPAFLCRQTDLLIAAAE 141

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +N+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGYN +V DMRS+  M   
Sbjct: 142 TGKAVNIKKGQFLAPWDMKNIVVKMEESGNKNIMLCERGSTFGYNNMVVDMRSLLEMRKF 201

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PVIFD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P  A SDGP
Sbjct: 202 NYPVIFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPTEAKSDGP 261

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +KDL ++L   + IDKI+K
Sbjct: 262 NMLYLKDLEEILKTAIEIDKIVK 284


>gi|298291854|ref|YP_003693793.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Starkeya novella DSM
           506]
 gi|296928365|gb|ADH89174.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Starkeya novella DSM
           506]
          Length = 286

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 154/280 (55%), Positives = 205/280 (73%), Gaps = 2/280 (0%)

Query: 22  IHTNAAIHLGSGKN-QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +  N  + +G   + QV+F N     LIAGPCQ+ES +HA   A  +  I Q    G+V+
Sbjct: 3   VSANPIVTIGEANSAQVSFGNHLPLALIAGPCQMESREHALECAAAIKEIAQRRGAGVVF 62

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANR+S+ G+RG+GLK    +F ++++KYG P+LTDVH  +QC  +A+ VD+LQI
Sbjct: 63  KTSFDKANRTSIKGQRGMGLKAALPVFAEIREKYGMPVLTDVHEHEQCAPVAEVVDVLQI 122

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA TGR +NVKKGQFL+PW+M N++ KL   G  +VL  ERG SFGY
Sbjct: 123 PAFLCRQTDLLIAAAATGRTVNVKKGQFLAPWDMKNVVAKLTESGNANVLVTERGVSFGY 182

Query: 201 NTLVTDMRSIPIMT-SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
           NTLVTDMR++PIM  + G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG
Sbjct: 183 NTLVTDMRALPIMAETTGAPVIFDATHSVQQPGGQGTSSGGQREFVPVLARAAVAVGVAG 242

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +F+ETH DPD APSDGPNM+ +     L+++L A D++ K
Sbjct: 243 VFIETHPDPDKAPSDGPNMVPLNQFEDLVAKLQAFDRVAK 282


>gi|237744235|ref|ZP_04574716.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. 7_1]
 gi|229431464|gb|EEO41676.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. 7_1]
          Length = 286

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 134/263 (50%), Positives = 185/263 (70%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   R
Sbjct: 22  IVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIFKASFDKANRSSIYSYR 81

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG ++    K+K+  P++TDVH   QC+ +A   DILQIPA LCRQTDLL AAA+
Sbjct: 82  GPGLEKGMKMLAKTKEKFNVPVITDVHEAWQCKEVAKVADILQIPAFLCRQTDLLIAAAE 141

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ IN+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGYN +V DMRS+  M   
Sbjct: 142 TGKAINIKKGQFLAPWDMKNIVVKMEESGNKNIMLCERGSTFGYNNMVVDMRSLLEMRKF 201

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P  A SDGP
Sbjct: 202 NYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPAEAKSDGP 261

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +KDL ++L   + IDKI+K
Sbjct: 262 NMLYLKDLEEILKTAIEIDKIVK 284


>gi|237742226|ref|ZP_04572707.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           4_1_13]
 gi|229429874|gb|EEO40086.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           4_1_13]
          Length = 278

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 185/264 (70%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   
Sbjct: 13  NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDKLGIEYIFKASFDKANRSSIYSY 72

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++    K+KY  P++TDVH   QC+ +A   DILQIPA LCRQTDLL AAA
Sbjct: 73  RGPGLEEGMKMLAKTKEKYNVPVITDVHEAWQCKEVAKVADILQIPAFLCRQTDLLIAAA 132

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +N+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGYN +V DMRS+  M  
Sbjct: 133 ETGKAVNIKKGQFLAPWDMKNIVVKMEESGNKNIMLCERGSTFGYNNMVVDMRSLLEMRK 192

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P  A SDG
Sbjct: 193 FNYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPAEAKSDG 252

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +KDL ++L   + IDKI+K
Sbjct: 253 PNMLYLKDLEEILKTAIEIDKIVK 276


>gi|146280238|ref|YP_001170395.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145558479|gb|ABP73090.1| hypothetical protein Rsph17025_4240 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 278

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 139/281 (49%), Positives = 195/281 (69%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M  T + + +G    ++         LI GPCQ+ES +HA M+A ++   C       ++
Sbjct: 1   MTETPSIVTIG----EIVLGGAHPIALITGPCQLESLEHARMMAGRISEACAPTGTKFIF 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+S+DKANRSSL   RG+G++KG EI   ++ ++G P+LTDVH   QC   A+  D+LQI
Sbjct: 57  KASYDKANRSSLGTARGLGMEKGLEILGAIRDEFGVPVLTDVHEPWQCAKAAEVCDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AA +TG+ +N+KKGQFL+PW+M N+  K+ + G + +L CERGTSFGY
Sbjct: 117 PAFLCRQTDLLLAAGETGKAVNIKKGQFLAPWDMGNVAAKVASTGNRKILLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLVTD R +P M + G PV+FDA+HSVQQPG  G  SGG+R++   LA+AA A+G++ +
Sbjct: 177 NTLVTDFRGLPTMAATGWPVVFDATHSVQQPGGLGGSSGGQREFAPVLARAACAVGVSAL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F+ETH+DPD APSDGPNMI +  + +L+++L A D + K L
Sbjct: 237 FIETHEDPDRAPSDGPNMIPVDRMGRLIAELRAFDALAKSL 277


>gi|220920174|ref|YP_002495475.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacterium
           nodulans ORS 2060]
 gi|219944780|gb|ACL55172.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacterium
           nodulans ORS 2060]
          Length = 290

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 194/267 (72%), Gaps = 2/267 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V F N     LIAGPC +ES  HA  +A  L  +   L +GLV+KSSFDKANR+S    R
Sbjct: 24  VRFGNHLPLSLIAGPCALESRAHALEVAAALKEMTAPLGLGLVFKSSFDKANRTSAGSAR 83

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+GL +   IF +++++   P+LTDVH   QC   A++VDILQIPA LCRQTDLL AAA 
Sbjct: 84  GLGLAEALPIFAEIRERLRLPVLTDVHEAGQCAVAAEAVDILQIPAFLCRQTDLLLAAAA 143

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGR +NVKKGQFL+PW+M ++  K+ A G  +V+  ERG SFGYNTLV+DMR++PIM  +
Sbjct: 144 TGRAVNVKKGQFLAPWDMAHVAAKVTAAGNPNVIVTERGASFGYNTLVSDMRALPIMARV 203

Query: 217 --GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETH DPD APSD
Sbjct: 204 TNGAPVVFDATHSVQQPGGQGATSGGQREFVPVLARAAVAVGVAGVFIETHPDPDRAPSD 263

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GPNM+ ++ +P LL  L+A D++ K L
Sbjct: 264 GPNMVPLRAMPALLGDLVAFDRLAKAL 290


>gi|229541726|ref|ZP_04430786.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bacillus coagulans 36D1]
 gi|229326146|gb|EEN91821.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bacillus coagulans 36D1]
          Length = 280

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 184/265 (69%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           +++ F      VLIAGPC IES   A   A  L  I   L I  V+K+SFDKANRSS+  
Sbjct: 8   SRIAFGQRLPLVLIAGPCVIESETMAMETAATLQTIAGKLGIPFVFKASFDKANRSSIFS 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG GL+KG EI   +K  +G P+ +D+H   Q +A  + +DILQIPA LCRQTDLL AA
Sbjct: 68  KRGPGLEKGLEILDRIKNVFGVPVTSDIHEPHQAKAAGEVLDILQIPAFLCRQTDLLLAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A TG+++NVKKGQFL+PW+M N++QKL   G   +L  ERG++FGYN LV DMR++P M 
Sbjct: 128 AATGKIVNVKKGQFLAPWDMKNVIQKLEESGTDKILLTERGSTFGYNNLVVDMRALPEMR 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            +G PV+FDA+HSVQ PG +G  +GG+R ++  LA+AA A GI  +FLE H DPD A SD
Sbjct: 188 RLGYPVVFDATHSVQIPGGNGTSTGGKRAFVPYLARAAAACGIDALFLEAHPDPDQAWSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ + DL ++L  ++ ID++IK
Sbjct: 248 GPNMVKLDDLEEMLKPVIEIDRMIK 272


>gi|257125306|ref|YP_003163420.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptotrichia buccalis
           C-1013-b]
 gi|257049245|gb|ACV38429.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptotrichia buccalis
           C-1013-b]
          Length = 278

 Score =  298 bits (764), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 186/267 (69%), Gaps = 1/267 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           +++T  N++ F LIAGPC IES D    +A K+  I   L I  ++K+SFDKANRSS++ 
Sbjct: 13  DKITIGNDKIF-LIAGPCVIESEDLVTEVAGKMKEITDKLGIQYIFKASFDKANRSSISS 71

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG EI   +K+KYG  + TD+H   QC+  A  +D+LQIPA L RQTDLL AA
Sbjct: 72  FRGPGLEKGLEILSRVKEKYGVALATDIHEPWQCKEAAKVIDLLQIPAFLSRQTDLLVAA 131

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+ +N+KKGQFL+PW+M N+++K    G ++++ CERG SFGYN LV DMR +  M 
Sbjct: 132 AETGKAVNIKKGQFLAPWDMKNVVKKFEEVGNENIMLCERGASFGYNNLVVDMRGLLEMR 191

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG R Y+ PLA+AAV++G+ G+F E H +PD   SD
Sbjct: 192 KFGYPVVFDATHSVQIPGGQGETSGGNRAYVYPLARAAVSVGVDGVFAEVHPEPDKGLSD 251

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GPNM+ + D+  +L +LL  DK+ K L
Sbjct: 252 GPNMLKLDDVENILEKLLQYDKLTKEL 278


>gi|289523514|ref|ZP_06440368.1| 3-deoxy-8-phosphooctulonate synthase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503206|gb|EFD24370.1| 3-deoxy-8-phosphooctulonate synthase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 282

 Score =  298 bits (763), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 134/259 (51%), Positives = 188/259 (72%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
            E RFVL+AGPC +ES + A  +A ++  IC  L +G ++KSSFDKANR+S+   RG GL
Sbjct: 13  GEGRFVLVAGPCVLESLELALEVACEVKKICDGLGLGYIFKSSFDKANRTSIYSFRGPGL 72

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
           + G     ++K K G P+LTD+H  +Q + ++  VDI+QIPA LCRQTDL+ +AA+TG+ 
Sbjct: 73  EVGLRWLEEVKTKVGVPVLTDIHEPKQADLVSSVVDIIQIPAFLCRQTDLIMSAAKTGKP 132

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KK QFLSP++M  +L+K    G   V+ CERGT+FGY  LV D RS+ IM S G PV
Sbjct: 133 LNIKKAQFLSPYDMRFVLEKAKESGNDQVILCERGTTFGYKQLVVDFRSLSIMRSFGCPV 192

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G  SGG+RQ+++PL++AAV++GI  +F+E H DPDNA SDGPNM+ 
Sbjct: 193 MFDATHSVQMPGGQGASSGGKRQFVLPLSRAAVSVGIDALFMEVHPDPDNAKSDGPNMVA 252

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           + +L  LL +L+A+D ++K
Sbjct: 253 LSNLRGLLEELIALDDLVK 271


>gi|254302925|ref|ZP_04970283.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
 gi|148323117|gb|EDK88367.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
          Length = 295

 Score =  298 bits (763), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 133/263 (50%), Positives = 185/263 (70%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   R
Sbjct: 31  IVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIFKASFDKANRSSIHSYR 90

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++    K+K+  P++TDVH   QC+ +A   DILQIPA LCRQTDLL AAA+
Sbjct: 91  GPGLEEGMKMLAKTKEKFNVPVITDVHEAWQCKEVAKVADILQIPAFLCRQTDLLIAAAE 150

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ IN+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGYN +V DMRS+  M   
Sbjct: 151 TGKAINIKKGQFLAPWDMKNIVVKMEESGNKNIMLCERGSTFGYNNMVVDMRSLLEMRKF 210

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P  A SDGP
Sbjct: 211 NYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPTEAKSDGP 270

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +KDL ++L   + IDKI+K
Sbjct: 271 NMLYLKDLEEILKTAIEIDKIVK 293


>gi|256845497|ref|ZP_05550955.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 3_1_36A2]
 gi|256719056|gb|EEU32611.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 3_1_36A2]
          Length = 286

 Score =  298 bits (763), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 186/263 (70%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   R
Sbjct: 22  IVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDKLGIEYIFKASFDKANRSSIYSYR 81

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++    K+K+  P++TDVH   QC+ ++   DILQIPA LCRQTDLL AAA+
Sbjct: 82  GPGLEEGMKMLAKTKEKFNVPVITDVHEAWQCKEVSKVADILQIPAFLCRQTDLLIAAAE 141

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +N+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGYN +V DMRS+  M   
Sbjct: 142 TGKAVNIKKGQFLAPWDMKNIVVKMEESGNKNIMLCERGSTFGYNNMVVDMRSLLEMRKF 201

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +A+G+  IF E H +P+ A SDGP
Sbjct: 202 NYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAVGVDAIFAEVHPNPEEAKSDGP 261

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +KDL ++L   + IDKI+K
Sbjct: 262 NMLYLKDLEEILKTAIEIDKIVK 284


>gi|315499287|ref|YP_004088091.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Asticcacaulis
           excentricus CB 48]
 gi|315417299|gb|ADU13940.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Asticcacaulis
           excentricus CB 48]
          Length = 286

 Score =  298 bits (763), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 153/278 (55%), Positives = 200/278 (71%), Gaps = 4/278 (1%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +  N  + L S +    F N     +IAGPCQ+ES +HA  +A  L  I + L  G+++K
Sbjct: 4   LRANPVVELKSAR----FGNHLPISVIAGPCQLESREHALEVASALKEISERLGFGVIFK 59

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANR+S    RG+GLK    IF ++++  G  +LTDVH  QQC  +A++VD+LQIP
Sbjct: 60  TSFDKANRTSAKAARGIGLKDALPIFAEIRESLGLAVLTDVHESQQCAPVAEAVDVLQIP 119

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A LCRQTDLL AAA TGR INVKKGQFL+PW+M N+L K+   G  +VL C+RGTSFGYN
Sbjct: 120 AFLCRQTDLLLAAAATGRAINVKKGQFLAPWDMKNVLDKIVLGGNPNVLLCDRGTSFGYN 179

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV+D R +PIM S G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F
Sbjct: 180 TLVSDFRGLPIMASTGAPVIFDATHSVQQPGGLGGSSGGQREFVPVLARAAVAVGVAGLF 239

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +ETH DPDNAPSDGPNM+ +     L+  L+AID++ K
Sbjct: 240 IETHPDPDNAPSDGPNMVPLASFEGLMRDLMAIDQVAK 277


>gi|84514359|ref|ZP_01001723.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Loktanella vestfoldensis
           SKA53]
 gi|84511410|gb|EAQ07863.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Loktanella vestfoldensis
           SKA53]
          Length = 277

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 192/265 (72%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
            Q+   N+   +LIAGPCQ+ES DHA MIA ++  IC +     ++K SFDKANR+SL G
Sbjct: 7   GQLKVGNDLPLLLIAGPCQLESIDHAQMIAGRMAEICTAHGAQFIFKGSFDKANRTSLGG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G+  G ++ + +K   G P+LTD+HT  QC  +AD  D+LQIPA LCRQTDLL AA
Sbjct: 67  KRGLGIDGGLKVMQSVKDSIGCPVLTDIHTADQCAPVADVCDVLQIPAFLCRQTDLLIAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG VINVKKGQFL+PW+M N++ K+ + G + +L  +RGTSFGYNTLV DMRS+P M 
Sbjct: 127 GETGAVINVKKGQFLAPWDMPNVVAKIESTGNRRILVTDRGTSFGYNTLVADMRSLPTMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            MG PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++GIA +F+ETH+DPD APSD
Sbjct: 187 RMGYPVVMDATHSVQQPGGQGGSSGGQREFAPVMARAAVSLGIAAVFIETHEDPDTAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNMI +  +  L+  L+  D + K
Sbjct: 247 GPNMIPLSQMDALVKSLMGFDALAK 271


>gi|294782938|ref|ZP_06748264.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 1_1_41FAA]
 gi|294481579|gb|EFG29354.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 1_1_41FAA]
          Length = 278

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 186/263 (70%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   R
Sbjct: 14  IVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIFKASFDKANRSSIHSYR 73

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++    K+K+  P++TDVH   QC+ +A  VDILQIPA LCRQTDLL AAA+
Sbjct: 74  GPGLEEGMKMLAKTKEKFNVPVITDVHEAWQCKEVAKVVDILQIPAFLCRQTDLLIAAAE 133

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +N+KKGQFL+PW+M NI+ K+   G ++++ CERG++FGYN +V DMRS+  M   
Sbjct: 134 TGKAVNIKKGQFLAPWDMKNIVVKMEESGNQNIMLCERGSTFGYNNMVVDMRSLLEMRKF 193

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P  A SDGP
Sbjct: 194 NYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPTEAKSDGP 253

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +KDL ++L   + IDKI+K
Sbjct: 254 NMLYLKDLEEILKTAIEIDKIVK 276


>gi|237736450|ref|ZP_04566931.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium mortiferum
           ATCC 9817]
 gi|229421492|gb|EEO36539.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium mortiferum
           ATCC 9817]
          Length = 278

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 137/284 (48%), Positives = 190/284 (66%), Gaps = 9/284 (3%)

Query: 16  IDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN 75
           +DK  ++     I +G  K         RF LIAGPC IES +    +A K+  IC  L 
Sbjct: 2   VDKVRVVKVGDKIEIGGNK---------RFALIAGPCVIESEELVMEVAGKIKDICDRLG 52

Query: 76  IGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSV 135
           I  ++K+SFDKANRSS+   RG GL+KG EI + +K+KY  P++TDVH   QC+  A+ V
Sbjct: 53  IQYIFKASFDKANRSSIHSFRGPGLEKGLEILKKVKEKYNVPVITDVHETWQCKKAAEVV 112

Query: 136 DILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERG 195
           DILQIPA LCRQTDLL AAA+TG  +N+KKGQFL+PW+M N++ K+     +++L CERG
Sbjct: 113 DILQIPAFLCRQTDLLLAAAETGLPVNIKKGQFLAPWDMKNVVTKMEESNNQNILLCERG 172

Query: 196 TSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAI 255
           ++FGYN +V DMRS   M   G PV+FD +H+VQ+PG  G  + G+R+Y+ PL +A +AI
Sbjct: 173 STFGYNNMVVDMRSFMEMRKFGYPVVFDVTHAVQRPGGLGTATSGDREYVFPLMRAGLAI 232

Query: 256 GIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           G+  IF E H +P+ A SDGPNM+ + DL ++L   + ID ++K
Sbjct: 233 GVDAIFAEVHPNPNEAKSDGPNMLFLDDLEEILKVAIKIDDLVK 276


>gi|257453302|ref|ZP_05618601.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           3_1_5R]
 gi|257467035|ref|ZP_05631346.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|315918172|ref|ZP_07914412.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|313692047|gb|EFS28882.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 279

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 131/267 (49%), Positives = 191/267 (71%), Gaps = 1/267 (0%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
           G+N V+   ++RF LIAGPC +ES +    +A ++  IC+ L I  ++K+SFDKANRSS+
Sbjct: 12  GEN-VSIGGKKRFTLIAGPCVMESQELMLEVAGEINKICKKLGIEYIFKASFDKANRSSI 70

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG GL++G ++ + +K  YG P++TD+H   QCE +A+  D+LQIPA LCRQTDLL 
Sbjct: 71  HSYRGPGLEEGLKMLQKVKDTYGIPVVTDIHEPWQCEKVAEVADLLQIPAFLCRQTDLLI 130

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           AAA TG+ +N+KKGQFL+PW+M N++ K+   G + +L CERG++FGYN +V DMRS+  
Sbjct: 131 AAAATGKPVNIKKGQFLAPWDMKNVVVKMEESGNEGILLCERGSTFGYNNMVVDMRSLLE 190

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M   G PV+FD +H+VQ+PG  GN + G+R+Y+ PL +A +AIG+  IF E H +P+ A 
Sbjct: 191 MRKFGYPVVFDVTHAVQKPGGLGNATSGDREYVYPLMRAGLAIGVDAIFAEVHPNPEVAK 250

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
           SDGPNM+ +KDL ++L   + ID ++K
Sbjct: 251 SDGPNMLYLKDLEEILKVAIQIDDLVK 277


>gi|34762974|ref|ZP_00143952.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
 gi|27887362|gb|EAA24454.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
          Length = 278

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 131/264 (49%), Positives = 185/264 (70%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   
Sbjct: 13  NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDKLGIEYIFKASFDKANRSSIYSY 72

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++    K+K+  P++TDVH   QC+ ++   DILQIPA LCRQTDLL AAA
Sbjct: 73  RGPGLEEGMKMLAKTKEKFNVPVITDVHEAWQCKEVSKVADILQIPAFLCRQTDLLIAAA 132

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +N+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGYN +V DMRS+  M  
Sbjct: 133 ETGKAVNIKKGQFLAPWDMKNIVVKMEESGNKNIMLCERGSTFGYNNMVVDMRSLLEMRK 192

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P  A SDG
Sbjct: 193 FNYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPAEAKSDG 252

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +KDL ++L   + IDKI+K
Sbjct: 253 PNMLYLKDLEEILKTAIEIDKIVK 276


>gi|262067015|ref|ZP_06026627.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium periodonticum
           ATCC 33693]
 gi|291379275|gb|EFE86793.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium periodonticum
           ATCC 33693]
          Length = 278

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 131/263 (49%), Positives = 185/263 (70%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   R
Sbjct: 14  IVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIFKASFDKANRSSIHSYR 73

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++    K+K+  P++TDVH   QC+ +A   DILQIPA LCRQTDLL AAA+
Sbjct: 74  GPGLEEGMKMLAKTKEKFNLPVITDVHEAWQCKEVAKVADILQIPAFLCRQTDLLIAAAE 133

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +N+KKGQFL+PW+M NI+ K+   G ++++ CERG++FGYN +V DMRS+  M   
Sbjct: 134 TGKAVNIKKGQFLAPWDMKNIVVKMEESGNQNIMLCERGSTFGYNNMVVDMRSLLEMRKF 193

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P  A SDGP
Sbjct: 194 NYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPTEAKSDGP 253

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +KDL ++L   + IDKI+K
Sbjct: 254 NMLYLKDLEEILKTAIEIDKIVK 276


>gi|302392915|ref|YP_003828735.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acetohalobium arabaticum
           DSM 5501]
 gi|302204992|gb|ADL13670.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acetohalobium arabaticum
           DSM 5501]
          Length = 275

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 187/265 (70%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
            ++ F N++ FVL+AGPC IES + +  +AE +  I   L I  V+KSS+DKANRSS+  
Sbjct: 9   EEIKFGNQRPFVLLAGPCAIESEERSLKVAEGIKEITDRLGIPYVFKSSYDKANRSSIDS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +I   +K+++  P+L+DVHT ++ E  AD +DI+QIPA L RQTDL+TA 
Sbjct: 69  YRGPGLEEGLKILEKVKREFDLPVLSDVHTAEEAEYAADVLDIMQIPAFLSRQTDLVTAV 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
             TGRV+NVKKGQFL+PW++  +++K+ +   + +L  ERG SFGYN LV DMRS+P M 
Sbjct: 129 GATGRVVNVKKGQFLAPWDIEQVVEKIESTNNQRILLTERGASFGYNNLVVDMRSLPRMR 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G+ SGGER+Y+  LA+AA   GI  +F+E H  P+ A  D
Sbjct: 189 ETGYPVVFDATHSVQLPGGAGDRSGGEREYVPHLARAAAGAGIDALFMEVHDRPEEALCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ + DL  +L ++ AID+I+K
Sbjct: 249 GPNMVRLDDLEDILRKIQAIDEIVK 273


>gi|285808560|gb|ADC36081.1| 2-dehydro-3-deoxyphosphooctonate aldolase [uncultured bacterium
           164]
          Length = 272

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 134/254 (52%), Positives = 183/254 (72%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             +IAGPC +ES  HA  +A+++  IC+ + +GLVYKSSFDKANRSS+   RG G++ G 
Sbjct: 16  LAIIAGPCVVESAQHALYMAQEISDICKHVGLGLVYKSSFDKANRSSIESFRGEGMEFGL 75

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            I   +K++ G P++TD+H   Q E +A+  DILQIPA LCRQTDLL AAA+TG+ +NVK
Sbjct: 76  SILAQVKEEIGVPVITDIHEPWQAEKVAEVADILQIPAFLCRQTDLLVAAAKTGKAVNVK 135

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFLSPW+  NI++KLHA G + +L  ERG SFGYN LV D+RS P+M S GVPV+FD 
Sbjct: 136 KGQFLSPWDAKNIVEKLHAAGGQMILLTERGASFGYNNLVVDLRSFPVMRSFGVPVVFDV 195

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HS+Q PG  G  +GG+ +YI   A+A VA G+  +F+E H +P  APSDGPN + +  L
Sbjct: 196 THSLQLPGGLGKATGGQSEYIENFARAGVACGVDAVFMEVHDNPAKAPSDGPNQLPLARL 255

Query: 285 PKLLSQLLAIDKII 298
            KLL++L +I +++
Sbjct: 256 EKLLTKLKSIHELV 269


>gi|330814036|ref|YP_004358275.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487131|gb|AEA81536.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 274

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 154/259 (59%), Positives = 196/259 (75%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N   F LIAGPCQ+ES  HAF + EK+  I + L I  +YK+SFDKANR+SL GKRG+GL
Sbjct: 15  NSLPFTLIAGPCQLESRAHAFKMVEKIQKITKKLKIKFIYKTSFDKANRTSLKGKRGLGL 74

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            K   IF ++KKK+  PILTDVHT +QC  ++  VDILQIPA LCRQTDLL AAA+T ++
Sbjct: 75  TKSLSIFDEIKKKFKVPILTDVHTPEQCSLVSSHVDILQIPAFLCRQTDLLVAAAKTKKI 134

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           IN+KKGQFL+PW+M N++ K+   G  ++L  ERG SFGYNTLV+D R+IP +  +G PV
Sbjct: 135 INIKKGQFLAPWDMGNVVNKIKNSGNNNILVTERGVSFGYNTLVSDFRAIPTLVKLGYPV 194

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           IFDA+HSVQQPG  G  S G+R+++ PL+KAAVAIG+A IF+ETH++PD APSDG NMIN
Sbjct: 195 IFDATHSVQQPGGKGTASSGQREFVEPLSKAAVAIGVAAIFIETHENPDRAPSDGANMIN 254

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           I  L  LL +L  ID ++K
Sbjct: 255 INKLESLLKKLKKIDSVVK 273


>gi|317059834|ref|ZP_07924319.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           3_1_5R]
 gi|313685510|gb|EFS22345.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           3_1_5R]
          Length = 288

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 131/267 (49%), Positives = 191/267 (71%), Gaps = 1/267 (0%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
           G+N V+   ++RF LIAGPC +ES +    +A ++  IC+ L I  ++K+SFDKANRSS+
Sbjct: 21  GEN-VSIGGKKRFTLIAGPCVMESQELMLEVAGEINKICKKLGIEYIFKASFDKANRSSI 79

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG GL++G ++ + +K  YG P++TD+H   QCE +A+  D+LQIPA LCRQTDLL 
Sbjct: 80  HSYRGPGLEEGLKMLQKVKDTYGIPVVTDIHEPWQCEKVAEVADLLQIPAFLCRQTDLLI 139

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           AAA TG+ +N+KKGQFL+PW+M N++ K+   G + +L CERG++FGYN +V DMRS+  
Sbjct: 140 AAAATGKPVNIKKGQFLAPWDMKNVVVKMEESGNEGILLCERGSTFGYNNMVVDMRSLLE 199

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M   G PV+FD +H+VQ+PG  GN + G+R+Y+ PL +A +AIG+  IF E H +P+ A 
Sbjct: 200 MRKFGYPVVFDVTHAVQKPGGLGNATSGDREYVYPLMRAGLAIGVDAIFAEVHPNPEVAK 259

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
           SDGPNM+ +KDL ++L   + ID ++K
Sbjct: 260 SDGPNMLYLKDLEEILKVAIQIDDLVK 286


>gi|197117988|ref|YP_002138415.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter bemidjiensis
           Bem]
 gi|226761659|sp|B5E8N4|KDSA_GEOBB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|197087348|gb|ACH38619.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Geobacter bemidjiensis Bem]
          Length = 273

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 133/254 (52%), Positives = 182/254 (71%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             L+AGPC IE+       AE+L +IC  + I L++K+S+DKANR+S+   RG G+K+G 
Sbjct: 18  LALVAGPCVIENETATLRCAERLMSICNGVGISLIFKASYDKANRTSVTAFRGPGMKEGL 77

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            I   +K+  G P+L+D+H+ +Q E  A+ +D+LQIPA LCRQTDLL AA  TG+VINVK
Sbjct: 78  RILAKVKEALGVPVLSDIHSIEQVEPAAEVLDVLQIPAFLCRQTDLLVAAGNTGKVINVK 137

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+PW+M N++ K+ +    +++  ERG SFGYN LV DMRS PIM S G PVIFDA
Sbjct: 138 KGQFLAPWDMKNVVGKISSCDNDNIILTERGASFGYNNLVVDMRSFPIMRSTGYPVIFDA 197

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G  SGG+R+Y+  L++AAVA G+ GIF+E H++P+ A  DGPN + + D+
Sbjct: 198 THSVQLPGGEGTSSGGQREYVEFLSRAAVAAGVDGIFMEVHEEPEQALCDGPNSVRLDDM 257

Query: 285 PKLLSQLLAIDKII 298
           P LL +L AID I+
Sbjct: 258 PALLKKLKAIDAIV 271


>gi|114707414|ref|ZP_01440310.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fulvimarina pelagi
           HTCC2506]
 gi|114536973|gb|EAU40101.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fulvimarina pelagi
           HTCC2506]
          Length = 277

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 156/280 (55%), Positives = 204/280 (72%), Gaps = 6/280 (2%)

Query: 20  HMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLV 79
           H+IH   A         V F+N   F LIAGPCQ+ES DHA MIAE++  I + L IG V
Sbjct: 2   HLIHNQVA------AATVNFANTSPFALIAGPCQMESRDHAMMIAERMKRITEDLGIGYV 55

Query: 80  YKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQ 139
           +K+SFDKANR+SL G+RG+GL     +F +++ +   P+LTD+HTE+Q        DILQ
Sbjct: 56  FKASFDKANRTSLKGRRGIGLSDALPVFAEIRDQLRLPVLTDIHTEEQAAEAGKVCDILQ 115

Query: 140 IPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFG 199
           IPA LCRQTDLL AAA+TG V+N+KKGQFL+PW+M N+L K+   G  +VL  ERG SFG
Sbjct: 116 IPAFLCRQTDLLIAAAKTGCVVNIKKGQFLAPWDMKNVLAKVTESGNPNVLLTERGVSFG 175

Query: 200 YNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
           YNTLV+D R++PIM   G PV+FDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+AG
Sbjct: 176 YNTLVSDFRALPIMAETGAPVVFDATHSVQQPGGQGGSSGGERRFVETLARAAVAVGVAG 235

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +F+ETH DPD+APSDGPNM+ +  +P LL +L A+D ++K
Sbjct: 236 LFIETHDDPDHAPSDGPNMVPLDRMPDLLGRLKALDDLVK 275


>gi|260889985|ref|ZP_05901248.1| 3-deoxy-8-phosphooctulonate synthase [Leptotrichia hofstadii F0254]
 gi|260860591|gb|EEX75091.1| 3-deoxy-8-phosphooctulonate synthase [Leptotrichia hofstadii F0254]
          Length = 278

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 136/267 (50%), Positives = 186/267 (69%), Gaps = 1/267 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           + +T  N++ F LIAGPC IES D    +A K+  I   L I  V+K+SFDKANRSS++ 
Sbjct: 13  DNITIGNDKIF-LIAGPCVIESEDLVMEVAAKMKYITDKLGIQYVFKASFDKANRSSISS 71

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG EI   +K+KYG  + TD+H   QC+  +  +D+LQIPA L RQTDLL AA
Sbjct: 72  FRGPGLEKGLEILARVKEKYGVALATDIHEPWQCKEASKVIDLLQIPAFLSRQTDLLVAA 131

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+ +N+KKGQFL+PW+M N+++K    G ++++ CERG SFGYN LV DMR +  M 
Sbjct: 132 AETGKAVNIKKGQFLAPWDMKNVVRKFEEVGNENIMLCERGASFGYNNLVVDMRGLLEMR 191

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG R Y+ PLA+AAV++GI G+F E H +P+   SD
Sbjct: 192 KFGYPVVFDATHSVQIPGGQGETSGGNRAYVYPLARAAVSVGIDGVFAEVHPEPEKGLSD 251

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GPNM+ + ++  +L++LL  DK+ K L
Sbjct: 252 GPNMLKLDNVEDILTKLLQYDKLTKEL 278


>gi|296327806|ref|ZP_06870344.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium nucleatum
           subsp. nucleatum ATCC 23726]
 gi|296155062|gb|EFG95841.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium nucleatum
           subsp. nucleatum ATCC 23726]
          Length = 295

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 185/263 (70%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   R
Sbjct: 31  IVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIFKASFDKANRSSIYSYR 90

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++   +K+K+  P++TDVH   QC+ +A   DILQIPA LCRQTDLL AAA+
Sbjct: 91  GPGLEEGMKMLTKIKEKFNVPVITDVHEAWQCKEVAKVADILQIPAFLCRQTDLLIAAAE 150

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +N+KKGQFL+PW+M NI+ K+     K+++ CERG++FGYN +V DMRS+  M   
Sbjct: 151 TGKAVNIKKGQFLAPWDMKNIVVKMEESRNKNIMLCERGSTFGYNNMVVDMRSLLEMRKF 210

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PVIFD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P  A SDGP
Sbjct: 211 NYPVIFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPAEAKSDGP 270

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +KDL ++L   + IDKI+K
Sbjct: 271 NMLYLKDLEEILKIAIEIDKIVK 293


>gi|260575602|ref|ZP_05843600.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sp. SW2]
 gi|259022245|gb|EEW25543.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sp. SW2]
          Length = 276

 Score =  295 bits (756), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 141/263 (53%), Positives = 190/263 (72%), Gaps = 1/263 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T  N+Q  ++IAGPCQ+ES DHA MIA  L   C +     V+K+S+DKANR+SL+G+R
Sbjct: 9   LTVGNDQPLLVIAGPCQLESLDHAQMIAGTLREACAAAGAQFVFKASYDKANRTSLSGRR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           GVG++ G +I   ++   G P+LTDVH  +Q  A A  VD++QIPA LCRQTDLL AA +
Sbjct: 69  GVGMQAGLDILAAVRA-MGVPVLTDVHDVEQARAAAVVVDVIQIPAFLCRQTDLLIAAGE 127

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG V+NVKKGQFL+P  M N+ QK+ + G   +L  ERG  FGYN LV DMR +PIM   
Sbjct: 128 TGAVVNVKKGQFLAPEGMANVAQKVASTGNDRILLTERGVCFGYNALVVDMRGLPIMART 187

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVI DA+H+VQQPG  GN +GG+R++   LA+AAV++GIAG+F+ETH+DPDNAPSDGP
Sbjct: 188 GYPVIMDATHAVQQPGGLGNSTGGQREFAPVLARAAVSLGIAGVFIETHEDPDNAPSDGP 247

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +  +  ++  L+A D++ K
Sbjct: 248 NMVPLGQMAAVVDSLMAFDRLAK 270


>gi|16125678|ref|NP_420242.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Caulobacter crescentus
           CB15]
 gi|221234433|ref|YP_002516869.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Caulobacter crescentus
           NA1000]
 gi|22095805|sp|Q9A8C5|KDSA_CAUCR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|254807737|sp|B8H5A9|KDSA_CAUCN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|13422792|gb|AAK23410.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Caulobacter crescentus
           CB15]
 gi|220963605|gb|ACL94961.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Caulobacter crescentus
           NA1000]
          Length = 287

 Score =  295 bits (756), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 203/285 (71%), Gaps = 1/285 (0%)

Query: 16  IDKNHMIHTNAAIHLGSGKNQ-VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSL 74
           +D+   +  NA + + +     V   N ++  +IAGPCQ+ES  HA   A  L  +   L
Sbjct: 1   MDQPKAVAPNAVVEIKTPTGAPVRIGNGEKLSIIAGPCQMESRQHALETAHALKEMADRL 60

Query: 75  NIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADS 134
            +GL+YK+S+DKANR+S   +RG+GLK    IF+++++  G P LTDVH    C  +A++
Sbjct: 61  GVGLIYKTSYDKANRTSANAQRGIGLKDSLAIFQEIREVTGLPTLTDVHETSHCSIVAEA 120

Query: 135 VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER 194
           VD++QIPA LCRQTDLL AAA TGR IN+KKGQFL+PW+M N++ K+   G  +V+ CER
Sbjct: 121 VDVIQIPAFLCRQTDLLVAAASTGRAINIKKGQFLAPWDMKNVIAKVTGAGNPNVMACER 180

Query: 195 GTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVA 254
           G SFGYNTLV+DMR++PIM  +G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA
Sbjct: 181 GASFGYNTLVSDMRALPIMKEIGCPVVFDATHSVQQPGGQGTSSGGQREFVPTLARAAVA 240

Query: 255 IGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +G+A +F+ETH DPDNAPSDGPNM+ +K+   L++ LL  D + K
Sbjct: 241 VGVACVFIETHPDPDNAPSDGPNMVPVKEFEALVANLLRYDALTK 285


>gi|19704559|ref|NP_604121.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
 gi|19714847|gb|AAL95420.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
          Length = 286

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 185/263 (70%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   R
Sbjct: 22  IVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIFKASFDKANRSSIYSYR 81

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++   +K+K+  P++TDVH   QC+ +A   DILQIPA LCRQTDLL AAA+
Sbjct: 82  GPGLEEGMKMLTKIKEKFNVPVITDVHEAWQCKEVAKVADILQIPAFLCRQTDLLIAAAE 141

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +N+KKGQFL+PW+M NI+ K+     K+++ CERG++FGYN +V DMRS+  M   
Sbjct: 142 TGKAVNIKKGQFLAPWDMKNIVVKMEESRNKNIMLCERGSTFGYNNMVVDMRSLLEMRKF 201

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PVIFD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P  A SDGP
Sbjct: 202 NYPVIFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPAEAKSDGP 261

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +KDL ++L   + IDKI+K
Sbjct: 262 NMLYLKDLEEILKIAIEIDKIVK 284


>gi|37999953|sp|Q8RE91|KDSA_FUSNN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
          Length = 278

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 185/264 (70%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   
Sbjct: 13  NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIFKASFDKANRSSIYSY 72

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++   +K+K+  P++TDVH   QC+ +A   DILQIPA LCRQTDLL AAA
Sbjct: 73  RGPGLEEGMKMLTKIKEKFNVPVITDVHEAWQCKEVAKVADILQIPAFLCRQTDLLIAAA 132

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +N+KKGQFL+PW+M NI+ K+     K+++ CERG++FGYN +V DMRS+  M  
Sbjct: 133 ETGKAVNIKKGQFLAPWDMKNIVVKMEESRNKNIMLCERGSTFGYNNMVVDMRSLLEMRK 192

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PVIFD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P  A SDG
Sbjct: 193 FNYPVIFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPAEAKSDG 252

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +KDL ++L   + IDKI+K
Sbjct: 253 PNMLYLKDLEEILKIAIEIDKIVK 276


>gi|119383978|ref|YP_915034.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Paracoccus denitrificans
           PD1222]
 gi|119373745|gb|ABL69338.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Paracoccus denitrificans
           PD1222]
          Length = 277

 Score =  295 bits (754), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 141/263 (53%), Positives = 192/263 (73%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           VT  N+Q   LIAGPCQ+E+ DHA MIAE +   C     G V+K+S+DKANR+SL G+R
Sbjct: 9   VTVGNDQPLALIAGPCQLETLDHALMIAETVAESCAKAGAGFVFKASYDKANRTSLKGRR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+ +G  +  +++++ G P+LTDVH  +Q       VD++QIPA L RQTDLL AA +
Sbjct: 69  GIGIDEGLRMLDEVRRRIGCPVLTDVHDIEQARLAGAVVDVIQIPAFLSRQTDLLLAAGE 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T   +N+KKGQFL+PW+M N+ +K+ + G + +L  ERG SFGYNTLV DMRS+PIM   
Sbjct: 129 TPAAVNIKKGQFLAPWDMPNVAEKVASTGNERILLTERGVSFGYNTLVADMRSLPIMART 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVI DA+HSVQQPG  G  SGG+R++   +A+AAVA+G+AG+F+ETHQDPDNAPSDGP
Sbjct: 189 GWPVIMDATHSVQQPGGQGGSSGGQREFAPVMARAAVALGVAGVFIETHQDPDNAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI++  +P L++ L+  D + K
Sbjct: 249 NMIHLDRMPALIASLMRFDALAK 271


>gi|56695849|ref|YP_166200.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ruegeria pomeroyi DSS-3]
 gi|56677586|gb|AAV94252.1| 3-deoxy-8-phosphooctulonate synthase [Ruegeria pomeroyi DSS-3]
          Length = 277

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 146/263 (55%), Positives = 193/263 (73%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T  N+    +IAGPCQ+ES DHA MIA  L   C +     V+K+S+DKANR+SL GKR
Sbjct: 9   LTVGNDLPLTIIAGPCQLESADHAQMIAGTLKEACDAAGAQYVFKASYDKANRTSLGGKR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+  G ++  D+++  G P+LTDVH+E QC   A++VD+LQIPA LCRQTD+L AA  
Sbjct: 69  GMGIDAGLKVLDDIRRTMGVPVLTDVHSEAQCAIAAEAVDVLQIPAFLCRQTDMLLAAGN 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VINVKKGQFL+PWEM NI+ K+ + G +++L  ERG SFGYNTLV DMR++PIM   
Sbjct: 129 TGAVINVKKGQFLAPWEMGNIVDKIASTGNENILLTERGVSFGYNTLVADMRALPIMAQT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAVA+G A +F+ETHQDPDNAP DGP
Sbjct: 189 GYPVVMDATHSVQQPGGRGGSSGGQREFAPVMARAAVAVGTAAVFMETHQDPDNAPCDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI + ++P L+  L+  D + K
Sbjct: 249 NMIYLDEMPGLIDTLMRFDALAK 271


>gi|237739967|ref|ZP_04570448.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           2_1_31]
 gi|229421984|gb|EEO37031.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           2_1_31]
          Length = 278

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 131/264 (49%), Positives = 184/264 (69%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   
Sbjct: 13  NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIFKASFDKANRSSIHSY 72

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++    K+K+   ++TDVH   QC+ +A   DILQIPA LCRQTDLL AAA
Sbjct: 73  RGPGLEEGMKMLAKTKEKFNVSVITDVHEAWQCKEVAKVADILQIPAFLCRQTDLLIAAA 132

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +N+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGYN +V DMRS+  M  
Sbjct: 133 ETGKAVNIKKGQFLAPWDMKNIVVKMEESGNKNIMLCERGSTFGYNNMVVDMRSLLEMRK 192

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P  A SDG
Sbjct: 193 FNYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPTEAKSDG 252

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +KDL ++L   + IDKI+K
Sbjct: 253 PNMLYLKDLEEILKTAIEIDKIVK 276


>gi|296533807|ref|ZP_06896347.1| 3-deoxy-8-phosphooctulonate synthase [Roseomonas cervicalis ATCC
           49957]
 gi|296265866|gb|EFH11951.1| 3-deoxy-8-phosphooctulonate synthase [Roseomonas cervicalis ATCC
           49957]
          Length = 286

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 151/279 (54%), Positives = 201/279 (72%), Gaps = 4/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   N  +  G     V F  +    +IAGPCQ+ES  HA  +A  L  I   +  GLVY
Sbjct: 1   MTQPNPIVEAGP----VRFGQDLPLAVIAGPCQLESRQHALEMASALKEIAARVGFGLVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANR+S   +RG+GL+K   IF ++++  G P+LTDVH  +QC  +A++VDILQI
Sbjct: 57  KTSFDKANRTSATAQRGLGLEKSLPIFAEIRESLGLPVLTDVHNAEQCAPVAEAVDILQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA TGRV+NVKKGQFL+PW+M N++ KL   G  +VL  +RGTSFGY
Sbjct: 117 PAFLCRQTDLLLAAAATGRVVNVKKGQFLAPWDMANVVDKLTGAGNANVLLTDRGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV+D R +P+M   G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+
Sbjct: 177 NTLVSDFRCLPVMARTGAPVVFDATHSVQQPGGLGGSSGGQREFVPVLARAAVAVGVAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+ETH++PD APSDGPNM+ +     LLS+L+A+D++ K
Sbjct: 237 FIETHENPDKAPSDGPNMVPLHRFEALLSELVALDRLSK 275


>gi|254511604|ref|ZP_05123671.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacteraceae bacterium
           KLH11]
 gi|221535315|gb|EEE38303.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacteraceae bacterium
           KLH11]
          Length = 277

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 141/263 (53%), Positives = 190/263 (72%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T  N+    +IAGPCQ+E+ DHA MIA  +   C +     V+K+S+DKANR+SL+GKR
Sbjct: 9   LTVGNDLPLTVIAGPCQLETADHARMIAGTMKEACDAAGAQYVFKASYDKANRTSLSGKR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+  G ++  D++   G P+LTDVHTE QC   A+ VDILQIPA LCRQTD+L AA  
Sbjct: 69  GMGIDAGLKVLGDIRHTMGIPVLTDVHTEAQCAIAAEVVDILQIPAFLCRQTDMLLAAGS 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +NVKKGQFL+PWEM NI+ K+ + G +++L  ERGTSFGYNTLV DMRS+P M   
Sbjct: 129 TGKAVNVKKGQFLAPWEMPNIVTKIESTGNQNILLTERGTSFGYNTLVADMRSLPQMAKT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++G+  +F+ETHQ+PD APSDGP
Sbjct: 189 GYPVVMDATHSVQQPGGQGGSSGGQREFAPVMARAAVSLGVGAVFIETHQEPDTAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +  L+  L+  D + K
Sbjct: 249 NMIPLDQMGHLIDTLMRFDALAK 271


>gi|253582904|ref|ZP_04860122.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium varium ATCC
           27725]
 gi|251835110|gb|EES63653.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium varium ATCC
           27725]
          Length = 279

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 183/267 (68%), Gaps = 1/267 (0%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
           GKN +      RF LIAGPC IES +    +A K+  IC  L I  ++K+SFDKANRSS+
Sbjct: 12  GKN-IEIGGNNRFTLIAGPCVIESEELVMEVAGKVKEICDRLGINYIFKASFDKANRSSI 70

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG G+++G  I + +K  YG P++TDVH   QC+  A+ VD++QIPA LCRQTDLL 
Sbjct: 71  HSYRGPGIEEGLRILKKVKDTYGLPVVTDVHEVWQCKKAAEVVDLIQIPAFLCRQTDLLI 130

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           AAA+TG  +NVKKGQFL+PW+M N++ K+   G  +V+ CERG++FGYN +V DMRS   
Sbjct: 131 AAAETGLPVNVKKGQFLAPWDMKNVVTKMEESGNPNVMLCERGSTFGYNNMVVDMRSFME 190

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M   G PV+FD +H+VQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P+ A 
Sbjct: 191 MRKFGYPVVFDVTHAVQKPGGLGTATSGDREYVYPLMRAGLAIGVDAIFAEVHPNPEKAM 250

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
           SDGPNM+ + DL ++L   + ID ++K
Sbjct: 251 SDGPNMLYLSDLEEILKMAVKIDDLVK 277


>gi|148255831|ref|YP_001240416.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bradyrhizobium sp.
           BTAi1]
 gi|158513285|sp|A5EK16|KDSA_BRASB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|146408004|gb|ABQ36510.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bradyrhizobium sp.
           BTAi1]
          Length = 286

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 151/265 (56%), Positives = 197/265 (74%), Gaps = 1/265 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            V F N+    +IAGPCQ+ES  HA  +A  L  I   LNIGLVYK+SFDKANR+S +  
Sbjct: 15  SVRFGNDLPLAVIAGPCQLESRGHALEVASALKEIATRLNIGLVYKTSFDKANRTSGSAA 74

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+GL +   IF +++   G P+LTD+H   QC  +A +VD+LQIPA LCRQTDLL AAA
Sbjct: 75  RGLGLAQSLPIFAEIRSSLGLPVLTDIHDASQCAEVAQAVDVLQIPAFLCRQTDLLLAAA 134

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT- 214
            TG+V+NVKKGQFL+PW+M N++ K+   G  +VL  ERG SFGYNTL++DMRS+PIM  
Sbjct: 135 ATGKVVNVKKGQFLAPWDMANVVAKITGAGNPNVLATERGVSFGYNTLISDMRSLPIMAR 194

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETH DPD+APSD
Sbjct: 195 TTGAPVIFDATHSVQQPGGQGTSSGGQREFVPVLARAAVAVGVAGVFIETHPDPDHAPSD 254

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ + +   LL +L+A DK+ K
Sbjct: 255 GPNMVPLAEFEGLLRRLMAFDKLAK 279


>gi|296448368|ref|ZP_06890256.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylosinus
           trichosporium OB3b]
 gi|296254129|gb|EFH01268.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylosinus
           trichosporium OB3b]
          Length = 285

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 150/264 (56%), Positives = 196/264 (74%), Gaps = 1/264 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V+F+ +  F LIAGPC +ES DHA  I   L  + + L IG V+K+SFDKANR+S A  R
Sbjct: 15  VSFAADLPFALIAGPCAMESRDHALDICGALTELTRRLGIGFVFKASFDKANRTSGASPR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           GVGL+    IF ++K+++G P+ TDVH   QC  +A  VDILQIPALLCRQTDLL AAA+
Sbjct: 75  GVGLEAALPIFAEIKQRFGVPVTTDVHEAAQCARVAAVVDILQIPALLCRQTDLLVAAAK 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT-S 215
           TGRV+NVKKGQFL+P +M ++  K+ + G ++VL  ERGTSFGY  LV+DMR++PIM  +
Sbjct: 135 TGRVVNVKKGQFLAPADMAHVAAKIASAGNRNVLLTERGTSFGYGALVSDMRALPIMARA 194

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFDA+HSVQQPG  G+ SGGER+++  LA+AAVA+G+AG+FLETH  P+ A SDG
Sbjct: 195 TGAPVIFDATHSVQQPGGLGDRSGGEREFVSTLARAAVAVGVAGLFLETHDAPERALSDG 254

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
            +MI + +L  LL QL+ ID+  K
Sbjct: 255 ASMIPLAELGGLLEQLMEIDRAAK 278


>gi|81301098|ref|YP_401306.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus elongatus
           PCC 7942]
 gi|123769197|sp|Q31KV0|KDSA_SYNE7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|81169979|gb|ABB58319.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus elongatus
           PCC 7942]
          Length = 284

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 131/254 (51%), Positives = 177/254 (69%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             L  GPC IE  D +  +AE +  +C  L +  V+KSSFDKANR+S+   RG GL++G 
Sbjct: 23  LTLFGGPCVIEGEDFSLKMAESIAKVCDRLGVQFVFKSSFDKANRTSIGSFRGYGLEEGL 82

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            I   +K + G P+LTD+H  QQ   +A+ VDILQIPA LCRQTDLL AAA TGR +NVK
Sbjct: 83  RILERVKTELGLPVLTDIHESQQAATVAEVVDILQIPAFLCRQTDLLLAAAATGRTVNVK 142

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           K QFL+PW+M N++ KL   GA+++L  ERG+ FGYN LV D RS+P+M  +G PV+FDA
Sbjct: 143 KAQFLAPWDMKNVVNKLRQGGAENLLLTERGSCFGYNALVVDFRSLPLMRELGCPVVFDA 202

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G+ S G+R+++  LA+AA A+GI  +F+E H++PD A SDGPNMI + DL
Sbjct: 203 THSVQIPGGAGDRSSGQREFVPVLARAAAAVGIDALFMEIHENPDQALSDGPNMIRLADL 262

Query: 285 PKLLSQLLAIDKII 298
              L Q+L + + +
Sbjct: 263 EATLRQILRVREAV 276


>gi|257468654|ref|ZP_05632748.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium ulcerans
           ATCC 49185]
 gi|317062911|ref|ZP_07927396.1| KDO-8-phosphate synthetase [Fusobacterium ulcerans ATCC 49185]
 gi|313688587|gb|EFS25422.1| KDO-8-phosphate synthetase [Fusobacterium ulcerans ATCC 49185]
          Length = 279

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 131/267 (49%), Positives = 183/267 (68%), Gaps = 1/267 (0%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
           GKN +      RF LIAGPC IES +    +A K+  IC  L I  ++K+SFDKANRSS+
Sbjct: 12  GKN-IEIGGNNRFTLIAGPCVIESEELVMEVAGKVKEICDRLGINYIFKASFDKANRSSI 70

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG G+++G  I + +K  YG P++TDVH   QC+  A+ VD++QIPA LCRQTDLL 
Sbjct: 71  HSYRGPGIEEGLRILKKVKDTYGLPVVTDVHEVWQCKKAAEVVDLIQIPAFLCRQTDLLI 130

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           AAA+TG  +NVKKGQFL+PW+M N++ K+   G  +V+ CERG++FGYN +V DMR+   
Sbjct: 131 AAAETGLPVNVKKGQFLAPWDMKNVVTKMEESGNPNVMLCERGSTFGYNNMVVDMRAFME 190

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M   G PV+FD +H+VQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P+ A 
Sbjct: 191 MRKFGYPVVFDVTHAVQKPGGLGTATSGDREYVYPLMRAGLAIGVDAIFAEVHPNPEKAM 250

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
           SDGPNM+ + DL ++L   + ID ++K
Sbjct: 251 SDGPNMLYLSDLEEILKMAVKIDDLVK 277


>gi|257463927|ref|ZP_05628312.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. D12]
 gi|317061453|ref|ZP_07925938.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. D12]
 gi|313687129|gb|EFS23964.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. D12]
          Length = 278

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 129/279 (46%), Positives = 190/279 (68%), Gaps = 3/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           MI     + +G     +T   ++RF LIAGPC +ES +    +A ++ A+C+ L I  ++
Sbjct: 1   MIQDTKVVKVGE---NITIGGKKRFTLIAGPCVMESQELMLEVAGEISALCKKLGIDYIF 57

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL++G ++ + +K  Y  P++TD+H   QCE +A   D+LQI
Sbjct: 58  KASFDKANRSSIHSYRGPGLEEGLKMLQKVKDTYRVPVVTDIHEPWQCEKVAQVADLLQI 117

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA TG+ +N+KKGQFL+PW+M N++ K+   G + +L CERG++FGY
Sbjct: 118 PAFLCRQTDLLIAAAATGKPVNIKKGQFLAPWDMKNVVVKMEESGNEGILLCERGSTFGY 177

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS+  M   G PV+FD +H+VQ+PG  G  + G+R+Y+ PL +A +A+G+  I
Sbjct: 178 NNMVVDMRSLLEMRKFGYPVVFDVTHAVQKPGGLGTATSGDREYVYPLMRAGLAVGVDAI 237

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F E H +P+ A SDGPNM+ +KDL  +L   + ID ++K
Sbjct: 238 FAEVHPNPEVAKSDGPNMLYLKDLEDILKVAIQIDDLVK 276


>gi|77919540|ref|YP_357355.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pelobacter carbinolicus
           DSM 2380]
 gi|123729435|sp|Q3A372|KDSA_PELCD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|77545623|gb|ABA89185.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Pelobacter carbinolicus DSM 2380]
          Length = 277

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 131/263 (49%), Positives = 184/263 (69%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           VTF       LIAGPC +E+  H   IA +L  +   L +G+V+K+SFDKANR+S++  R
Sbjct: 10  VTFGGNHPVALIAGPCVMENEAHTLAIARQLLEVKNELGVGVVFKASFDKANRTSVSAYR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+ G  I   ++++ G PI++D+H   Q EA A+ +DILQIPA LCRQTDLL AA +
Sbjct: 70  GPGLESGLRILDKVRQQTGLPIVSDIHDVSQVEAAAEVLDILQIPAFLCRQTDLLLAAGR 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           +G+V+N+KKGQFL+PW+M N + K+ + G   +L  ERGTSFGYN LV DMRS+ +M  +
Sbjct: 130 SGKVVNIKKGQFLAPWDMANAVAKVASTGNDRILLTERGTSFGYNNLVVDMRSLAVMREL 189

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+H+VQ PG  G  SGG+RQ++  L++AAVA+G+ G+F E H DPD A  DG 
Sbjct: 190 GCPVVFDATHAVQLPGGAGTSSGGQRQFVAALSRAAVAVGVDGLFWEVHPDPDRALCDGA 249

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           N + +  + K L +++AID I+K
Sbjct: 250 NSLPLDQVKKTLKEMMAIDAIVK 272


>gi|254476972|ref|ZP_05090358.1| 3-deoxy-8-phosphooctulonate synthase [Ruegeria sp. R11]
 gi|214031215|gb|EEB72050.1| 3-deoxy-8-phosphooctulonate synthase [Ruegeria sp. R11]
          Length = 277

 Score =  291 bits (745), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 183/263 (69%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T  N+    LIAGPCQ+ES DHA M+A KL   C       V+K SFDKANR+SL  K 
Sbjct: 9   LTIGNDCPLTLIAGPCQLESADHAQMVAGKLKEACDKAGAQFVFKGSFDKANRTSLNAKP 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
            +GL +G ++   +KK+ G P++TD+H ++QCE +A  VDI+QIPA LCRQT LL AA +
Sbjct: 69  ALGLDEGLKVLDSVKKQIGVPVITDIHEKEQCEPVAAVVDIMQIPAFLCRQTALLLAAGK 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG  INVKKGQFL+PW+M N++ K+ + G   +L  ERG SFGYN LV DM+S+P M   
Sbjct: 129 TGAAINVKKGQFLAPWDMPNVVTKIESTGNDRILLTERGVSFGYNRLVVDMQSLPEMART 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+H+V QPG  G  SGG+R++   LA+AAVA GIA +F ETH+DPDNAP DGP
Sbjct: 189 GYPVVMDATHAVAQPGGLGGASGGQREFAPVLARAAVATGIAAVFTETHEDPDNAPCDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +PKL+  L+  D + K
Sbjct: 249 NMIYLDQMPKLIETLMRFDALAK 271


>gi|126739935|ref|ZP_01755626.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter sp.
           SK209-2-6]
 gi|126719167|gb|EBA15878.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter sp.
           SK209-2-6]
          Length = 277

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 195/263 (74%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T  N++   +IAGPCQ+ES DHA MIA  L   C+      V+K+S+DKANR+SL+GKR
Sbjct: 9   LTIGNDRPLTVIAGPCQLESADHAQMIAGTLKEACEKAGAQYVFKASYDKANRTSLSGKR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G+  G ++   ++K++G P+LTDVH+E QC   A++ DILQ+PA LCRQTD+L AA  
Sbjct: 69  GMGIDAGLKVLDGIRKEFGVPVLTDVHSEAQCALAAEAADILQVPAFLCRQTDMLLAAGN 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VINVKKGQFL+PWEM NI+ K+ + G   ++  ERG SFGYNTLV DMRS+PIM   
Sbjct: 129 TGAVINVKKGQFLAPWEMENIVTKIASTGNDKIMLTERGASFGYNTLVADMRSLPIMAQT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  G  SGG+R++   +A+AA AIG+A IF+ETHQDPDNAP DGP
Sbjct: 189 GCPVVMDATHSVQQPGGRGGSSGGQREFAPVMARAAAAIGVAAIFMETHQDPDNAPCDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +PKL+  L+A D++ K
Sbjct: 249 NMIYLDQMPKLIDTLMAFDRLAK 271


>gi|295689309|ref|YP_003593002.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Caulobacter segnis ATCC
           21756]
 gi|295431212|gb|ADG10384.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Caulobacter segnis ATCC
           21756]
          Length = 288

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 202/285 (70%), Gaps = 1/285 (0%)

Query: 16  IDKNHMIHTNAAIHLGSGKNQ-VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSL 74
           +D+   +  NA + + +     V   N +R  +IAGPCQ+ES  HA   A  L  + Q L
Sbjct: 1   MDQPQAVAPNAVVEIKTPTGAPVRIGNGERLSIIAGPCQMESRQHALETAHALKEMAQRL 60

Query: 75  NIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADS 134
            +G++YK+S+DKANR+S+  +RG+GLK    IF+++++  G P LTDVH    C  +A++
Sbjct: 61  GVGMIYKTSYDKANRTSVNAQRGIGLKDSLPIFQEIREVTGLPTLTDVHETSHCPIVAEA 120

Query: 135 VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER 194
           VD++QIPA LCRQTDLL AAA TGR IN+KKGQFL+PW+M N++ K+   G  +V+ CER
Sbjct: 121 VDVIQIPAFLCRQTDLLLAAAATGRAINIKKGQFLAPWDMKNVIAKVTGAGNPNVMACER 180

Query: 195 GTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVA 254
           G SFGYNTLV+DMRS+PIM  +G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA
Sbjct: 181 GVSFGYNTLVSDMRSLPIMKEIGCPVVFDATHSVQQPGGQGTSSGGQREFVPVLARAAVA 240

Query: 255 IGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +G+A +F+ETH DPD APSDGPNM+ +     L++ LL  D + K
Sbjct: 241 VGVACVFMETHPDPDKAPSDGPNMVPMSQFEALVANLLEYDALTK 285


>gi|258405726|ref|YP_003198468.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfohalobium
           retbaense DSM 5692]
 gi|257797953|gb|ACV68890.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfohalobium
           retbaense DSM 5692]
          Length = 271

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 140/261 (53%), Positives = 181/261 (69%), Gaps = 1/261 (0%)

Query: 39  FSNEQRFVL-IAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRG 97
           FS  +R +  I GPC +E  +    +AE+L AI   L I LV+KSSFDKANRSS+   RG
Sbjct: 8   FSLSRRSLFAIVGPCALEELELGLRVAERLAAIQDELGIPLVFKSSFDKANRSSVDSFRG 67

Query: 98  VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQT 157
            GL+ G E  + +K+  G P++TD+H  +Q   +AD  D+LQIPA LCRQTDLL AAA+T
Sbjct: 68  PGLQTGLEWLQRIKEASGLPVVTDIHAPEQARPVADVADVLQIPAFLCRQTDLLLAAAKT 127

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           GR++NVKKGQFL+PW+M N++ KL A G + +   ERG+SFGYN LV DMRSIPIM   G
Sbjct: 128 GRIVNVKKGQFLAPWDMANVVAKLEAGGGESIWLTERGSSFGYNNLVVDMRSIPIMQDTG 187

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
            P +FDA+HSVQ PG  G  SGG+RQ++  LA+AAVA G  GIFLE H DPD+A  DGPN
Sbjct: 188 WPAVFDATHSVQLPGGQGTRSGGQRQFVGTLARAAVAAGCNGIFLEVHPDPDHALCDGPN 247

Query: 278 MINIKDLPKLLSQLLAIDKII 298
            + +  L   L +LLA+ + +
Sbjct: 248 SLALDALAGELRRLLAVREAV 268


>gi|83955924|ref|ZP_00964435.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfitobacter sp.
           NAS-14.1]
 gi|83839688|gb|EAP78866.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfitobacter sp.
           NAS-14.1]
          Length = 248

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 144/248 (58%), Positives = 181/248 (72%)

Query: 54  IESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKK 113
           +ES DHA  IA  L   C  L I  V+K+S+DKANRSSL+GKRG+G++ G E    +K +
Sbjct: 1   MESLDHARKIAGSLVENCDDLGIPFVFKASYDKANRSSLSGKRGLGIELGLENLAKIKDE 60

Query: 114 YGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWE 173
           +G  +LTDVH    C   A+  DILQIPA L RQTDLL AA  TGRVIN+KKGQFL+PW+
Sbjct: 61  FGCAVLTDVHEASHCAKAAEVCDILQIPAFLSRQTDLLLAAGATGRVINIKKGQFLAPWD 120

Query: 174 MHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGI 233
           M N   K+ + G + ++ CERGTSFGYN LV+DMR++PIM   G PVIFDA+HSVQ PG 
Sbjct: 121 MANAAAKVASTGNESIMLCERGTSFGYNMLVSDMRALPIMADTGYPVIFDATHSVQLPGG 180

Query: 234 HGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLA 293
            G  SGG+RQ++ PLA+AA+A+G AG+FLETH+DPD APSDGPNMI + D+  LL +L A
Sbjct: 181 QGTSSGGQRQFVEPLARAALAVGCAGLFLETHEDPDKAPSDGPNMIPLDDMAGLLKRLCA 240

Query: 294 IDKIIKPL 301
            DK+ K L
Sbjct: 241 FDKLTKVL 248


>gi|307294792|ref|ZP_07574634.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingobium
           chlorophenolicum L-1]
 gi|306879266|gb|EFN10484.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingobium
           chlorophenolicum L-1]
          Length = 273

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 146/263 (55%), Positives = 194/263 (73%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           VT  N+  FVLI+GPCQIES DHA M+AE+L        +  ++KSSFDKANR+S++G+R
Sbjct: 10  VTVGNDLPFVLISGPCQIESRDHAMMMAERLSGAAAKAGVPFIFKSSFDKANRTSVSGQR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           GVG+  G  I   +K  +G P+LTD+H   Q  A A++VDILQIPA LCRQTDLL AA +
Sbjct: 70  GVGIDAGLAILAAVKAAFGCPVLTDIHEAGQVAAAAEAVDILQIPAFLCRQTDLLLAAGR 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG V+NVKKGQFL+PW+M  + QK+ + G + +L  ERG SFGYNTLV+DMRS+P+M   
Sbjct: 130 TGAVVNVKKGQFLAPWDMAAVAQKVASTGNERILLTERGASFGYNTLVSDMRSLPVMAQT 189

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQQPG  G+ SGG+R++   L ++AVA G+A +F E H DPDNAPSDGP
Sbjct: 190 GYPVVFDATHSVQQPGGLGSASGGQREFAPVLGRSAVAAGVAAVFAEAHDDPDNAPSDGP 249

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
            M+ ++ +  LL +L AID+++K
Sbjct: 250 VMLPVEWVGPLLEKLKAIDEVVK 272


>gi|56751820|ref|YP_172521.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus elongatus
           PCC 6301]
 gi|81561716|sp|Q5N119|KDSA_SYNP6 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|56686779|dbj|BAD80001.1| carboxysome formation protein CcmA [Synechococcus elongatus PCC
           6301]
          Length = 284

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 176/254 (69%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             L  GPC IE  D +  +AE +  +C  L +  V+KSSFDKANR+S+   RG GL++G 
Sbjct: 23  LTLFGGPCVIEGEDFSLKMAESIAKVCDRLGVQFVFKSSFDKANRTSIGSFRGYGLEEGL 82

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            I   +K + G P+LTD+H  QQ   +A+ VDILQIPA LCRQTDLL AAA TGR +NVK
Sbjct: 83  RILERVKTELGLPVLTDIHESQQAATVAEVVDILQIPAFLCRQTDLLLAAAATGRTVNVK 142

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           K QFL+PW+M N++ KL   GA+++L  ERG+ FGYN LV D RS+P+M  +G PV+FDA
Sbjct: 143 KAQFLAPWDMKNVVNKLRQGGAENLLLTERGSCFGYNALVVDFRSLPLMRELGCPVVFDA 202

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G+ S G+R+++  LA+AA A+GI  +F+E H++PD A SDGPNMI + DL
Sbjct: 203 THSVQIPGGAGDRSSGQREFVPVLARAAAAVGIDALFMEIHENPDQALSDGPNMIRLADL 262

Query: 285 PKLLSQLLAIDKII 298
              L  +L + + +
Sbjct: 263 EATLRHILRVREAV 276


>gi|146341030|ref|YP_001206078.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bradyrhizobium sp.
           ORS278]
 gi|158514224|sp|A4YVC7|KDSA_BRASO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|146193836|emb|CAL77853.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase; KDO-8-phosphate synthetase, KDOPS)
           [Bradyrhizobium sp. ORS278]
          Length = 287

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 193/264 (73%), Gaps = 1/264 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V F N+    +IAGPCQ+ES  HA  +A  L  I   LNI LVYK+SFDKANR+S +  R
Sbjct: 16  VRFGNQLPLAVIAGPCQLESRGHALEVASALKEIATRLNISLVYKTSFDKANRTSGSAAR 75

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+GL +   IF +++   G P+LTDVH   QC  +A +VDILQIPA LCRQTDLL AAA 
Sbjct: 76  GLGLAQSLPIFAEIRSSLGLPVLTDVHDASQCAEVAQAVDILQIPAFLCRQTDLLLAAAA 135

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT-S 215
           TG+V+NVKKGQFL+PW+M N++ K+   G  +VL  ERG SFGYNTL++DMRS+PIM  +
Sbjct: 136 TGKVVNVKKGQFLAPWDMANVVAKITGAGNPNVLATERGVSFGYNTLISDMRSLPIMAKT 195

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETH DPD+APSDG
Sbjct: 196 TGAPVIFDATHSVQQPGGQGTSSGGQREFVPVLARAAVAVGVAGVFIETHPDPDHAPSDG 255

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +     LL  L+A D + K
Sbjct: 256 PNMVPLAQFEGLLRTLMAFDALAK 279


>gi|170747413|ref|YP_001753673.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacterium
           radiotolerans JCM 2831]
 gi|238688769|sp|B1LZU2|KDSA_METRJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|170653935|gb|ACB22990.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 284

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 146/263 (55%), Positives = 195/263 (74%), Gaps = 2/263 (0%)

Query: 39  FSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGV 98
           F+N     LIAGPCQ+E   HA  IA  L  +   L +GLV+K+SFDKANR+S +  RG+
Sbjct: 18  FANHLPLTLIAGPCQLEGRQHALEIAAALKEMAAGLGVGLVFKTSFDKANRTSGSAARGI 77

Query: 99  GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTG 158
           GL     +F ++++  G P+LTDVH  +QC   A++VD+LQIPA LCRQTDLL AAA TG
Sbjct: 78  GLDGALPVFAEIRETLGLPVLTDVHAAEQCARAAEAVDVLQIPAFLCRQTDLLLAAAATG 137

Query: 159 RVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT--SM 216
           R +N+KKGQFL+PW+M ++  K+   G  +V+  ERG SFGYNTLV+DMRS+PIM   + 
Sbjct: 138 RAVNIKKGQFLAPWDMKHVAAKVTEAGNPNVIVTERGASFGYNTLVSDMRSLPIMAQVTQ 197

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETH DPD APSDGP
Sbjct: 198 GAPVVFDATHSVQQPGGQGASSGGQREFVAVLARAAVAVGVAGVFIETHPDPDRAPSDGP 257

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ ++D+P LL +LLA D++ K
Sbjct: 258 NMVALRDMPALLEELLAFDRLAK 280


>gi|262038488|ref|ZP_06011857.1| 3-deoxy-8-phosphooctulonate synthase [Leptotrichia goodfellowii
           F0264]
 gi|261747357|gb|EEY34827.1| 3-deoxy-8-phosphooctulonate synthase [Leptotrichia goodfellowii
           F0264]
          Length = 278

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 138/284 (48%), Positives = 186/284 (65%), Gaps = 10/284 (3%)

Query: 16  IDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN 75
           I+K + +     I +G+GK            LIAGPC IES D    +A K+  I   L 
Sbjct: 3   INKVNEVKITENIKVGNGK----------MFLIAGPCVIESEDLVNEVAAKMKEITDKLG 52

Query: 76  IGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSV 135
           I  V+K+SFDKANRSS++  RG G++KG EI   +K+KYG  + TD+H    C+  A+ +
Sbjct: 53  IQYVFKASFDKANRSSISSFRGPGIEKGLEILSRVKEKYGVALATDIHEPWHCKVAAEVI 112

Query: 136 DILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERG 195
           D+LQIPA L RQTDLL AA +TG+ +N+KKGQFL+PW+M N+++K    G K+++ CERG
Sbjct: 113 DLLQIPAFLSRQTDLLIAAGETGKAVNIKKGQFLAPWDMKNVVKKFEEIGNKNIMLCERG 172

Query: 196 TSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAI 255
            SFGYN LV DMR +  M   G PV+FDA+HSVQ PG  G  SGG   Y+ PLA+AA+A+
Sbjct: 173 ASFGYNNLVVDMRGLLEMRKFGYPVVFDATHSVQIPGGQGETSGGNSVYVYPLARAALAV 232

Query: 256 GIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           G+ GIF E H DP  A SDGPNM+ ++D+  +L  LL  D++ K
Sbjct: 233 GVDGIFAEVHPDPSVAKSDGPNMLKLEDVENILKHLLKYDELTK 276


>gi|56478956|ref|YP_160545.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aromatoleum aromaticum
           EbN1]
 gi|81598523|sp|Q5NZ70|KDSA_AZOSE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|56314999|emb|CAI09644.1| 2-dehydro-3-deoxyphosphooctonate aldolase (EC 2.5.1.55)
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) (KDOPS) [Aromatoleum aromaticum EbN1]
          Length = 279

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 181/260 (69%), Gaps = 2/260 (0%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAGPC IES D AF  A  L  IC  L I  +YKSS+DKANRSS    RG+G++
Sbjct: 11  DKPFFLIAGPCVIESRDMAFETAGALKEICVELGIPFIYKSSYDKANRSSGKSYRGMGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI  D+KK+ G P+LTDVH   +  A+A +VD+LQ PA LCRQTD + A A +GR +
Sbjct: 71  KGLEILADVKKQLGVPVLTDVHAIDEIPAVAAAVDVLQTPAFLCRQTDFIHAVAASGRPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAH--GAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
           N+KKGQFL+P +M N++ K      GA  ++ CERG SFGYN LV+DMRS+ IM   G P
Sbjct: 131 NIKKGQFLAPGDMKNVVDKAREANGGADTIMVCERGASFGYNNLVSDMRSLAIMRETGCP 190

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           V+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GIAG+F+E+H DP  A SDGPN  
Sbjct: 191 VVFDATHSVQLPGGQGTASGGQREFVPVLARAAVAVGIAGLFMESHPDPAKALSDGPNAW 250

Query: 280 NIKDLPKLLSQLLAIDKIIK 299
            +  +  LL+ L  ID ++K
Sbjct: 251 PLPKMKALLATLKEIDALVK 270


>gi|237755941|ref|ZP_04584530.1| 3-deoxy-8-phosphooctulonate synthase [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691890|gb|EEP60909.1| 3-deoxy-8-phosphooctulonate synthase [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 260

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 137/255 (53%), Positives = 181/255 (70%), Gaps = 2/255 (0%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQS-LNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           F +IAGPC IES +  F +A+ L ++ +   N+  V+KSSFDKANRSS+   RG GL+ G
Sbjct: 2   FTIIAGPCVIESKEICFEVAQVLKSLQEKHKNVRFVFKSSFDKANRSSIDSFRGKGLEYG 61

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
             + +D+K  +  P+LTD+H   Q + +A+ VDILQIPA LCRQTDLL AAA+TGR INV
Sbjct: 62  LAVLKDVKDTFNLPVLTDIHESYQAKPVAEVVDILQIPAFLCRQTDLLLAAAETGREINV 121

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQFL+PW+  NI++KL   GA  +   ERGT+FGYN LV D RS+PIM     PVI+D
Sbjct: 122 KKGQFLAPWDTKNIVEKLKFGGATKIYLTERGTTFGYNNLVVDFRSLPIMRQYA-PVIYD 180

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ PG  G  SGG+R++  PLAKAA+++G+ G+F ETH DPD A SDGPN I +K+
Sbjct: 181 ATHSVQLPGGLGKVSGGQREFAYPLAKAAISVGVDGLFFETHPDPDKALSDGPNQIPLKE 240

Query: 284 LPKLLSQLLAIDKII 298
            P ++  LL + + I
Sbjct: 241 FPNIVENLLKLREFI 255


>gi|86136540|ref|ZP_01055119.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter sp. MED193]
 gi|85827414|gb|EAQ47610.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter sp. MED193]
          Length = 277

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 137/263 (52%), Positives = 183/263 (69%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T  N++   ++AGPCQ+ES DHA MIA  L   C       V+K S+DKANR+S+  K 
Sbjct: 9   LTIGNDRPLTILAGPCQLESADHAQMIAGTLKEACDKAGAQFVFKGSYDKANRTSINAKP 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
            +GL+KG E+ + +K   G P+LTD+H  + C  +A+ VDILQIPA LCRQT LL AA +
Sbjct: 69  ALGLEKGLEVLQSVKDSIGVPVLTDIHEAEHCAPVAEVVDILQIPAFLCRQTALLLAAGR 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VINVKKGQFL+PW+M N+  K+ + G + ++  ERG SFGYN LV DM+S+P M   
Sbjct: 129 TGAVINVKKGQFLAPWDMPNVAAKIASTGNERIMLTERGVSFGYNRLVVDMQSLPEMART 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+H+V QPG  G  SGG+R++   LA+AAVA GIA +F+ETH DPDNAP DGP
Sbjct: 189 GYPVVMDATHAVAQPGGLGGASGGQREFAPVLARAAVATGIASVFMETHHDPDNAPCDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +P+L+  L+A D + K
Sbjct: 249 NMIYLDQMPQLIETLMAFDALAK 271


>gi|218530958|ref|YP_002421774.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacterium
           chloromethanicum CM4]
 gi|254561946|ref|YP_003069041.1| 3-deoxy-8-phosphooctulonate synthase [Methylobacterium extorquens
           DM4]
 gi|218523261|gb|ACK83846.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacterium
           chloromethanicum CM4]
 gi|254269224|emb|CAX25190.1| 3-deoxy-8-phosphooctulonate synthase [Methylobacterium extorquens
           DM4]
          Length = 282

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 150/265 (56%), Positives = 193/265 (72%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V F+N     LIAGPCQ+E  +HA  IA  L  +   L IGLV+KSSFDKANR+S    R
Sbjct: 17  VAFANHLPLALIAGPCQLEGRNHALEIAAALKEMAAKLGIGLVFKSSFDKANRTSGRTAR 76

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           GVGL +   +F ++++  G P+LTDVH  + C   A +VDILQIPA LCRQTDLL AAA 
Sbjct: 77  GVGLDEALPVFAEIRESLGLPVLTDVHEAEHCARAAQAVDILQIPAFLCRQTDLLLAAAA 136

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGR +NVKKGQFL+PW+M ++  K+   G  +V+  ERG SFGYNTLV+DMRS+PIM  +
Sbjct: 137 TGRAVNVKKGQFLAPWDMAHVAAKVTEAGNPNVIVTERGASFGYNTLVSDMRSLPIMARV 196

Query: 217 --GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETH DPD APSD
Sbjct: 197 TGGAPVVFDATHSVQQPGGQGTTSGGQREFVAVLARAAVAVGVAGVFIETHPDPDRAPSD 256

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ + DLP L+  L+A D++ K
Sbjct: 257 GPNMVALADLPALIETLMAFDRLAK 281


>gi|320103578|ref|YP_004179169.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Isosphaera pallida ATCC
           43644]
 gi|319750860|gb|ADV62620.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Isosphaera pallida ATCC
           43644]
          Length = 303

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 133/262 (50%), Positives = 182/262 (69%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
           G + V     +  VLIAGPC +E  D +  IA +L  I  +L + L++K+SFDKANR+S 
Sbjct: 37  GSSIVEIGRGRGLVLIAGPCVMEPGDLSRRIAGRLAEIGDALKVPLIFKASFDKANRTSR 96

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
           +  RG+G+ +G +IF  +K + G P+ TD+H   Q   +A  VD+LQIPA L RQTDLL 
Sbjct: 97  SSYRGIGIDEGLKIFERIKAQTGLPVTTDIHESHQAATVAQVVDLLQIPAFLARQTDLLE 156

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           AAA TGR +NVKKGQF++PW+M +++ KL A GA+D+L  ERGT+FGY  LV D R++PI
Sbjct: 157 AAAATGRAVNVKKGQFMAPWDMTHVVGKLTAAGARDLLLTERGTTFGYGRLVNDFRALPI 216

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M + G PV+FDA+HSVQ P      + GER+ + PLA+AAVA+G+  +FLE H DPD+A 
Sbjct: 217 MRATGAPVVFDATHSVQLPSAGAGVTQGEREMVPPLARAAVAVGVDALFLEVHPDPDHAL 276

Query: 273 SDGPNMINIKDLPKLLSQLLAI 294
           SDGPN + + DLP+LL   LA+
Sbjct: 277 SDGPNALKLDDLPELLKVCLAL 298


>gi|225848204|ref|YP_002728367.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225643555|gb|ACN98605.1| 3-deoxy-8-phosphooctulonate synthase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 262

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 179/257 (69%), Gaps = 2/257 (0%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           RF +IAGPC IES +  F +AE L  + +   +I  V+KSSFDKANRSSL   RG GL+ 
Sbjct: 3   RFTIIAGPCVIESREICFEVAEVLRQLQEKYSDIRFVFKSSFDKANRSSLESFRGRGLEW 62

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G  + +D+K K+G  +LTD+H   Q + +++ VDI+QIPA LCRQTDLL AAA+TG+ +N
Sbjct: 63  GLSVLKDVKDKFGLEVLTDIHESYQAKPVSEVVDIIQIPAFLCRQTDLLLAAAETGKEVN 122

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQFL+PW+  NI+ KL   GA  +   ERGT+FGYN LV D R + IM     PVIF
Sbjct: 123 VKKGQFLAPWDTKNIVDKLKFGGADKIYLTERGTTFGYNNLVVDFRGLKIMRQYA-PVIF 181

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGG+R++  PLAKAAV +G+ G+F ETH DPD A SDGPN I +K
Sbjct: 182 DATHSVQIPGGLGKASGGQREFAYPLAKAAVVVGVDGLFFETHPDPDKALSDGPNQIPLK 241

Query: 283 DLPKLLSQLLAIDKIIK 299
           D P ++  LL + + ++
Sbjct: 242 DFPTIVENLLRLREFVE 258


>gi|302383035|ref|YP_003818858.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193663|gb|ADL01235.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 288

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 149/281 (53%), Positives = 201/281 (71%), Gaps = 2/281 (0%)

Query: 21  MIHTNAAIHL-GSG-KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGL 78
           M   NA I L G+G    V      R   IAGPCQ+ES  HA  +A  L  I Q LN+G+
Sbjct: 1   MSAPNAVITLSGNGITTPVVIGGGARIAFIAGPCQLESRQHALEMAHALKEIGQRLNVGI 60

Query: 79  VYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDIL 138
           +YK+SFDKANR+S    RG+GL++   IF ++++  G P+LTDVH+E+Q    A +VD+L
Sbjct: 61  IYKTSFDKANRTSANAARGLGLEQSLPIFDEIRQVTGLPVLTDVHSEEQARVAAQAVDVL 120

Query: 139 QIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSF 198
           QIPA L RQTDLL AAA TG+ IN+KKGQFL+PW+M N++ K+   G  +V+ CERG SF
Sbjct: 121 QIPAFLSRQTDLLLAAAATGKAINIKKGQFLAPWDMKNVIAKVVGAGNPNVMACERGASF 180

Query: 199 GYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIA 258
           GYNTLV+DMR++P++  +G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+ 
Sbjct: 181 GYNTLVSDMRALPVLREIGCPVVFDATHSVQQPGGQGTSSGGQREFVPVLARAAVAVGVD 240

Query: 259 GIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +F+ETHQDPD+APSDGPNM+ +     L ++LLA D + K
Sbjct: 241 AVFMETHQDPDHAPSDGPNMVPLDQFEALAAELLAYDDLSK 281


>gi|188996182|ref|YP_001930433.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931249|gb|ACD65879.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 260

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 135/255 (52%), Positives = 180/255 (70%), Gaps = 2/255 (0%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQS-LNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           F +IAGPC IES +  F +A+ L ++ +   N+  V+KSSFDKANRSS+   RG GL+ G
Sbjct: 2   FTIIAGPCVIESKEICFEVAQVLKSLQEKHKNVRFVFKSSFDKANRSSVDSFRGKGLEYG 61

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
             + +D+K  +  P+LTD+H   Q + +A+ VDILQIPA LCRQTDLL AA +TGR INV
Sbjct: 62  LAVLKDVKDTFNLPVLTDIHESYQAKPVAEVVDILQIPAFLCRQTDLLLAAVETGREINV 121

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQFL+PW+  NI++KL   GA  +   ERGT+FGYN LV D RS+PIM     PVI+D
Sbjct: 122 KKGQFLAPWDTKNIVEKLKFGGATKIYLTERGTTFGYNNLVVDFRSLPIMRQYA-PVIYD 180

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ PG  G  SGG+R++  PLAKAA+++G+ G+F ETH DPD A SDGPN + +K+
Sbjct: 181 ATHSVQLPGGLGKASGGQREFAYPLAKAAISVGVDGLFFETHPDPDKALSDGPNQLPLKE 240

Query: 284 LPKLLSQLLAIDKII 298
            P ++  LL + + I
Sbjct: 241 FPNIVENLLKLREFI 255


>gi|311031991|ref|ZP_07710081.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bacillus sp. m3-13]
          Length = 275

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 189/264 (71%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
           ++TF     FVLIAGPC IES +     AE+L  I   LNI  ++K+S+DKANRSS+   
Sbjct: 10  EITFGGTNPFVLIAGPCVIESEEVIMETAERLKEITTKLNIPFIFKASYDKANRSSIHSY 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL+ G EI + +K+K+  P+ +D+H   Q E  A+ +DILQIPA LCRQTDLL AAA
Sbjct: 70  RGPGLEDGLEILKKVKEKFNVPVTSDIHDPSQAEKAAEVLDILQIPAFLCRQTDLLVAAA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+++NVKKGQFL+PW+M N++ KL     +++L  ERG++FGYN LV DMRS+  M  
Sbjct: 130 KTGKIVNVKKGQFLAPWDMKNVVTKLKESNNENILLTERGSTFGYNNLVVDMRSLVTMRE 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           +G PV+FDA+HSVQ PG +G  +GG+R+++  L++AA A+G+  IF+E H +P+ A SDG
Sbjct: 190 LGAPVVFDATHSVQIPGGNGTTTGGKREFVPYLSRAAAAVGVDAIFMEVHPNPNEAKSDG 249

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ + +L ++L  ++ ID+ IK
Sbjct: 250 PNMVKLDELEEVLKPIIEIDRAIK 273


>gi|206889727|ref|YP_002249520.1| 3-deoxy-8-phosphooctulonate synthase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741665|gb|ACI20722.1| 3-deoxy-8-phosphooctulonate synthase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 271

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 181/255 (70%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LIAGPC IES +  F  A  L  I Q+L I  ++KSS+DKANRSS+   RG G+KKG EI
Sbjct: 17  LIAGPCVIESEEIVFKTAFALKEISQNLKIPFIFKSSYDKANRSSINSYRGPGIKKGLEI 76

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
              +KK++  P+L+DVH+ ++ +   D +DI+QIPA LCRQTD++   A+TG+ +NVKKG
Sbjct: 77  LNKVKKEFEVPVLSDVHSVEEVQIAKDFLDIIQIPAFLCRQTDIIVEVAKTGKPVNVKKG 136

Query: 167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASH 226
           QFL+PW++ NI++K+ + G + ++  ERGTSFGYN LV D RS PI+ SMGV V+FDA+H
Sbjct: 137 QFLAPWDVKNIIEKIKSTGNEKIIITERGTSFGYNNLVVDFRSFPIIRSMGVFVVFDATH 196

Query: 227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPK 286
           SVQ PG  G CS G+R++I  L++AAVA G+ G+F E H +P+ A  DGPNMI +KD   
Sbjct: 197 SVQLPGGAGTCSSGQREFIPYLSRAAVACGVDGLFFEVHPEPEKALCDGPNMIPLKDFKN 256

Query: 287 LLSQLLAIDKIIKPL 301
           L+  LL I   +K L
Sbjct: 257 LILTLLEIHNTVKKL 271


>gi|254717643|ref|ZP_05179454.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ceti M13/05/1]
 gi|261219482|ref|ZP_05933763.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ceti M13/05/1]
 gi|260924571|gb|EEX91139.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Brucella ceti M13/05/1]
          Length = 220

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 162/208 (77%), Gaps = 4/208 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M+  N+ + +G+    VTFSN     LIAGPCQ+E+ DHAF +A +L  +   L IGLVY
Sbjct: 1   MVTANSTVKVGN----VTFSNSAPLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANR+SL   RG+GL+K  E+F DLKK+YGFP+LTD+HTE+QC A+A  VD+LQI
Sbjct: 57  KSSFDKANRTSLKAARGIGLEKALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGY
Sbjct: 117 PAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLAKITESGNPNVLATERGVSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSV 228
           NTLV+DMR++PIM  +G PVIFDA+HSV
Sbjct: 177 NTLVSDMRALPIMAGLGAPVIFDATHSV 204


>gi|193084253|gb|ACF09915.1| 2-dehydro-3-deoxyphosphooctonate aldolase [uncultured marine group
           III euryarchaeote KM3-28-E8]
          Length = 249

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 189/246 (76%)

Query: 54  IESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKK 113
           +ES  HA  +AE L A    L  GL+YKSSFDKANR+S+  +RG+GL K  E+F +++  
Sbjct: 1   MESRSHALEMAEALKAEADELGFGLIYKSSFDKANRTSVGSERGIGLDKAMEVFAEVRDT 60

Query: 114 YGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWE 173
            G P+LTDVH   QC  +A+SVD+LQIPA LCRQTDLL AAA+TGR +N+KKGQFL+PW+
Sbjct: 61  IGCPVLTDVHEPHQCAVVAESVDVLQIPAYLCRQTDLLVAAAETGRAMNIKKGQFLAPWD 120

Query: 174 MHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGI 233
           M N++ K    G ++++ CERG SFGYNTLV+DMRS+P + + G PV+FDA+HSVQQPG 
Sbjct: 121 MKNVVAKCVQAGNENLMVCERGASFGYNTLVSDMRSLPELAATGFPVVFDATHSVQQPGG 180

Query: 234 HGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLA 293
            G  SGG+R+Y+  LA+AAVA+G+A +FLETHQDPDNAPSDGPNM+++K+   L+  L+A
Sbjct: 181 RGGTSGGQREYVPVLARAAVAVGVAAVFLETHQDPDNAPSDGPNMVHLKEFGGLVETLMA 240

Query: 294 IDKIIK 299
            D++ K
Sbjct: 241 FDRLSK 246


>gi|118580038|ref|YP_901288.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pelobacter propionicus
           DSM 2379]
 gi|158512562|sp|A1APG0|KDSA_PELPD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|118502748|gb|ABK99230.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pelobacter propionicus
           DSM 2379]
          Length = 272

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 136/263 (51%), Positives = 188/263 (71%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V    ++   L+AGPC IES       AE+L  IC +L++ L++K+S+DKANR+S+   R
Sbjct: 10  VKIGAKRPLALVAGPCVIESELATMRQAERLMTICNALSLPLIFKASYDKANRTSIGAYR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G  I R +K+  G  +L+DVH+ +Q    A+ +D+LQIPA LCRQTDLL AAA 
Sbjct: 70  GPGMREGLRILRKVKESLGLAVLSDVHSIEQVAPAAEVLDVLQIPAFLCRQTDLLIAAAA 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGRVINVKKGQFL+PW+M N+  K+ + G ++++  ERG SFGYN LV DMRS P+M + 
Sbjct: 130 TGRVINVKKGQFLAPWDMKNVAAKIASSGNENIILTERGASFGYNNLVVDMRSFPVMRAS 189

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVIFDA+HSVQ PG  G  SGG+R+++  L++AAVA G+ GIF+E H++P+ A  DGP
Sbjct: 190 GYPVIFDATHSVQLPGGQGESSGGQREFVEFLSRAAVAAGVDGIFMEVHEEPEKALCDGP 249

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           N I + DLP LL+ L AID ++K
Sbjct: 250 NSIALNDLPALLATLKAIDAVVK 272


>gi|323136672|ref|ZP_08071753.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylocystis sp. ATCC
           49242]
 gi|322397989|gb|EFY00510.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylocystis sp. ATCC
           49242]
          Length = 278

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 188/272 (69%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           + +G G  +V    ++   LIAGPC +ES + A  +A +L  +   L IG+V+K+SFDKA
Sbjct: 4   VPIGEGARRVEIGADRPLTLIAGPCALESREMALQVARELARLSDRLGIGVVFKASFDKA 63

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NR+S    RGVGL     IF ++K   G P+ TDVH   QC  +A+ VD+LQIPA LCRQ
Sbjct: 64  NRTSGDAPRGVGLSAALPIFAEIKAATGLPVTTDVHESGQCAPVAEVVDLLQIPAFLCRQ 123

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ AAA+TGR +N+KKGQFL+PW+M + ++K  A G   VL  ERG SFGYNTLV DM
Sbjct: 124 TDLIVAAARTGRPVNIKKGQFLAPWDMIHAVEKARAAGGGGVLVTERGASFGYNTLVADM 183

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
           R++PI+   G PVIFDA+HSVQQPG  G  SGGER+++  LA+AAVA+G+AG+F+ETH D
Sbjct: 184 RALPILRETGAPVIFDATHSVQQPGGRGASSGGERRFVATLARAAVAVGVAGLFVETHPD 243

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PD A SD    + + +L  ++ QL+  D++ K
Sbjct: 244 PDAATSDPATQVPLGELGAMMEQLMGFDRLAK 275


>gi|222055367|ref|YP_002537729.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sp. FRC-32]
 gi|254807747|sp|B9M9Q6|KDSA_GEOSF RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|221564656|gb|ACM20628.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sp. FRC-32]
          Length = 272

 Score =  285 bits (729), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 188/264 (71%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +    ++  VL+AGPC IE+       AE+L  IC  +++ L++K+S+DKANR+S+   
Sbjct: 9   NIKIGGDRPLVLVAGPCVIENEAATLRCAERLMTICNGVSMPLIFKASYDKANRTSVNSF 68

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GLK G +I + +K+  G P+L+D+H+ +Q E  A+ +D++QIPA LCRQTDL+ AAA
Sbjct: 69  RGPGLKDGLKILKKVKESLGVPVLSDIHSIEQVEPAAEVLDVIQIPAFLCRQTDLVVAAA 128

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
            +GRVIN+KKGQFL+PW+M N++ K  + G  +V+  ERG SFGYN LV+DMRS PI+  
Sbjct: 129 MSGRVINIKKGQFLAPWDMENVVGKAVSTGNDNVILTERGVSFGYNNLVSDMRSFPILRQ 188

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFDA+HSVQ PG  G  SGG+R+++  L +AAVA GI GIF+E H+DP+ A  DG
Sbjct: 189 TGYPVIFDATHSVQLPGGLGGSSGGQREFVEYLGRAAVATGIDGIFMEVHEDPEKALCDG 248

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + + DLP LL +L AID I+K
Sbjct: 249 PNSVKLDDLPALLKKLKAIDAIVK 272


>gi|260886286|ref|ZP_05897549.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas sputigena ATCC
           35185]
 gi|260864005|gb|EEX78505.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas sputigena ATCC
           35185]
          Length = 296

 Score =  285 bits (729), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 135/262 (51%), Positives = 178/262 (67%)

Query: 38  TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRG 97
           T       VL+AGPC +E  +   +I   +  I   L I  ++K+SFDKANRSS    RG
Sbjct: 31  TIGGGSPLVLMAGPCVLEEMERCLLIGRTIKEITARLGIPYIFKASFDKANRSSFNSFRG 90

Query: 98  VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQT 157
            GLKKG E+ + +K++   P++TDVH E Q    A  VD+LQIPA LCRQTDL+ AAA++
Sbjct: 91  PGLKKGLEMLQAIKEELDVPVVTDVHKESQIAPAAKVVDVLQIPAFLCRQTDLIYAAAKS 150

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           G V+NVKKGQFL+P +M N++ KLH  G  D+L  ERG SFGYN LV DMRS PIM + G
Sbjct: 151 GCVVNVKKGQFLAPRDMGNVVDKLHEGGCSDILLTERGASFGYNNLVVDMRSFPIMRTFG 210

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
            PVIFDA+HSVQ PG  G  SGG R+++ PLA+AAVA G+ G+F+E H +P+ A  DGPN
Sbjct: 211 APVIFDATHSVQLPGGAGTSSGGNREFVEPLARAAVAAGVDGLFMEVHDNPEEALCDGPN 270

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
            + +  L +LL ++LAI  ++K
Sbjct: 271 SLYLDKLEELLKEVLAIYNVVK 292


>gi|309388532|gb|ADO76412.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halanaerobium praevalens
           DSM 2228]
          Length = 281

 Score =  285 bits (728), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 186/265 (70%), Gaps = 1/265 (0%)

Query: 36  QVTFSNEQR-FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           +V F ++++ FVL+AGPC IE  D    IAE +  I   L I  V+K+SFDKANRSS+  
Sbjct: 10  EVIFGDQEKPFVLLAGPCAIEEEDRVLRIAEGIKEITSKLGIPYVFKASFDKANRSSIES 69

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG EI   +KK++  P+++D+H  +Q  A AD +DI+QIPA L RQTD+LTAA
Sbjct: 70  YRGPGLEKGLEILAKVKKEFDLPVISDIHLPEQAAAAADVLDIMQIPAFLSRQTDMLTAA 129

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG +INVKKGQFL+PW++  ++ K+ + G + ++  ERG SFGYN LV DMRS+P M 
Sbjct: 130 GKTGSIINVKKGQFLAPWDIDQVVAKIESTGNEKIILTERGVSFGYNNLVVDMRSLPRMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+H+VQ PG  G+ S GE++Y+  L +AA+A GI  +F+E H +P  A SD
Sbjct: 190 KTGYPVVFDATHAVQLPGGAGDSSDGEKEYVPYLMRAALAAGIDSLFMEVHDNPAVAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           G NMI + +L ++L Q LAID+ +K
Sbjct: 250 GANMIPLVNLEEILKQGLAIDQAVK 274


>gi|330839731|ref|YP_004414311.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Selenomonas sputigena
           ATCC 35185]
 gi|329747495|gb|AEC00852.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Selenomonas sputigena
           ATCC 35185]
          Length = 276

 Score =  285 bits (728), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 135/262 (51%), Positives = 178/262 (67%)

Query: 38  TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRG 97
           T       VL+AGPC +E  +   +I   +  I   L I  ++K+SFDKANRSS    RG
Sbjct: 11  TIGGGSPLVLMAGPCVLEEMERCLLIGRTIKEITARLGIPYIFKASFDKANRSSFNSFRG 70

Query: 98  VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQT 157
            GLKKG E+ + +K++   P++TDVH E Q    A  VD+LQIPA LCRQTDL+ AAA++
Sbjct: 71  PGLKKGLEMLQAIKEELDVPVVTDVHKESQIAPAAKVVDVLQIPAFLCRQTDLIYAAAKS 130

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           G V+NVKKGQFL+P +M N++ KLH  G  D+L  ERG SFGYN LV DMRS PIM + G
Sbjct: 131 GCVVNVKKGQFLAPRDMGNVVDKLHEGGCSDILLTERGASFGYNNLVVDMRSFPIMRTFG 190

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
            PVIFDA+HSVQ PG  G  SGG R+++ PLA+AAVA G+ G+F+E H +P+ A  DGPN
Sbjct: 191 APVIFDATHSVQLPGGAGTSSGGNREFVEPLARAAVAAGVDGLFMEVHDNPEEALCDGPN 250

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
            + +  L +LL ++LAI  ++K
Sbjct: 251 SLYLDKLEELLKEVLAIYNVVK 272


>gi|163782044|ref|ZP_02177043.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159882576|gb|EDP76081.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 266

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 132/256 (51%), Positives = 183/256 (71%), Gaps = 2/256 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGLK 101
           + F +IAGPC IES      +A+KL  + +  + +  V+KSSFDKANRSS+   RG GL+
Sbjct: 2   KNFTIIAGPCVIESEAVVLPVAQKLKELSEKYDEVDFVFKSSFDKANRSSINSFRGHGLE 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G ++ R +K+++G  + TD+H   Q E + + VDI+QIPA LCRQTDLL AAA+TG+ +
Sbjct: 62  FGLKVLRSVKEEFGLKVTTDIHESWQAEPVGEVVDIVQIPAFLCRQTDLLIAAAKTGKAV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  NI++KL   GAK++   ERG SFGYN LV D RS+PIM++    VI
Sbjct: 122 NVKKGQFLAPWDTKNIVEKLKVGGAKEIFLTERGVSFGYNNLVVDFRSLPIMSNFA-KVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG  GN SGG+R+++ PL +AAVA+G  G+F+ETH +PD A SDGPN + +
Sbjct: 181 FDATHSVQLPGGMGNRSGGQREFVFPLIRAAVAVGCDGVFMETHPNPDEALSDGPNQVPL 240

Query: 282 KDLPKLLSQLLAIDKI 297
           KDL  ++  +L I ++
Sbjct: 241 KDLEFIVEAMLEIREV 256


>gi|78222491|ref|YP_384238.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter
           metallireducens GS-15]
 gi|123756462|sp|Q39W61|KDSA_GEOMG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|78193746|gb|ABB31513.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter
           metallireducens GS-15]
          Length = 272

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 187/264 (70%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            V     +  VLIAGPC IE+       AE+L  I   L+I L++K+S+DKANR+S+   
Sbjct: 9   NVKMGGSRPLVLIAGPCVIENETATLRCAERLMTIVNGLSIPLIFKASYDKANRTSVTAF 68

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GLK+G  I   +K+  G P+++D+H+ +Q +  A+ +DILQIPA LCRQTDLL  AA
Sbjct: 69  RGPGLKEGLRILAKVKESLGLPVISDIHSIEQVQPAAEVLDILQIPAFLCRQTDLLVEAA 128

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG V+NVKKGQFL+PW+M N++ K+ A G + ++  ERG SFGYN LV+DMRS+PIM  
Sbjct: 129 RTGCVVNVKKGQFLAPWDMENVVGKIVASGNERIILTERGASFGYNNLVSDMRSLPIMRR 188

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA GI G+FLE H++PD A  DG
Sbjct: 189 FGFPVVFDATHSVQLPGGQGGSSGGQREFVEYLSRAAVATGIDGVFLEVHEEPDKALCDG 248

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + + DLP LL +L AID I+K
Sbjct: 249 PNSVPLDDLPVLLKKLKAIDAIVK 272


>gi|227824362|ref|ZP_03989194.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidaminococcus sp. D21]
 gi|226904861|gb|EEH90779.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidaminococcus sp. D21]
          Length = 273

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 134/253 (52%), Positives = 179/253 (70%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
            +++AGPC +E ++ + MI  +  AIC+ + +  V+K+SFDKANRSSL   RG GL++G 
Sbjct: 17  LLVMAGPCVLEGYERSLMIGRRAKAICEKVGLPYVFKASFDKANRSSLTAFRGPGLEEGL 76

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           EI + +KK  G P+++DVH   Q E  A+ +DI+QIPA LCRQTDLL AAA TGRV+NVK
Sbjct: 77  EILKQIKKDLGVPVVSDVHETYQVEKAAEVLDIIQIPAFLCRQTDLLVAAAHTGRVVNVK 136

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+PW+M N++ KL   G + ++  ERG SFGYNTLVTDMRS+PIM   G PVI D 
Sbjct: 137 KGQFLAPWDMKNVINKLVGSGTEKIMLTERGASFGYNTLVTDMRSLPIMRDFGYPVIMDV 196

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G  SGG+ QY   +A+AA A+G+ G+F+E H +P  A SDGPNMI +  +
Sbjct: 197 THSVQIPGGKGTSSGGQSQYAPHMARAAAAVGVDGLFMEVHDNPAEALSDGPNMIALDKM 256

Query: 285 PKLLSQLLAIDKI 297
            ++L    AID I
Sbjct: 257 EQVLLDAKAIDAI 269


>gi|255658895|ref|ZP_05404304.1| 3-deoxy-8-phosphooctulonate synthase [Mitsuokella multacida DSM
           20544]
 gi|260848844|gb|EEX68851.1| 3-deoxy-8-phosphooctulonate synthase [Mitsuokella multacida DSM
           20544]
          Length = 274

 Score =  283 bits (723), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 136/254 (53%), Positives = 173/254 (68%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             L+AGPC +E  D   +I   +  IC  L I  V+K+SFDKANRSS    RG GLKKG 
Sbjct: 17  LTLLAGPCVLEGMDRCLLIGRTIKEICGRLGINYVFKASFDKANRSSYHSFRGPGLKKGL 76

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           E+ +++K+    PI+TD+H   Q E +A   DILQIPA LCRQTDLL AAAQTGRV+NVK
Sbjct: 77  EMLQEIKETLDVPIVTDIHETTQAEPVAKVADILQIPAFLCRQTDLLHAAAQTGRVVNVK 136

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+P +M N++ KLH  G + +L  ERG SFGY+ LV DMRS+PIM S+G PV+FD 
Sbjct: 137 KGQFLAPEDMRNVVDKLHECGCEQMLLTERGASFGYHNLVVDMRSLPIMRSLGYPVVFDG 196

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG +G  S G R+Y+  L +AA   GI  +FLE H +P+ A SDG NM+ +  L
Sbjct: 197 THSVQLPGGNGTTSSGNREYVEYLVRAAAGAGIDALFLEVHDNPEEALSDGANMVYLDKL 256

Query: 285 PKLLSQLLAIDKII 298
             LL+  LAI KI+
Sbjct: 257 EGLLTDALAIHKIV 270


>gi|189425231|ref|YP_001952408.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter lovleyi SZ]
 gi|238692113|sp|B3E467|KDSA_GEOLS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|189421490|gb|ACD95888.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter lovleyi SZ]
          Length = 272

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 186/264 (70%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            V     +  VLIAGPC IES +     AE+L  IC  L + L++KSS+DKANR+S+   
Sbjct: 9   SVKMGGGRLLVLIAGPCVIESEEATLRHAERLMTICNGLGMPLIFKSSYDKANRTSINAF 68

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+ +G  I   +K+  G P+L+D+H+ +Q    A  +D+LQIPA LCRQTDL+ AAA
Sbjct: 69  RGPGMDEGLRILSKVKESLGIPVLSDIHSIEQVAPAAQVLDVLQIPAFLCRQTDLVVAAA 128

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+V+NVKKGQFL+PW+M N++ K+ A G ++++  ERG SFGYN LV DMRS P+M S
Sbjct: 129 KTGKVVNVKKGQFLAPWDMRNVVGKVAASGNENIILTERGASFGYNNLVVDMRSFPVMRS 188

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA GI GIF+E H+DP  A  DG
Sbjct: 189 YGYPVVFDATHSVQLPGGQGESSGGQREFVETLSRAAVATGIDGIFMEVHEDPSCALCDG 248

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN I + +LP LL +L A+D +++
Sbjct: 249 PNSIPLAELPALLKRLQALDAVVR 272


>gi|206601616|gb|EDZ38099.1| 2-Dehydro-3-deoxyphosphooctonate aldolase [Leptospirillum sp. Group
           II '5-way CG']
          Length = 289

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 127/266 (47%), Positives = 186/266 (69%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           + L   +  +    E R   I GPC IES   A  +A +L AI + L + +++KSS+DKA
Sbjct: 4   LSLDGPRGPLVLGEEDRPFFILGPCVIESRSLAREVAAELDAIRERLGVSILFKSSYDKA 63

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NR+S    RG+G+ +G +I  +++ ++G P+++DVH   Q    A  +D+LQIPA LCRQ
Sbjct: 64  NRTSAKSFRGIGMNEGLDILAEVRSEWGLPVVSDVHDADQVSEAASVLDVLQIPAFLCRQ 123

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDLL AA ++G+ ++VKKGQFL+P +M ++++K+ + G   +L CERG SFGY+TLV D 
Sbjct: 124 TDLLLAAGESGKTVHVKKGQFLAPEDMRHVVEKIASTGNHRILVCERGVSFGYHTLVVDF 183

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
           RS+P+++S+G PV+FDA+HSVQ PG  GN SGG+R+++ PLA+AA  +G  GIF+E H D
Sbjct: 184 RSLPVLSSLGYPVVFDATHSVQSPGGAGNRSGGDRRFVWPLARAAAIVGCQGIFMEVHPD 243

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLA 293
           PD APSDGPNM+ +  L  LL ++LA
Sbjct: 244 PDKAPSDGPNMVPLGKLESLLKEILA 269


>gi|148265017|ref|YP_001231723.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter uraniireducens
           Rf4]
 gi|189028410|sp|A5G5T2|KDSA_GEOUR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|146398517|gb|ABQ27150.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter uraniireducens
           Rf4]
          Length = 272

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 189/264 (71%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            V    ++  VLIAGPC IE+       AE+L  IC  ++I L++K+S+DKANR+S+   
Sbjct: 9   NVKIGGDRPLVLIAGPCVIENEVATMRCAERLMTICNGVSIPLIFKASYDKANRTSVNSF 68

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+K G +I + +K+  G P+L+D+H+ +Q E  A+ +D++QIPA LCRQTDL+ AAA
Sbjct: 69  RGPGMKDGLKILKKVKEALGVPVLSDIHSIEQVEPAAEVLDVVQIPAFLCRQTDLVVAAA 128

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           ++G+V+N+KKGQFL+PW+M N+  K  + G  +++  ERG SFGYN LV+DMRS PI+  
Sbjct: 129 RSGKVVNIKKGQFLAPWDMENVAGKAVSTGNDNIILTERGVSFGYNNLVSDMRSFPILRK 188

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           +G PV+FDA+HSVQ PG  G  SGG+R+++  L +AAVA GI GIF+E H DP+ A  DG
Sbjct: 189 IGYPVVFDATHSVQLPGGLGGSSGGQREFVEYLGRAAVATGIDGIFMEVHDDPEKALCDG 248

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + ++DLP LL +L AID I+K
Sbjct: 249 PNSVKLEDLPALLKKLKAIDAIVK 272


>gi|303230207|ref|ZP_07316975.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella atypica
           ACS-134-V-Col7a]
 gi|303230952|ref|ZP_07317695.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514334|gb|EFL56333.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302515133|gb|EFL57107.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 272

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 181/264 (68%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T    +   ++AGPC IE +D    I ++  AIC+ L I  V+K+SFDKANRSS    
Sbjct: 8   NMTIGGGKGLFVLAGPCVIEDYDRTLAIGKEAKAICERLGIPYVFKASFDKANRSSFNSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G +I   +KK+   P+++D+H+ +Q E  A+ +DILQIPA LCRQTDL+  AA
Sbjct: 68  RGPGLEEGLKILASIKKELNVPVVSDIHSIEQIEPAAEVLDILQIPAFLCRQTDLVYGAA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S
Sbjct: 128 KTGKCVNVKKGQFMAPKDMENVLNKMKESGNENLMLTERGFSFGYNNLVVDMRSFPIMRS 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PVIFDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDG
Sbjct: 188 FDYPVIFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +     LL  L+AIDKI+K
Sbjct: 248 PNMVYLNQFEDLLKDLVAIDKIVK 271


>gi|146329714|ref|YP_001209280.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dichelobacter nodosus
           VCS1703A]
 gi|254807740|sp|A5EW23|KDSA_DICNV RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|146233184|gb|ABQ14162.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dichelobacter nodosus
           VCS1703A]
          Length = 277

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 132/259 (50%), Positives = 177/259 (68%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N++ F LIAGPC IES   A   AE L  I   L I  +YKSSFDKANRSS A  RG+GL
Sbjct: 10  NDRPFFLIAGPCVIESEYLALHTAEVLKTITDELKIPFIYKSSFDKANRSSGASFRGLGL 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            +G  I   +K+ +  PILTDVH     + +A  VD+LQ PA LCRQTD +T     G+ 
Sbjct: 70  AEGLRILAKVKETFAVPILTDVHEYTPLDEVASVVDVLQTPAFLCRQTDFITRVCAQGKP 129

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M +++ K  A G + ++ CERG SFGYN LV DMRS+ +M +   PV
Sbjct: 130 VNIKKGQFLAPWDMKHVVAKAKATGNEQIMLCERGASFGYNNLVADMRSLAVMKTFSAPV 189

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG +G  SGG+R+++  LA+AA+A+G+AGIF+ETH +P+ A SDG N I 
Sbjct: 190 VFDATHSVQLPGGNGASSGGQREFVPVLARAAIAVGVAGIFMETHPEPEKALSDGANSIP 249

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  +  LL QL A+D ++K
Sbjct: 250 LAQMRHLLQQLRALDTLVK 268


>gi|323140928|ref|ZP_08075841.1| 3-deoxy-8-phosphooctulonate synthase [Phascolarctobacterium sp. YIT
           12067]
 gi|322414666|gb|EFY05472.1| 3-deoxy-8-phosphooctulonate synthase [Phascolarctobacterium sp. YIT
           12067]
          Length = 272

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 135/255 (52%), Positives = 186/255 (72%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
            +L+AGPC +E ++ + MI ++  AIC  L I  V+K+SFDKANRSS A  RG G+++G 
Sbjct: 17  LMLMAGPCVLEGYERSLMIGQRTKAICDKLGIPYVFKASFDKANRSSYASFRGPGIEEGL 76

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           ++   +KK  G P++TD+H   Q E  A+ VDILQIPA LCRQTDL+ AAA+TG+ +NVK
Sbjct: 77  KLLAQIKKDLGVPVVTDIHEPWQAEKAAEVVDILQIPAFLCRQTDLVYAAAKTGKTVNVK 136

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+PW+M N+++K+   G  +++  ERG SFGYNTLVTDMR + IM  +G PV+ DA
Sbjct: 137 KGQFLAPWDMKNVIKKVEEAGNHNIMLTERGASFGYNTLVTDMRGLAIMRELGYPVVMDA 196

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G  SGG+ QY+  +A+AA A+GI  +FLE H +P  A SDGPNM+ + +L
Sbjct: 197 THSVQIPGGQGTSSGGQSQYVPHMARAAAAVGIDALFLEVHDNPAEALSDGPNMVKLDNL 256

Query: 285 PKLLSQLLAIDKIIK 299
            KLL+ +LAIDKI++
Sbjct: 257 EKLLTDVLAIDKIVR 271


>gi|260655090|ref|ZP_05860578.1| 3-deoxy-8-phosphooctulonate synthase [Jonquetella anthropi E3_33
           E1]
 gi|260630201|gb|EEX48395.1| 3-deoxy-8-phosphooctulonate synthase [Jonquetella anthropi E3_33
           E1]
          Length = 283

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 128/255 (50%), Positives = 179/255 (70%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             +IAGPC +ES +    +   L  IC  L +  ++K+SFDKANR+S+  KRG G+ +G 
Sbjct: 16  LAVIAGPCALESLELGLQVGGALKEICSRLGLNYIFKASFDKANRTSIHSKRGPGIDQGL 75

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           E    +K +   P+LTD+H   Q E +A  VD+LQIPA LCRQTDLL AAA+TGR +NVK
Sbjct: 76  EWLGTIKGELDVPVLTDIHESWQAEPVAQVVDVLQIPAFLCRQTDLLVAAAKTGRPVNVK 135

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           K QFL+P +M +++ KLH  G  +V+ CERGTS GY+ LV DMRS+PIM S+G PV+FDA
Sbjct: 136 KAQFLAPGDMKSVITKLHEAGNDNVMVCERGTSMGYHQLVVDMRSLPIMRSLGRPVVFDA 195

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +H VQ P   G+ SGG+R++ +PLA+AAVAIG+ G+F+E H  P+ A SDGPNM+ +   
Sbjct: 196 THCVQMPSGQGDSSGGDRRFTLPLARAAVAIGVDGLFMEVHPKPEEAFSDGPNMVPLSMA 255

Query: 285 PKLLSQLLAIDKIIK 299
            + L+ + AID++++
Sbjct: 256 ERFLTDIAAIDRLVR 270


>gi|220932727|ref|YP_002509635.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halothermothrix orenii H
           168]
 gi|219994037|gb|ACL70640.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halothermothrix orenii H
           168]
          Length = 279

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 131/264 (49%), Positives = 180/264 (68%), Gaps = 1/264 (0%)

Query: 37  VTFSNEQR-FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
           + F +  R  VLIAGPC +E  D    IAE +  I   L I  V+KSS+DKANRSS+   
Sbjct: 14  IVFGDSNRPLVLIAGPCVLEEEDRVLKIAETVKEITSRLGIPYVFKSSYDKANRSSIKSF 73

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL+ G ++   +K++ G P+LTDVH   Q    A+ VDI+QIPA L RQTDL+ AA 
Sbjct: 74  RGPGLEDGLKLLERVKREVGVPLLTDVHEPDQAALAAEVVDIVQIPAFLSRQTDLVVAAG 133

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+++NVKKGQFL+PW++  +++K+ + G + +L  ERG SFGYN LV DMRS+P M  
Sbjct: 134 RTGKIVNVKKGQFLAPWDIDRVVEKIESTGNEKILLTERGVSFGYNNLVVDMRSLPRMRE 193

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  L +AAV  G+  +F+E H +PD A SDG
Sbjct: 194 TGYPVVFDATHSVQLPGGAGETSGGDRKFVPYLTRAAVGTGVDALFMEVHDNPDVALSDG 253

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +  L  +L + LAID+I+K
Sbjct: 254 PNMVPLDQLEGILIKALAIDEIVK 277


>gi|159043136|ref|YP_001531930.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dinoroseobacter shibae
           DFL 12]
 gi|157910896|gb|ABV92329.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dinoroseobacter shibae
           DFL 12]
          Length = 277

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 132/265 (49%), Positives = 179/265 (67%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
            ++   N+Q   LIAGPCQ+ES +    I   L   C       ++K+S+DKANR+S  G
Sbjct: 7   GELRVGNDQPLTLIAGPCQLESFEQGLEIGAALKEACDRSGAQFIFKASYDKANRTSAGG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G+  G +    L++  G P+LTDVH  + C   A++VDILQIPA LCRQTDLL AA
Sbjct: 67  VRGMGMAAGLDALGRLRETLGVPVLTDVHAAEHCAPAAEAVDILQIPAFLCRQTDLLIAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG V+NVKKGQFL+PW+M +++ K+ + G   ++  ERG SFGYNTLV DMRS+P M 
Sbjct: 127 GETGAVVNVKKGQFLAPWDMPHVIGKIESTGNTRIMLTERGASFGYNTLVADMRSLPTMM 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++GIA +F+ETH  PD APSD
Sbjct: 187 KTGYPVVMDATHSVQQPGGLGGASGGQREFAPVMARAAVSLGIAAVFIETHPAPDTAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNMI +  +  L+  L+A D + K
Sbjct: 247 GPNMIPLAQMQDLIGDLMAFDALAK 271


>gi|220934357|ref|YP_002513256.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|254807752|sp|B8GQ74|KDSA_THISH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|219995667|gb|ACL72269.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 280

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 129/258 (50%), Positives = 176/258 (68%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           E    LI+GPC IES   A   A +L  +C+ + +  +YKSSFDKANRSS    RG+GL+
Sbjct: 11  EHPIFLISGPCVIESEQLALDTAGQLKELCERVGVPFIYKSSFDKANRSSTRSFRGLGLE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I   +K++ G P+LTDVH +   E +A  VD+LQ PA LCRQT+ +   A+ GR +
Sbjct: 71  EGLRILETVKQQIGVPVLTDVHEDTPLEEVAAVVDVLQTPAFLCRQTNFIQNVARQGRPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M N++ K    G   ++ CERG SFGYNTLV+DMR + +M   G PV+
Sbjct: 131 NIKKGQFLAPWDMGNVVDKAREAGNDQIMVCERGVSFGYNTLVSDMRGLAVMRETGCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQQPG  G  SGG+R+++  LA+AAVA G+AG+F+ETH DPD A SDGPN   +
Sbjct: 191 FDATHSVQQPGGKGTSSGGQREFVPVLARAAVASGVAGLFMETHPDPDKALSDGPNAWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             + +LL  L  +D ++K
Sbjct: 251 PLMEELLVTLKTLDDVVK 268


>gi|258591071|emb|CBE67366.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase; KDO-8-phosphate synthetase, KDOPS) [NC10
           bacterium 'Dutch sediment']
          Length = 279

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 188/266 (70%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
            ++T       +L+AGPC IES DH   + E +  +C++  +  + K+S+DKANRSS   
Sbjct: 10  GKLTLGGGAPLLLVAGPCVIESEDHLLRVGEAIRTVCETCRVPFILKASYDKANRSSGRS 69

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  I   +K K   P+++DVH  QQ  A A  +DILQIPA LCRQTDLL AA
Sbjct: 70  FRGPGLEEGLRILERVKAKLDVPVISDVHDIQQISAAAQVLDILQIPAFLCRQTDLLVAA 129

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A++G+ +NVKKGQFLSPW+  NI++KL + G++ ++  ERG+SFGYN LV D+RS+PIM 
Sbjct: 130 ARSGKPVNVKKGQFLSPWDAGNIVEKLRSAGSEAIILTERGSSFGYNNLVVDIRSLPIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PV+FD +HSVQ PG  G+ SGG+ +++  +A+AAVA G+ G+F+E H DP NAPSD
Sbjct: 190 SFGYPVLFDVTHSVQLPGGAGDASGGQPEFVPYVARAAVAAGVDGLFMEVHPDPANAPSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP M+ +  LP LL+QL AI++++ P
Sbjct: 250 GPTMLRLDALPGLLNQLTAIERVVTP 275


>gi|163734116|ref|ZP_02141557.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter litoralis
           Och 149]
 gi|161392652|gb|EDQ16980.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter litoralis
           Och 149]
          Length = 277

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 142/263 (53%), Positives = 188/263 (71%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +   N++   +IAGPCQ+ES DHA MIA ++   C       V+K+SFDKANR+SLAG R
Sbjct: 9   LVIGNDRPLTVIAGPCQLESQDHAQMIAGRMKEACDKAGAQYVFKASFDKANRTSLAGVR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+ +G +I + + +  G P+LTDVH E QC   A +VDILQIPA LCRQTD+L AA +
Sbjct: 69  GPGIDEGLKILQSVGQAIGVPVLTDVHNEGQCAPAAQAVDILQIPAFLCRQTDMLLAAGE 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG  +NVKKGQFL+PWEM NI  K+ + G + +L  ERGTSFGYNTLV DMR++P M   
Sbjct: 129 TGAAVNVKKGQFLAPWEMSNITTKIESTGNRKILLTERGTSFGYNTLVADMRALPQMAQT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAVAIG+A +F+ETH++PD +PSDGP
Sbjct: 189 GYPVVMDATHSVQQPGGKGGSSGGQREFAPVMARAAVAIGVAAVFIETHENPDASPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +P L+  L+  D + K
Sbjct: 249 NMIYLDQMPDLIDTLMQFDALAK 271


>gi|264677265|ref|YP_003277171.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Comamonas testosteroni
           CNB-2]
 gi|262207777|gb|ACY31875.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Comamonas testosteroni
           CNB-2]
          Length = 317

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 137/264 (51%), Positives = 179/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++RF LIAGPC +ES      +A +L  I  SL I  ++KSSFDKANRSS    RG G++
Sbjct: 43  DKRFFLIAGPCVVESEQLQMDVAGQLKEITSSLGIHFIFKSSFDKANRSSGTSFRGPGME 102

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +KK+   PILTDVHTE +   +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 103 KGLEILAKVKKELNVPILTDVHTEAEVPYVASVVDMLQTPAFLCRQTDFIRAVAQSGKPV 162

Query: 162 NVKKGQFLSPWEMHNILQKLHAHG------AKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K  A        A     CERG SFGYN LV+DMRS+ IM  
Sbjct: 163 NIKKGQFLAPHDMKNVIDKARAAAVEAGLPADSFTACERGASFGYNNLVSDMRSLAIMRE 222

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG +G  SGG R+ +  L++AAVA+G+AG+F+ETH DP NA SDG
Sbjct: 223 TGAPVVFDATHSVQLPGGNGTSSGGMREMVPVLSRAAVAVGVAGLFMETHPDPCNALSDG 282

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +K +  LL  L+A+D + K
Sbjct: 283 PNAVPLKHMKALLETLVALDDVTK 306


>gi|91776262|ref|YP_546018.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacillus
           flagellatus KT]
 gi|123078804|sp|Q1H010|KDSA_METFK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|91710249|gb|ABE50177.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacillus
           flagellatus KT]
          Length = 279

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 134/260 (51%), Positives = 183/260 (70%), Gaps = 2/260 (0%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q   LIAGPC IES + A   A +L  I  +L I  +YKSS+DKANRSS    RG G+ 
Sbjct: 11  DQPLFLIAGPCVIESQEMAIETAGQLKEITTALGINFIYKSSYDKANRSSNKTFRGFGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G +I  +++++ G PILTDVHTE Q   +A  VD+LQ PA LCRQTD +TA AQ+G+ +
Sbjct: 71  EGLKILDEVRRQVGVPILTDVHTEAQVPHVAAVVDVLQTPAFLCRQTDFITACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
           N+KKGQFL+P +M  ++QK   A+G  D ++ CERG SFGYNTL++DMR + IM     P
Sbjct: 131 NIKKGQFLAPGDMKQVVQKAKEANGGADTIMVCERGASFGYNTLISDMRGLAIMRETNCP 190

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           V+FDA+HSVQQPG  G+ SGG+R+++  LA+AAVA G+AG+F+ETH DP  A SDGPN  
Sbjct: 191 VVFDATHSVQQPGGQGDKSGGQREFVPVLARAAVASGVAGVFMETHPDPAQALSDGPNAW 250

Query: 280 NIKDLPKLLSQLLAIDKIIK 299
            +  +  LL  L+ +D+++K
Sbjct: 251 PLSKMKALLEVLVDLDRVVK 270


>gi|325294610|ref|YP_004281124.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065058|gb|ADY73065.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 259

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 183/255 (71%), Gaps = 1/255 (0%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGL-VYKSSFDKANRSSLAGKRGVGLKKGR 104
           ++IAGPC IE  D  F +A+K+  +       + ++K+SFDKANRSS+   RG G++KG 
Sbjct: 2   LIIAGPCVIEDRDTVFEVAKKIRELKDKYPKHMWIFKASFDKANRSSIDSYRGPGIEKGL 61

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           E+  ++K+K+  PI TD+H   Q E +   VDI+QIPA LCRQTDL+ AAA+T +++NVK
Sbjct: 62  ELLSEVKEKFELPITTDIHEPWQAEIVGKVVDIVQIPAFLCRQTDLIVAAAKTEKIVNVK 121

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQF++PW+M N+++KL   GA ++L  ERGT+FGYN LV D RSIPIM   GV V+FDA
Sbjct: 122 KGQFMAPWDMANVVEKLRKSGASEILLTERGTTFGYNNLVVDFRSIPIMKKFGVKVLFDA 181

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ+PG  G  SGG+R+++  L++AA+AIG+ G+F E H +P+ A SDG NM+N++D 
Sbjct: 182 THSVQRPGGLGKVSGGDREFVPYLSRAAIAIGVDGLFFEIHPEPERALSDGANMLNLEDF 241

Query: 285 PKLLSQLLAIDKIIK 299
             L+ +L+ +   +K
Sbjct: 242 EVLIGKLIKLYSFMK 256


>gi|95928729|ref|ZP_01311475.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfuromonas
           acetoxidans DSM 684]
 gi|95135074|gb|EAT16727.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfuromonas
           acetoxidans DSM 684]
          Length = 274

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 180/263 (68%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V F ++  FVL++GPC +E  D    IAE L  +   L I  V+K+S+DKANR+S++  R
Sbjct: 10  VAFGDQHPFVLVSGPCVLEDLDMTLHIAESLKKLTDQLGIDFVFKASYDKANRTSVSSFR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+  G E+   +K ++  P+++DVH   Q  A +  +DI+QIPA LCRQTDLL AA  
Sbjct: 70  GPGIDAGLEMLAKVKSEFNVPVVSDVHDATQVAAASQVLDIIQIPAFLCRQTDLLVAAGN 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           +GRV+NVKKGQF +PW+M +++ K+ + G + +L  ERG SFGYN LV DMRS+ IM  +
Sbjct: 130 SGRVVNVKKGQFQAPWDMKHVVGKVASTGNEQILLTERGASFGYNNLVVDMRSLLIMREL 189

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVIFDA+H+VQ PG     S G+R+Y+  L++AAVAIGI G+F E H DP+ A  DGP
Sbjct: 190 GKPVIFDATHAVQLPGGADGASAGQREYVAALSRAAVAIGIDGLFWEVHPDPECARCDGP 249

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           N + +KDL  +L  LLA+D ++K
Sbjct: 250 NSLYLKDLQPILESLLAVDAVVK 272


>gi|221068543|ref|ZP_03544648.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Comamonas testosteroni
           KF-1]
 gi|299530810|ref|ZP_07044225.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Comamonas testosteroni
           S44]
 gi|220713566|gb|EED68934.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Comamonas testosteroni
           KF-1]
 gi|298721326|gb|EFI62268.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Comamonas testosteroni
           S44]
          Length = 285

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 137/264 (51%), Positives = 179/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++RF LIAGPC +ES      +A +L  I  SL I  ++KSSFDKANRSS    RG G++
Sbjct: 11  DKRFFLIAGPCVVESEQLQMDVAGQLKEITSSLGIHFIFKSSFDKANRSSGTSFRGPGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +KK+   PILTDVHTE +   +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  KGLEILAKVKKELNVPILTDVHTEAEVPYVASVVDMLQTPAFLCRQTDFIRAVAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHG------AKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K  A        A     CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARAAAVEAGLPADSFTACERGASFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG +G  SGG R+ +  L++AAVA+G+AG+F+ETH DP NA SDG
Sbjct: 191 TGAPVVFDATHSVQLPGGNGTSSGGMREMVPVLSRAAVAVGVAGLFMETHPDPCNALSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +K +  LL  L+A+D + K
Sbjct: 251 PNAVPLKHMKALLETLVALDDVTK 274


>gi|74316638|ref|YP_314378.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thiobacillus
           denitrificans ATCC 25259]
 gi|123759171|sp|Q3SL44|KDSA_THIDA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|74056133|gb|AAZ96573.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thiobacillus
           denitrificans ATCC 25259]
          Length = 280

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 133/258 (51%), Positives = 174/258 (67%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q   LI+GPC IES   A   A +L  +C  L I  +YKSSFDKANRSS    RG+GL+
Sbjct: 11  DQPLFLISGPCVIESEQLAMDTAGQLKEMCAGLGIPFIYKSSFDKANRSSTKSFRGLGLE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  D+K K G P+LTDVH +   + +A  VD+LQ PA LCRQT+ +   A+ GR +
Sbjct: 71  EGLRILADVKAKIGVPVLTDVHEDTPLDEVAAVVDVLQTPAFLCRQTNFIQNVARAGRPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M N++ K    G   ++ CERG SFGYNTLV+DMR + IM   G PV+
Sbjct: 131 NIKKGQFLAPWDMQNVVDKAREVGNDQIMVCERGVSFGYNTLVSDMRGLAIMRGTGCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQQPG  G  SGG+R+++  LA+AAVA G+AG+F ETH DP  A SDGPN   +
Sbjct: 191 FDATHSVQQPGGQGATSGGQREFVPVLARAAVASGVAGVFAETHPDPACALSDGPNAWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             + +LL  L  ID ++K
Sbjct: 251 GMMRELLETLKEIDALVK 268


>gi|54294127|ref|YP_126542.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella pneumophila
           str. Lens]
 gi|59798136|sp|Q5WXA7|KDSA_LEGPL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|53753959|emb|CAH15430.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) [Legionella pneumophila str. Lens]
          Length = 274

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 176/258 (68%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++   LIAGPC IES + A   A  L  +C  LNI  +YKSSFDKANRSS++  RG G +
Sbjct: 11  DKPLFLIAGPCVIESEELALETAGYLKEMCSQLNIPFIYKSSFDKANRSSISSYRGPGFE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG  I   +K + G P+LTDVH +     ++  VD+LQ PA LCRQT+ +   A   + +
Sbjct: 71  KGLSILEKVKSQIGVPVLTDVHEDTPLFEVSSVVDVLQTPAFLCRQTNFIQKVAAMNKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PWEM +++ K  A G + ++ CERG SFGYN LV+DMRS+ IM   G PV+
Sbjct: 131 NIKKGQFLAPWEMKHVIAKAKAQGNEQIMACERGVSFGYNNLVSDMRSLVIMRETGCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG +   SGG+R++I  LA+AAVA+GI+G+F+ETH DPDNA SDGPN   +
Sbjct: 191 YDATHSVQLPGGNNGVSGGQREFIPALARAAVAVGISGLFMETHPDPDNALSDGPNSWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             + +LL  L A D++ K
Sbjct: 251 DKMKQLLESLKAADEVYK 268


>gi|238019685|ref|ZP_04600111.1| hypothetical protein VEIDISOL_01559 [Veillonella dispar ATCC 17748]
 gi|237863726|gb|EEP65016.1| hypothetical protein VEIDISOL_01559 [Veillonella dispar ATCC 17748]
          Length = 272

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/263 (48%), Positives = 181/263 (68%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T    +   ++AGPC IE +D    I ++   IC+ L I  ++K+SFDKANRSS    R
Sbjct: 9   ITVGGGKGLFVLAGPCVIEDYDRTLAIGKRAKEICERLGIPYIFKASFDKANRSSYGSFR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +I   +KK+   P+++D+H+ +Q E  A+ +D+LQIPA LCRQTDL+  AA+
Sbjct: 69  GPGLEEGLKILASIKKELNVPVVSDIHSIEQIEPAAEVLDVLQIPAFLCRQTDLVYGAAK 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S 
Sbjct: 129 TGKCVNVKKGQFMAPKDMENVLNKMKETGNENLMLTERGFSFGYNNLVVDMRSFPIMRSF 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV+FDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDGP
Sbjct: 189 DYPVVFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ + +   LL  L+AIDKI+K
Sbjct: 249 NMLYLDNFEALLKDLVAIDKIVK 271


>gi|269797606|ref|YP_003311506.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Veillonella parvula DSM
           2008]
 gi|269094235|gb|ACZ24226.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Veillonella parvula DSM
           2008]
          Length = 272

 Score =  278 bits (712), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 128/263 (48%), Positives = 181/263 (68%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T    +   ++AGPC IE +D    I ++   IC+ L +  ++K+SFDKANRSS +  R
Sbjct: 9   ITVGGGKGLFVLAGPCVIEDYDRTLAIGKRAKEICERLGVPYIFKASFDKANRSSFSSFR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++   +KK+   P+++D+H+ +Q E  A+ +DILQIPA LCRQTDL+  AA+
Sbjct: 69  GPGLEEGLKMLASIKKELNVPVVSDIHSIEQIEPAAEVLDILQIPAFLCRQTDLVYGAAK 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S 
Sbjct: 129 TGKCVNVKKGQFMAPKDMENVLNKMKETGNENLMLTERGFSFGYNNLVVDMRSFPIMRSF 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PVIFDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDGP
Sbjct: 189 DYPVIFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +     LL  L+AIDKI+K
Sbjct: 249 NMLYLDQFEDLLRDLVAIDKIVK 271


>gi|313894612|ref|ZP_07828175.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella sp. oral taxon
           158 str. F0412]
 gi|313440802|gb|EFR59231.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella sp. oral taxon
           158 str. F0412]
          Length = 272

 Score =  278 bits (712), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 128/263 (48%), Positives = 180/263 (68%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T    +   ++AGPC IE +D    I ++   ICQ L +  ++K+SFDKANRSS    R
Sbjct: 9   ITVGGGKGLFVLAGPCVIEDYDRTLAIGKRAKEICQRLGVPYIFKASFDKANRSSFGSFR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++   +KK+   P+++D+H+ +Q E  A+ +DILQIPA LCRQTDL+  AA+
Sbjct: 69  GPGLEEGLKMLASIKKELNVPVVSDIHSIEQIEPAAEVLDILQIPAFLCRQTDLVYGAAK 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S 
Sbjct: 129 TGKCVNVKKGQFMAPKDMENVLNKMKETGNENLMLTERGFSFGYNNLVVDMRSFPIMRSF 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PVIFDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDGP
Sbjct: 189 DYPVIFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +     +L  L+AIDKI+K
Sbjct: 249 NMLYLDQFEAMLRDLVAIDKIVK 271


>gi|39996992|ref|NP_952943.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sulfurreducens
           PCA]
 gi|48428283|sp|P61655|KDSA_GEOSL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|39983880|gb|AAR35270.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sulfurreducens
           PCA]
 gi|298506009|gb|ADI84732.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Geobacter sulfurreducens KN400]
          Length = 272

 Score =  278 bits (712), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 131/272 (48%), Positives = 192/272 (70%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I +GS    V    ++  VLIAGPC IE+       AE+L  IC  +++ LV+K+S+DKA
Sbjct: 5   ITIGS----VKIGGDRPLVLIAGPCVIENEAATLRCAERLMTICNGVSVSLVFKASYDKA 60

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NR+S+   RG G+++G  I + +K   G P+++D+H+ +Q +  A+ +DI+Q+PA LCRQ
Sbjct: 61  NRTSVTSFRGPGMQEGLRILQKVKDSLGIPVISDIHSIEQVKPAAEVLDIIQVPAFLCRQ 120

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+    +T RV+NVKKGQF++PW+M N++ K+ + G + ++  ERG +FGYN LV+DM
Sbjct: 121 TDLVVEVGRTNRVVNVKKGQFMAPWDMENVVGKILSTGNERIILTERGVTFGYNNLVSDM 180

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
           RS+PIM  +G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA GI GIF+E H+D
Sbjct: 181 RSLPIMRRIGFPVVFDATHSVQLPGGQGGSSGGQREFVEYLSRAAVATGIDGIFMEVHED 240

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           P+ A  DGPN + + DLP LL +L AID I+K
Sbjct: 241 PEKALCDGPNSVKLDDLPALLKKLKAIDAIVK 272


>gi|121604092|ref|YP_981421.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polaromonas
           naphthalenivorans CJ2]
 gi|158513868|sp|A1VLH2|KDSA_POLNA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|120593061|gb|ABM36500.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polaromonas
           naphthalenivorans CJ2]
          Length = 285

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 136/264 (51%), Positives = 178/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAGPC +ES       A  L  I  SL I  ++KSS+DKANRSS    RG G++
Sbjct: 11  DQPFFLIAGPCVVESEQLQMDTAGTLKEITASLGIPFIFKSSYDKANRSSGTSFRGPGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG +I   +K++ G PILTDVH+E +  A+A  VD+LQ PA LCRQTD + A AQ+GR +
Sbjct: 71  KGLQILAKVKRELGLPILTDVHSEAEITAVAAVVDVLQTPAFLCRQTDFIHAVAQSGRPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKD------VLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K  A   +        + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPGDMKNVIDKARAAAREKGLDEDRFMACERGASFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQ PG  G  SGG+R+ +  LA+AAVA+GIAG+F+ETH DP NA SDG
Sbjct: 191 TRAPVVFDATHSVQLPGGMGTSSGGQREMVPVLARAAVAVGIAGLFMETHPDPANAMSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +K +  LL  LL +D++ K
Sbjct: 251 PNAVPLKHMKALLETLLELDRVTK 274


>gi|212703577|ref|ZP_03311705.1| hypothetical protein DESPIG_01622 [Desulfovibrio piger ATCC 29098]
 gi|212672998|gb|EEB33481.1| hypothetical protein DESPIG_01622 [Desulfovibrio piger ATCC 29098]
          Length = 281

 Score =  278 bits (710), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 183/263 (69%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           + FSN     +IAGPC IE        A  L  I     + L++KSSFDKANRSS A  R
Sbjct: 4   IRFSNTGPLSVIAGPCAIEGRQQTLEAAAALKEIFLQAGVPLIFKSSFDKANRSSGASYR 63

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           GVG+ +G  I  +++++Y  P++TD+H  +Q   +A++VD+LQIPA LCRQTDLL AAA 
Sbjct: 64  GVGMTEGLSILAEVRERYDVPVITDIHLPEQAIPVAEAVDMLQIPAFLCRQTDLLLAAAA 123

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +N+KKGQFLSPWEM ++L K  + G + +  CERG+SFGYN LV DMR + IM   
Sbjct: 124 TGKPVNIKKGQFLSPWEMRHVLAKACSTGNERICLCERGSSFGYNNLVVDMRGLEIMKKT 183

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVIFDA+HSVQ PG     SGG+R+++ PLA+AAVA+G+AG+FLETH DPD AP DGP
Sbjct: 184 GHPVIFDATHSVQLPGAGDGKSGGQREFVAPLARAAVAVGVAGLFLETHPDPDVAPCDGP 243

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+    LP LL+ L  +D+I K
Sbjct: 244 NMLPFTALPSLLATLKDLDRIAK 266


>gi|319761808|ref|YP_004125745.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alicycliphilus
           denitrificans BC]
 gi|330826332|ref|YP_004389635.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alicycliphilus
           denitrificans K601]
 gi|317116369|gb|ADU98857.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alicycliphilus
           denitrificans BC]
 gi|329311704|gb|AEB86119.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alicycliphilus
           denitrificans K601]
          Length = 285

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 180/264 (68%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAGPC +ES      +A +L  I  SL I  ++KSS+DKANRSS A  RG G++
Sbjct: 11  DRPFFLIAGPCVVESEQLQMDVAGRLQEITASLGIPFIFKSSYDKANRSSGASFRGPGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +KK+ G P+LTDVHTE +  A+A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  KGLEILAKVKKQLGVPVLTDVHTEAEIPAVAQVVDVLQTPAFLCRQTDFIRAVAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAK------DVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K  A   +        + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARAAAREAGLSEDRFMACERGASFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG R+ +  L++AAVA+G+AG+F+ETH DP +A SDG
Sbjct: 191 TGAPVVFDATHSVQLPGGQGTSSGGMREMVPVLSRAAVAVGVAGLFMETHPDPASALSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +K +  LL  L+ +D + K
Sbjct: 251 PNAVPLKHMRALLETLVQLDAVTK 274


>gi|294795175|ref|ZP_06760309.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella sp. 3_1_44]
 gi|294453967|gb|EFG22342.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella sp. 3_1_44]
          Length = 272

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 181/263 (68%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T    +   ++AGPC IE +D    I ++   IC+ L +  ++K+SFDKANRSS +  R
Sbjct: 9   ITVGGGKGLFVLAGPCVIEDYDRTLAIGKRAKEICERLGVPYIFKASFDKANRSSFSSFR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++   +KK+   P+++D+H+ +Q E  A+ +DILQIPA LCRQTDL+  AA+
Sbjct: 69  GPGLEEGLKMLASIKKELNVPVVSDIHSIEQIEPAAEVLDILQIPAFLCRQTDLVYGAAK 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S 
Sbjct: 129 TGKCVNVKKGQFMAPKDMENVLNKMKETGNENLMLTERGFSFGYNNLVVDMRSFPIMRSF 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PVIFDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDGP
Sbjct: 189 DYPVIFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +     +L  L+AIDKI+K
Sbjct: 249 NMLYLDQFEDVLRDLVAIDKIVK 271


>gi|317485285|ref|ZP_07944165.1| 3-deoxy-8-phosphooctulonate synthase [Bilophila wadsworthia 3_1_6]
 gi|316923411|gb|EFV44617.1| 3-deoxy-8-phosphooctulonate synthase [Bilophila wadsworthia 3_1_6]
          Length = 271

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 135/251 (53%), Positives = 171/251 (68%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           + AGPC +ES + A   A  +    +   +  V+KSS+DKANR+S  G RG GL KG E 
Sbjct: 17  IFAGPCALESFELALDTAHAVAEASKEAGLFAVFKSSWDKANRTSGKGFRGPGLVKGMEW 76

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
              +K++ G P++TD+H  +Q   + +  DILQIPA LCRQTDLL AAA+TGRV+NVKKG
Sbjct: 77  LARIKEETGLPVVTDIHLPEQAGPVGEVADILQIPAFLCRQTDLLLAAARTGRVVNVKKG 136

Query: 167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASH 226
           QF++PW+M  +  K+ A G   VL  ERG+SFGYN LV D RSIPIM ++GVPVIFDA+H
Sbjct: 137 QFVAPWDMGPVRDKVAAAGNDRVLLTERGSSFGYNNLVVDFRSIPIMRALGVPVIFDATH 196

Query: 227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPK 286
           SVQ PG  G+CSGGER ++  LA+AA   G+ GIF+E H DPD A  DGPN   +  LP 
Sbjct: 197 SVQLPGGQGSCSGGERHHVPTLARAAAGAGVDGIFMECHPDPDKALCDGPNSWPVAKLPA 256

Query: 287 LLSQLLAIDKI 297
           LL QL AI  I
Sbjct: 257 LLKQLSAIWNI 267


>gi|302879410|ref|YP_003847974.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gallionella
           capsiferriformans ES-2]
 gi|302582199|gb|ADL56210.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gallionella
           capsiferriformans ES-2]
          Length = 283

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 132/259 (50%), Positives = 177/259 (68%), Gaps = 1/259 (0%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q   LIAGPC IES   A   A  L  IC+ LN+  +YKSS+DKANRSS    RG GL 
Sbjct: 11  DQPLFLIAGPCVIESAQMAIDTAGALQEICRELNLPFIYKSSYDKANRSSGKSFRGFGLD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +I  D+K + G  +LTDVH+ ++  A+A  VD+LQ PA LCRQTD + A A+ G+ +
Sbjct: 71  AGLKILSDVKSQLGVNVLTDVHSIEEIGAVASVVDVLQTPAFLCRQTDFIHAVARCGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLH-AHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           N+KKGQFLSPW+M N+++K     GA +++ CERG SFGYN LV+DMRS+ +M +   PV
Sbjct: 131 NIKKGQFLSPWDMQNVVEKARDVSGADNIMVCERGASFGYNNLVSDMRSLAVMRNTRCPV 190

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G  SGG+R+++  LA+AAVA GI+G+F+ETH  P  A SDGPN   
Sbjct: 191 VFDATHSVQLPGGQGTVSGGQREFVPVLARAAVAAGISGLFMETHPTPSKALSDGPNAFP 250

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  L  LL  L+ +D+ +K
Sbjct: 251 LGHLKALLKTLMVLDQTVK 269


>gi|254468351|ref|ZP_05081757.1| 3-deoxy-8-phosphooctulonate synthase [beta proteobacterium KB13]
 gi|207087161|gb|EDZ64444.1| 3-deoxy-8-phosphooctulonate synthase [beta proteobacterium KB13]
          Length = 275

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 131/259 (50%), Positives = 185/259 (71%), Gaps = 2/259 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           Q F LIAGPC IE+      +AE+L     SL I  ++KSSFDKANRSS    RG G+++
Sbjct: 12  QPFFLIAGPCVIENESMTMSVAEQLKETTSSLGINFIFKSSFDKANRSSNNTFRGHGIEE 71

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G  I   +KK++  P+LTDVH+E Q +++A+ VD+LQ PA LCRQTD + A A++G+ +N
Sbjct: 72  GLRILEKVKKEFDLPVLTDVHSEDQVKSVAEVVDVLQTPAFLCRQTDFIHAVAKSGKPVN 131

Query: 163 VKKGQFLSPWEMHNILQKL-HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +KKGQFL+P +M  +++K   A+G  D ++ CERG SFGYNTLV+DMRS+ IM +   PV
Sbjct: 132 IKKGQFLAPQDMSMVVKKAKEANGGIDNIMVCERGVSFGYNTLVSDMRSLSIMRATNCPV 191

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQQPG  G+ SGG+ +++  LA+AA+A+GI+GIF+ETH +P  A SDGPN + 
Sbjct: 192 VFDATHSVQQPGGQGDRSGGQSEFVPLLARAAMAVGISGIFMETHPNPSEALSDGPNAVP 251

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           + ++  LL  L  ID ++K
Sbjct: 252 LDNMKDLLKTLQGIDHLVK 270


>gi|283781752|ref|YP_003372507.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pirellula staleyi DSM
           6068]
 gi|283440205|gb|ADB18647.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pirellula staleyi DSM
           6068]
          Length = 285

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 134/256 (52%), Positives = 179/256 (69%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           +  +LIAGPC IE  D    IA +L  I   L + LV+K+SFDKANR+S    RG GL+ 
Sbjct: 26  ENLLLIAGPCVIEDADFTVAIAHELKRITSGLPVNLVFKASFDKANRTSSGAFRGAGLEG 85

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G ++   + ++ G P+ TD+H   Q  A A+   +LQIPA L RQTDLL AAAQTGR +N
Sbjct: 86  GLKVLDRVVRETGLPVTTDIHESYQAAAAAEVCTVLQIPAFLARQTDLLVAAAQTGRSVN 145

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQF++PW+M ++  KL + G ++VL CERGT FGY  LV DMRS+P M S+G PV+F
Sbjct: 146 VKKGQFMAPWDMAHVAGKLRSAGCQNVLLCERGTFFGYGRLVNDMRSLPQMRSLGCPVVF 205

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ+PG  G  +GG R  + PLA+AAVAIG+ G+F ETH DPD +PSDGPNM+ + 
Sbjct: 206 DATHSVQEPGGLGGATGGNRAMVEPLARAAVAIGVDGLFFETHPDPDKSPSDGPNMLPLA 265

Query: 283 DLPKLLSQLLAIDKII 298
               +LS++LAI +++
Sbjct: 266 TFSDVLSRVLAIRQLV 281


>gi|52841416|ref|YP_095215.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|54297140|ref|YP_123509.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella pneumophila
           str. Paris]
 gi|148358769|ref|YP_001249976.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella pneumophila
           str. Corby]
 gi|296106814|ref|YP_003618514.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Legionella pneumophila 2300/99 Alcoy]
 gi|59798141|sp|Q5X5Y5|KDSA_LEGPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|59798154|sp|Q5ZWA3|KDSA_LEGPH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166199038|sp|A5IB80|KDSA_LEGPC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|52628527|gb|AAU27268.1| 2-dehydro-3-deoxyphosphonooctonate aldolase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|53750925|emb|CAH12336.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) [Legionella pneumophila str. Paris]
 gi|148280542|gb|ABQ54630.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase) (3-deoxy-D-
           manno-octulosonic acid 8-phosphate synthetase)
           [Legionella pneumophila str. Corby]
 gi|295648715|gb|ADG24562.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Legionella pneumophila 2300/99 Alcoy]
          Length = 274

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 129/258 (50%), Positives = 175/258 (67%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++   LIAGPC IES + A   A  L  +C  LNI  +YKSSFDKANRSS++  RG G +
Sbjct: 11  DKPLFLIAGPCVIESEELALETAGYLKEMCSQLNIPFIYKSSFDKANRSSISSYRGPGFE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG  I   +K + G P+LTDVH +     ++  VD+LQ PA LCRQT+ +   A   + +
Sbjct: 71  KGLSILEKVKSQIGVPVLTDVHEDTPLFEVSSVVDVLQTPAFLCRQTNFIQKVAAMNKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PWEM +++ K  A G + ++ CERG SFGYN LV+DMRS+ IM   G PV+
Sbjct: 131 NIKKGQFLAPWEMKHVIAKAKAQGNEQIMACERGVSFGYNNLVSDMRSLVIMRETGCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG +   SGG+R++I  LA+AAVA+GI+G+F+ETH DPD A SDGPN   +
Sbjct: 191 YDATHSVQLPGGNNGVSGGQREFIPALARAAVAVGISGLFMETHPDPDKALSDGPNSWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             + +LL  L A D++ K
Sbjct: 251 DKMKQLLESLKAADEVYK 268


>gi|291532170|emb|CBL05283.1| 3-deoxy-8-phosphooctulonate synthase [Megamonas hypermegale
           ART12/1]
          Length = 273

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 129/255 (50%), Positives = 176/255 (69%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
            VL+AGPC +ES++ +  I + +  I   L I  V+K+SFDKANRSS  G RG GL++G 
Sbjct: 17  LVLLAGPCVLESYERSLYIGKTIKEITSRLGIPYVFKASFDKANRSSYNGYRGPGLEEGL 76

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           +  + +K++   P++TD+H E Q E ++  VD+LQIPA L RQTDLL  AA++G V+NVK
Sbjct: 77  KWLQSIKEELNVPVVTDIHNETQVEPVSKVVDVLQIPAFLSRQTDLLYTAAKSGCVVNVK 136

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+P +M N+++KL   G++ +L  ERG SFGYN LV DMRS PIM S G PVIFDA
Sbjct: 137 KGQFLAPADMKNVVKKLEEAGSEKILLTERGASFGYNNLVVDMRSFPIMRSTGYPVIFDA 196

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G  S G R+Y+  LA+ A  +G+ G F+E H +P+ A  DGPNM+ +  L
Sbjct: 197 THSVQLPGGAGTSSAGNREYVEFLARGAAGVGVDGFFMEVHDNPEEALCDGPNMVYLDKL 256

Query: 285 PKLLSQLLAIDKIIK 299
             LL  L+AI++I K
Sbjct: 257 EDLLKDLIAINEITK 271


>gi|225849973|ref|YP_002730207.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Persephonella marina
           EX-H1]
 gi|225646081|gb|ACO04267.1| 3-deoxy-8-phosphooctulonate synthase [Persephonella marina EX-H1]
          Length = 262

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 134/256 (52%), Positives = 183/256 (71%), Gaps = 2/256 (0%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           RF +IAGPC IE+ +  F +AE L  + +   +I  V+KSSFDKANRSS    RG G+  
Sbjct: 3   RFTVIAGPCVIENEEVCFKVAETLSELQKRYPDIRFVFKSSFDKANRSSHESFRGRGMDY 62

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G ++  ++K ++G P+LTD+H   Q E +++ VDI+QIPA LCRQTDLL +AA+TGR IN
Sbjct: 63  GLKVLEEVKSEFGLPVLTDIHESYQAEPVSEVVDIIQIPAFLCRQTDLLLSAAKTGREIN 122

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQFLSPW+  NI++KL   GAK     ERG +FGYN LV D RS+P+M     PVI+
Sbjct: 123 VKKGQFLSPWDTKNIVEKLKFGGAKKFYLTERGVTFGYNNLVVDFRSLPVMRQFA-PVIY 181

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGG+R++I PLAKAAV++G+ G+F ETH DPD A SDGPN I + 
Sbjct: 182 DATHSVQLPGGKGKSSGGQREFIYPLAKAAVSVGVDGLFFETHPDPDKALSDGPNQIPLS 241

Query: 283 DLPKLLSQLLAIDKII 298
           + P+++ +L+++ + +
Sbjct: 242 EFPEVIEKLISLREFL 257


>gi|323697965|ref|ZP_08109877.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio sp. ND132]
 gi|323457897|gb|EGB13762.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio
           desulfuricans ND132]
          Length = 267

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 181/253 (71%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           ++AGPC IES + A   A+ L  +   L + +VYKSSFDKANR+SL   RG G+++G  I
Sbjct: 14  ILAGPCAIESRETALQTADVLAGLASKLGLPIVYKSSFDKANRTSLTSFRGPGMEEGLAI 73

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
             ++K   G P++TD+H  +Q   +A+  D+LQIPA LCRQTDLL AAA+TGRV+NVKKG
Sbjct: 74  LAEVKAATGLPVVTDIHHPEQAAPVAEVADVLQIPAFLCRQTDLLMAAARTGRVVNVKKG 133

Query: 167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASH 226
           QFL+PW+M N+++KL A G   +   ERG+++GYN LV DMRSIP M + GVPVI DA+H
Sbjct: 134 QFLAPWDMKNVVEKLRAAGNDRIWLTERGSTYGYNNLVVDMRSIPQMQAFGVPVIMDATH 193

Query: 227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPK 286
           SVQ PG  G  SGG+R+Y+  LA AAVA G+ G+F+E H DPD A  DGPN + +  +  
Sbjct: 194 SVQLPGGLGGASGGQREYVPVLASAAVAAGVDGVFMEVHPDPDRALCDGPNSLPLNQVEG 253

Query: 287 LLSQLLAIDKIIK 299
           LL++LLA+ ++++
Sbjct: 254 LLNRLLALWEVVR 266


>gi|282850053|ref|ZP_06259435.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella parvula ATCC
           17745]
 gi|282580242|gb|EFB85643.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella parvula ATCC
           17745]
          Length = 272

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 180/263 (68%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T    +   ++AGPC IE +D    I ++   IC+ L +  ++K+SFDKANRSS    R
Sbjct: 9   ITVGGGKGLFVLAGPCVIEDYDRTLAIGKRAKEICERLGVPYIFKASFDKANRSSFNSFR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++   +KK+   P+++D+H+ +Q E  A+ +DILQIPA LCRQTDL+  AA+
Sbjct: 69  GPGLEEGLKMLASIKKELNVPVVSDIHSIEQIEPAAEVLDILQIPAFLCRQTDLVYGAAK 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S 
Sbjct: 129 TGKCVNVKKGQFMAPKDMENVLNKMKETGNENLMLTERGFSFGYNNLVVDMRSFPIMRSF 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PVIFDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDGP
Sbjct: 189 DYPVIFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +     +L  L+AIDKI+K
Sbjct: 249 NMLYLDQFEDVLRDLVAIDKIVK 271


>gi|294793356|ref|ZP_06758501.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella sp. 6_1_27]
 gi|294455787|gb|EFG24152.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella sp. 6_1_27]
          Length = 272

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 180/263 (68%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T    +   ++AGPC IE +D    I ++   IC+ L +  ++K+SFDKANRSS    R
Sbjct: 9   ITVGGGKGLFVLAGPCVIEDYDRTLAIGKRAKEICERLGVPYIFKASFDKANRSSFNSFR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G ++   +KK+   P+++D+H+ +Q E  A+ +DILQIPA LCRQTDL+  AA+
Sbjct: 69  GPGLEEGLKMLASIKKELNVPVVSDIHSIEQIEPAAEVLDILQIPAFLCRQTDLVYGAAK 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S 
Sbjct: 129 TGKCVNVKKGQFMAPKDMENVLNKMKETGNENLMLTERGFSFGYNNLVVDMRSFPIMRSF 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PVIFDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDGP
Sbjct: 189 DYPVIFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +     +L  L+AIDKI+K
Sbjct: 249 NMLYLDQFEAVLRDLVAIDKIVK 271


>gi|121998220|ref|YP_001003007.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halorhodospira halophila
           SL1]
 gi|121589625|gb|ABM62205.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halorhodospira halophila
           SL1]
          Length = 278

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 179/258 (69%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           EQ   LIAGPC +ES   A   A +L  +C  L + L+YKSSFDKANRSS    RG G++
Sbjct: 14  EQPLFLIAGPCVVESEALALESALELRDLCAELGVPLIYKSSFDKANRSSAQSYRGPGME 73

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G  +   ++++ G P++TDVH +   + +A  VD+LQ PA LCRQT+ +   A  G  +
Sbjct: 74  AGLRVLERVRREVGVPVVTDVHEDTPLDEVASVVDVLQTPAFLCRQTNFIQRVAACGLPV 133

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M +++ K  A G + +L CERG SFGYN L++DMR++ +M   G PV+
Sbjct: 134 NLKKGQFLAPWDMTHVVDKARATGNEHILVCERGVSFGYNNLISDMRALAVMRQTGAPVV 193

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG  G+ SGG+R+++  LA+AAVA G++G+F+ETH DPD A SDGPN   +
Sbjct: 194 FDATHSVQLPGGQGHASGGQREFVPVLARAAVAAGVSGLFMETHPDPDAALSDGPNAWPL 253

Query: 282 KDLPKLLSQLLAIDKIIK 299
             + +LL+ L+A+D+++K
Sbjct: 254 DRMRELLATLIALDRVVK 271


>gi|307609938|emb|CBW99466.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella pneumophila
           130b]
          Length = 274

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 129/258 (50%), Positives = 175/258 (67%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++   LIAGPC IES + A   A  L  +C  LNI  +YKSSFDKANRSS++  RG G +
Sbjct: 11  DKPLFLIAGPCVIESEELALETAGYLKEMCIQLNIPFIYKSSFDKANRSSISSYRGPGFE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG  I   +K + G P+LTDVH +     ++  VD+LQ PA LCRQT+ +   A   + +
Sbjct: 71  KGLSILEKVKSQIGVPVLTDVHEDTPLFEVSSVVDVLQTPAFLCRQTNFIQKVAAXNKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PWEM +++ K  A G + ++ CERG SFGYN LV+DMRS+ IM   G PV+
Sbjct: 131 NIKKGQFLAPWEMKHVIAKAKAQGNEQIMACERGVSFGYNNLVSDMRSLVIMRETGCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG +   SGG+R++I  LA+AAVA+GI+G+F+ETH DPD A SDGPN   +
Sbjct: 191 YDATHSVQLPGGNNGVSGGQREFIPALARAAVAVGISGLFMETHPDPDKALSDGPNSWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             + +LL  L A D++ K
Sbjct: 251 DKMKQLLESLKAADEVYK 268


>gi|254497574|ref|ZP_05110362.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella drancourtii
           LLAP12]
 gi|254353190|gb|EET11937.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella drancourtii
           LLAP12]
          Length = 274

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 174/258 (67%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++   LIAGPC IES + A   A  L  +C  LNI  +YKSSFDKANRSSL+  RG G +
Sbjct: 11  DKPLFLIAGPCVIESEELALETAGYLKELCGQLNIPFIYKSSFDKANRSSLSSYRGPGFE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG  I   +K + G P+LTDVH +     ++  VD+LQ PA LCRQT+ +   A   + +
Sbjct: 71  KGLAILEKVKAQIGVPVLTDVHEDTPLVEVSSVVDVLQTPAFLCRQTNFIQKVAAMNKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PWEM +++ K  A G + ++ CERG SFGYN LV+DMRS+ IM     P++
Sbjct: 131 NIKKGQFLAPWEMKHVITKAKASGNEQIMACERGVSFGYNNLVSDMRSLAIMRETECPIV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG +   SGG+R++I  LA+AAVA GI+GIF+ETH DPD A SDGPN   +
Sbjct: 191 YDATHSVQLPGGNNGVSGGQREFIPVLARAAVAAGISGIFMETHPDPDKALSDGPNSWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             + +LL  L+AID + K
Sbjct: 251 DKMKQLLESLIAIDAVYK 268


>gi|198283106|ref|YP_002219427.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665807|ref|YP_002425335.1| 3-deoxy-8-phosphooctulonate synthase [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|226722928|sp|B7J6R3|KDSA_ACIF2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226722929|sp|B5EPM6|KDSA_ACIF5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|198247627|gb|ACH83220.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518020|gb|ACK78606.1| 3-deoxy-8-phosphooctulonate synthase [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 281

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 128/255 (50%), Positives = 175/255 (68%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F L+AGPC IES   A   AE L  IC  L I  +YKSS+DKANRSS    RG G+ +G 
Sbjct: 14  FFLMAGPCAIESESLALRTAEDLRDICARLGIPFIYKSSYDKANRSSGQSFRGPGMDEGL 73

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            I   ++++ G P++TDVH ++   A+A+ VD+LQ PA LCRQTD + A A  G+ +N+K
Sbjct: 74  RILEKVRREVGVPVVTDVHEKEDVSAVAEVVDVLQTPAFLCRQTDFIQAVAAAGKPVNIK 133

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+PW+M ++  K  A G + ++ CERG SFGYN LV+DMRS+ +M   G PV+FDA
Sbjct: 134 KGQFLAPWDMLHVASKAKATGNEQIMVCERGASFGYNNLVSDMRSLAVMRQTGCPVVFDA 193

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G+ SGG+R++I  LA+AAVA G++G+F+ETH +P +A SDGPN   +  +
Sbjct: 194 THSVQLPGGQGDRSGGQREFIPVLARAAVAAGVSGLFMETHPNPADALSDGPNAWPLGRM 253

Query: 285 PKLLSQLLAIDKIIK 299
             LL  L  ID ++K
Sbjct: 254 EDLLRILQHIDHVVK 268


>gi|161579543|ref|YP_114925.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylococcus capsulatus
           str. Bath]
 gi|59798158|sp|Q604M5|KDSA_METCA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
          Length = 283

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 129/258 (50%), Positives = 174/258 (67%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           E    LIAGPC IE+   A   A  L  I   L I  +YKSSFDKANRSS A  RG G++
Sbjct: 21  EHPLFLIAGPCVIETEQLALDTAGALKEITDGLGIPFIYKSSFDKANRSSHASYRGPGME 80

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH +   + +A  VD+LQ PA LCRQT+ +   A TG+ +
Sbjct: 81  EGLRILAEVKRQIGVPVLTDVHEDTPLQEVASVVDVLQTPAFLCRQTNFIQNVANTGKPV 140

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M ++  K  A G + ++ CERG SFGYN LV+DMRS+ IM   G PV+
Sbjct: 141 NLKKGQFLAPWDMKHVAAKALATGNRHIMVCERGVSFGYNNLVSDMRSLSIMRETGCPVV 200

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F+ETH DPD A SDGPN   +
Sbjct: 201 YDATHSVQLPGGQGTASGGQREFVPALARAAVAVGISGLFMETHPDPDRALSDGPNSWPL 260

Query: 282 KDLPKLLSQLLAIDKIIK 299
             +  LL  L  +D+ +K
Sbjct: 261 DRMKALLELLSTLDRTVK 278


>gi|253998570|ref|YP_003050633.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylovorus sp. SIP3-4]
 gi|313200643|ref|YP_004039301.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylovorus sp. MP688]
 gi|253985249|gb|ACT50106.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylovorus sp. SIP3-4]
 gi|312439959|gb|ADQ84065.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylovorus sp. MP688]
          Length = 279

 Score =  275 bits (703), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 135/260 (51%), Positives = 179/260 (68%), Gaps = 2/260 (0%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           E    LIAGPC IES   A   A +L  I  ++ I  +YKSS+DKANRSS    RG G++
Sbjct: 11  EHPIFLIAGPCVIESKQMAIDTAGQLKEIAAAIGIPFIYKSSYDKANRSSTKTFRGFGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  D++ + G PILTDVHTE+Q   +A  VD+LQ PA LCRQTD +TA A  G+ +
Sbjct: 71  EGLRILDDVRAQIGVPILTDVHTEEQVPHVAAVVDVLQTPAFLCRQTDFITAVATCGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
           N+KKGQFL+P +M  ++QK   A+G  D ++ CERG SFGYNTLV+DMR + IM     P
Sbjct: 131 NIKKGQFLAPGDMKQVVQKAKEANGGADTIMVCERGASFGYNTLVSDMRGLAIMRETQCP 190

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           V+FDA+HSVQQPG  G+ SGG+R+++  LA+AAVA GIAG+F+ETH DP  A SDGPN  
Sbjct: 191 VVFDATHSVQQPGGQGDKSGGQREFVPVLARAAVASGIAGLFMETHPDPSKALSDGPNAW 250

Query: 280 NIKDLPKLLSQLLAIDKIIK 299
            +  +  LL  L+ +D+++K
Sbjct: 251 PLPKMKDLLQVLVELDRVVK 270


>gi|320529929|ref|ZP_08031006.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas artemidis F0399]
 gi|320137947|gb|EFW29852.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas artemidis F0399]
          Length = 277

 Score =  275 bits (703), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 134/270 (49%), Positives = 178/270 (65%), Gaps = 5/270 (1%)

Query: 35  NQVTFSN-----EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR 89
           N+V  +N      +  VL+AGPC +E  D + MI   +  I   L I  V+K+SFDKANR
Sbjct: 4   NKVKLANFEIGGGEPLVLLAGPCVLEGLDRSLMIGRGIKEITDRLGIPYVFKASFDKANR 63

Query: 90  SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTD 149
           S+    RG GLK+G ++ + +KK+ G P++TD+H   Q    A+ VDILQIPA L RQTD
Sbjct: 64  SAFHSFRGPGLKEGLKLLKTIKKELGVPVVTDIHETHQARPAAEVVDILQIPAFLSRQTD 123

Query: 150 LLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRS 209
           LL AAAQT  ++NVKKGQFLSP +M N++ K+H  G++ +L  ERG SFGYN LV DMRS
Sbjct: 124 LLHAAAQTNAIVNVKKGQFLSPNDMRNVVDKIHESGSEKILLTERGASFGYNNLVVDMRS 183

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
            PIM S G PVIFD +HSVQ PG  G  S G+R+++  L +AAV  G+ G+FLE H +P 
Sbjct: 184 FPIMRSFGYPVIFDGTHSVQLPGGAGTSSSGQREFVEYLVRAAVGAGVDGLFLEVHDNPP 243

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDG NM+ +  L  LL   LAI ++++
Sbjct: 244 EALSDGANMVYLDKLEDLLKDALAIYEVVR 273


>gi|253996918|ref|YP_003048982.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylotenera mobilis
           JLW8]
 gi|253983597|gb|ACT48455.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylotenera mobilis
           JLW8]
          Length = 279

 Score =  275 bits (703), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 135/260 (51%), Positives = 180/260 (69%), Gaps = 2/260 (0%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           E    LIAGPC IES   A   A +L  I  +LNI  +YKSS+DKANRSS    RG G+ 
Sbjct: 11  EHPLFLIAGPCVIESQQMAIDTAGQLKEIATALNIPFIYKSSYDKANRSSNKTFRGFGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G +I   ++ + G PILTDVHTE+Q   +A  VD+LQ PA LCRQTD +TA A++G+ +
Sbjct: 71  EGLKILDHVRSQIGVPILTDVHTEEQVPHVAAVVDVLQTPAFLCRQTDFITACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAH--GAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
           N+KKGQF++P +M N++QK      GA +++ CERG SFGYNTLV+DMR +  M     P
Sbjct: 131 NIKKGQFMAPGDMKNVVQKAKEANGGADNIMVCERGASFGYNTLVSDMRGLATMRETHCP 190

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           V+FDA+HSVQQPG  G+ SGG+R+++  LA+AAVA GIAGIF+ETH DP  A SDGPN  
Sbjct: 191 VVFDATHSVQQPGGQGDKSGGQREHVPVLARAAVASGIAGIFMETHPDPAKALSDGPNAW 250

Query: 280 NIKDLPKLLSQLLAIDKIIK 299
            +  +  LL  L+ +D+++K
Sbjct: 251 PLHKMRDLLEVLVDLDRLVK 270


>gi|154248123|ref|YP_001419081.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xanthobacter
           autotrophicus Py2]
 gi|154162208|gb|ABS69424.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xanthobacter
           autotrophicus Py2]
          Length = 292

 Score =  275 bits (703), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 146/273 (53%), Positives = 197/273 (72%), Gaps = 1/273 (0%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           + +G   + V   N     LIAGPCQ+ES  HA  +A  L  I +   IGL++K+SFDKA
Sbjct: 14  VEVGQDVDLVRIGNGLPLALIAGPCQMESRAHALEVASALKEITRRRGIGLIFKTSFDKA 73

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NR+SL+ +RG+GL+    +F ++++  G P+LTDVH   QC A A +VD+LQIPA LCRQ
Sbjct: 74  NRTSLSAQRGLGLEAALPVFAEIRESLGLPVLTDVHEIDQCAAAAQAVDVLQIPAFLCRQ 133

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDLL AAA+TG+ +NVKKGQFL+PW+M N++ KL   G   VL  ERG SFGYNTLV+DM
Sbjct: 134 TDLLIAAARTGKTVNVKKGQFLAPWDMANVVNKLTGAGNGRVLVTERGVSFGYNTLVSDM 193

Query: 208 RSIPIMT-SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQ 266
           R++PI+  + G PV+FDA+HSVQQPG  G+ SGG+R+++  LA+AAVA+G+A +F+ETH 
Sbjct: 194 RALPILAKTTGAPVVFDATHSVQQPGGQGSSSGGQREFVPVLARAAVAVGVAAVFIETHP 253

Query: 267 DPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           DPD APSDGPNM+ +  L  L++ L A D + K
Sbjct: 254 DPDKAPSDGPNMVPLSQLEALITTLQAFDAVAK 286


>gi|292669894|ref|ZP_06603320.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Selenomonas noxia ATCC
           43541]
 gi|292648691|gb|EFF66663.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Selenomonas noxia ATCC
           43541]
          Length = 277

 Score =  275 bits (702), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 132/270 (48%), Positives = 181/270 (67%), Gaps = 5/270 (1%)

Query: 35  NQVTFSN-----EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR 89
           N+V  +N      +  VLIAGPC +E  + + MI   +  I   L I  V+K+SFDKANR
Sbjct: 4   NKVKLANFEIGGGEPLVLIAGPCVLEGLERSLMIGRGIKEITNRLGIPYVFKASFDKANR 63

Query: 90  SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTD 149
           S+    RG G++ G ++ + ++++   P++TD+H   Q E  A +VDILQIPA L RQTD
Sbjct: 64  SAYHSFRGPGMEDGLKMLKKIRRELNVPVVTDIHETCQAEPAAKAVDILQIPAFLSRQTD 123

Query: 150 LLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRS 209
           LL AAAQTG ++NVKKGQFLSP +M N++ K+H  G++ +L  ERG SFGYN LV DMR+
Sbjct: 124 LLHAAAQTGAIVNVKKGQFLSPNDMRNVVDKIHESGSERILLTERGASFGYNNLVVDMRA 183

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
            PIM S G PVIFD +HSVQ PG  G  S G+R+Y+  L +AAV  G+ G+FLE H +P 
Sbjct: 184 FPIMRSFGYPVIFDGTHSVQLPGGAGTSSSGQREYVEYLVRAAVGAGVDGLFLEVHDNPP 243

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPNM+ +  L +LL + LAI ++++
Sbjct: 244 EALSDGPNMVYLDKLEELLKEALAIYEVVR 273


>gi|110678965|ref|YP_681972.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter
           denitrificans OCh 114]
 gi|109455081|gb|ABG31286.1| 3-deoxy-8-phosphooctulonate synthase [Roseobacter denitrificans OCh
           114]
          Length = 277

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 186/263 (70%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +   N++   +IAGPCQ+ES DHA MIA ++   C       V+K+S+DKANR+SL+G R
Sbjct: 9   LVIGNDRPLTVIAGPCQLESADHAQMIAGRMKEACDKAGAQYVFKASYDKANRTSLSGIR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+ +G +I + + +    P+LTDVH E QC   A +VDILQIPA LCRQTD+L AA Q
Sbjct: 69  GPGMDEGLKILQSVGQAIDVPVLTDVHNEGQCAPAAQAVDILQIPAFLCRQTDMLLAAGQ 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG  +NVKKGQFL+PWEM NI  K+ + G   +L  ERGTSFGYNTLV DMR++P M   
Sbjct: 129 TGAAVNVKKGQFLAPWEMSNITTKIESTGNTRILLTERGTSFGYNTLVADMRALPQMAQT 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAVAIG+A +F+ETH++PD +PSDGP
Sbjct: 189 GYPVVMDATHSVQQPGGKGGSSGGQREFAPVMARAAVAIGVAAVFIETHENPDASPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NMI +  +P L+  L+  D + K
Sbjct: 249 NMIYLDQMPDLIETLMQFDALAK 271


>gi|223938905|ref|ZP_03630792.1| 2-dehydro-3-deoxyphosphooctonate aldolase [bacterium Ellin514]
 gi|223892458|gb|EEF58932.1| 2-dehydro-3-deoxyphosphooctonate aldolase [bacterium Ellin514]
          Length = 274

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 136/262 (51%), Positives = 183/262 (69%)

Query: 38  TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRG 97
           + ++  R  LIAGPC IE+      IA  L   C  L I  ++K+S+DKANR+S    RG
Sbjct: 10  SLNSPSRLSLIAGPCAIENEKLCLRIAASLKKTCDKLGINYIFKASYDKANRTSNQSFRG 69

Query: 98  VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQT 157
           +GL+ G +I   ++   G P+LTDVHTEQQ  A A+ VD LQIPA LCRQTDL+ AAA+T
Sbjct: 70  LGLENGLQILARVRTDIGVPVLTDVHTEQQVAAAAEVVDALQIPAFLCRQTDLIAAAAKT 129

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           G+++NVKKGQFLSP EM N+++K  A G K +   ERGT+FGYN LV DMRSIPIM+  G
Sbjct: 130 GKIVNVKKGQFLSPQEMGNVVKKAEAAGTKKICVTERGTTFGYNNLVADMRSIPIMSRFG 189

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
            PVIFDA+HSVQ PG  G+ S G+R++   LA+ A+  G  G+F+ETH DP++A SDGPN
Sbjct: 190 YPVIFDATHSVQLPGGGGDKSSGQREFAPVLARCALIAGANGVFIETHPDPEHALSDGPN 249

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
           MI + ++P+LL+ L+ +  + +
Sbjct: 250 MIPLAEMPRLLANLVKVHTLAR 271


>gi|158335350|ref|YP_001516522.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acaryochloris marina
           MBIC11017]
 gi|226722926|sp|B0BZZ8|KDSA_ACAM1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|158305591|gb|ABW27208.1| 3-deoxy-8-phosphooctulonate synthase [Acaryochloris marina
           MBIC11017]
          Length = 278

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 180/254 (70%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             L++GPC IES D    +A  +  IC+ L I  V+KSSFDKANR+S++  RG  +++G 
Sbjct: 18  LTLLSGPCVIESEDFTLKMASGIARICEKLGISYVFKSSFDKANRTSISSFRGHPMEEGL 77

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            I + +K + G P++TD+H   Q   +A+  DILQIPA LCRQTDLL AAA TGR INVK
Sbjct: 78  RILQRVKDEVGVPVVTDIHESHQAAPVAEVADILQIPAFLCRQTDLLMAAAATGRTINVK 137

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+PW+M N++ KL A GAK +L  ERGTSFGYN LV D RS+P M S G PV+FDA
Sbjct: 138 KGQFLAPWDMKNVVSKLEAGGAKKILLTERGTSFGYNALVVDFRSLPQMRSFGYPVVFDA 197

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G+ SGG+R+Y   LA+AA AIG+  +F+E H++PD APSDGPNMI +  L
Sbjct: 198 THSVQMPGGQGSSSGGQREYAPYLARAAAAIGVDALFMEVHENPDQAPSDGPNMIPLHQL 257

Query: 285 PKLLSQLLAIDKII 298
             +L  +L + KI+
Sbjct: 258 EDVLRPILEVHKIM 271


>gi|238927532|ref|ZP_04659292.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas flueggei ATCC
           43531]
 gi|238884814|gb|EEQ48452.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas flueggei ATCC
           43531]
          Length = 275

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 135/270 (50%), Positives = 180/270 (66%), Gaps = 5/270 (1%)

Query: 35  NQVTFSN-----EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR 89
           N+V  +N      +  VL+AGPC +E  + + MI   +  I + L I  V+K+SFDKANR
Sbjct: 2   NKVKLANFEIGGGEPLVLLAGPCVLEGLERSLMIGRGIKEITERLGIPYVFKASFDKANR 61

Query: 90  SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTD 149
           S+    RG GL  G ++   +KK+ G P++TD+H   Q E  A  VDILQIPA L RQTD
Sbjct: 62  SAYHSFRGPGLTDGLKMLGRIKKELGVPVVTDIHETCQAEPAAKVVDILQIPAFLSRQTD 121

Query: 150 LLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRS 209
           LL AAAQTG V+NVKKGQFLSP +M N++ K+H  G++ +L  ERG SFGYN LV DMR+
Sbjct: 122 LLHAAAQTGAVVNVKKGQFLSPNDMRNVVDKIHESGSERILLTERGASFGYNNLVVDMRA 181

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           +PIM S G PVIFD +HSVQ PG  G  S G+R+Y+  L +AAV  G+ G+FLE H +P 
Sbjct: 182 LPIMRSFGYPVIFDGTHSVQLPGGAGTSSSGQREYVEYLVRAAVGAGVDGLFLEVHDNPA 241

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDG NM+ +  L +LL + L+I +I++
Sbjct: 242 EALSDGANMVYLDKLEELLKEALSIYEIVR 271


>gi|160900538|ref|YP_001566120.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Delftia acidovorans
           SPH-1]
 gi|238687163|sp|A9BN40|KDSA_DELAS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|160366122|gb|ABX37735.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Delftia acidovorans
           SPH-1]
          Length = 285

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 178/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++RF LIAGPC +ES      +A  L  I  +L I  ++KSS+DKANRSS A  RG G+ 
Sbjct: 11  DRRFFLIAGPCVVESEQLQMDVAGHLKEITAALGIHFIFKSSYDKANRSSGASFRGPGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +KK    PILTDVHTE +  A++  VD+LQ PA LCRQTD + A AQ+GR +
Sbjct: 71  KGLEILAKVKKDLQVPILTDVHTESEIPAVSQVVDVLQTPAFLCRQTDFIRAVAQSGRPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAK------DVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K  A   +        + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARAAAKEAGLPEDSFMACERGASFGYNNLVSDMRSLSIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG +G  SGG R+ +  L++AAVA+G+AG+F+ETH +P  A SDG
Sbjct: 191 TGAPVVFDATHSVQLPGGNGTSSGGMREMVPVLSRAAVAVGVAGLFMETHPNPPCALSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +K +  LL  L+A+D + K
Sbjct: 251 PNAVPLKHMKALLETLVALDDVTK 274


>gi|282856194|ref|ZP_06265477.1| 3-deoxy-8-phosphooctulonate synthase [Pyramidobacter piscolens
           W5455]
 gi|282585953|gb|EFB91238.1| 3-deoxy-8-phosphooctulonate synthase [Pyramidobacter piscolens
           W5455]
          Length = 283

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 130/256 (50%), Positives = 177/256 (69%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           R  LIAGPC +ES +    +  K   +C+ L +  ++K+S+DKANR+S++  RG G++KG
Sbjct: 15  RLTLIAGPCALESLELGLEVGRKTQVLCEKLGLNYIFKASYDKANRTSISSPRGPGIEKG 74

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
            +    +K + G PILTD+H   Q   +A+  D+LQIPA LCRQTDLL AAA+TGR +NV
Sbjct: 75  LQWLAQIKAELGAPILTDIHEPWQAAPVAEVADVLQIPAFLCRQTDLLVAAAKTGRAVNV 134

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KK QFLS W+M ++L KL   G   V+ CERGT  GYN LV DMRS+ IM S+G PV+FD
Sbjct: 135 KKAQFLSAWDMKSVLGKLTEAGNDRVMLCERGTMMGYNQLVVDMRSLVIMRSLGAPVVFD 194

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ PG  G  SGG+R++ +PLA+AAV IG+  +FLE H  P+ A SDGPNM+ +  
Sbjct: 195 ATHSVQMPGGMGGSSGGDRRFALPLARAAVGIGVDALFLEVHPQPEKAMSDGPNMVPLDL 254

Query: 284 LPKLLSQLLAIDKIIK 299
           L   L Q+ AID++++
Sbjct: 255 LEGFLEQVRAIDRLVR 270


>gi|160871707|ref|ZP_02061839.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsiella grylli]
 gi|159120506|gb|EDP45844.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsiella grylli]
          Length = 277

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 172/258 (66%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q   LIAGPC +ES   A   A  L  I  SLNI  +YKSSFDKANRSS+   RG+GL 
Sbjct: 11  DQPLFLIAGPCVVESEQLAMDTAGSLKEITDSLNIPFIYKSSFDKANRSSVRSFRGLGLT 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++KK+ G  ILTDVH +     ++  VD+LQ PA LCRQT+ +   A+ G  +
Sbjct: 71  EGLRILDNVKKQLGVAILTDVHEDTPLNEVSHVVDVLQTPAFLCRQTNFIQKVAEQGLPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFLSPWEMH +++K        ++ CERG +FGYN L++DMRS+ IM     PVI
Sbjct: 131 NIKKGQFLSPWEMHYVVEKARQVSDALIMVCERGVTFGYNNLISDMRSLAIMRKTHCPVI 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG H   SGG+R++I  LA+AAVA GI+G+F+ETH  P+ A SDGPN   +
Sbjct: 191 FDATHSVQLPGSHAGVSGGQREFIPVLARAAVAAGISGLFMETHPKPEKALSDGPNSWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             + KLL  L A+DK +K
Sbjct: 251 NKMAKLLETLQALDKAVK 268


>gi|312144457|ref|YP_003995903.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halanaerobium sp.
           'sapolanicus']
 gi|311905108|gb|ADQ15549.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halanaerobium sp.
           'sapolanicus']
          Length = 282

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 178/266 (66%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQR-FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
           +++ F + ++ FVL+AGPC IE  +  F IAE +  I   L I  V+KSSFDKANRSS+ 
Sbjct: 9   DEIIFGDSKKPFVLLAGPCAIEEEERVFKIAEGIKEITSRLGIPYVFKSSFDKANRSSIE 68

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RG G+ KG  I + +K++   P+++D+H  +Q E  A+ +DI+QIPA L RQTD+L A
Sbjct: 69  SYRGPGIDKGLAILKRIKEELNLPVISDIHLPEQAEKAAEVLDIIQIPAFLSRQTDMLVA 128

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
           A  T R+INVKKGQFL+PW++  ++ K+ + G + +L  ERG SFGYN LV D RS+P M
Sbjct: 129 AGNTDRIINVKKGQFLAPWDIDQVVNKIESTGNEKILLTERGVSFGYNNLVVDFRSLPRM 188

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
              G PV+FD +HSVQ PG  G+ S GE++++  L +A +A G+  +F+E H +P  A S
Sbjct: 189 RKTGYPVVFDVTHSVQLPGGAGDSSDGEKEFVPYLMRAGLAAGVDSLFMEVHDNPAEAKS 248

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DG NMI +  L K+L Q LAID  +K
Sbjct: 249 DGANMIPLDKLEKILKQALAIDSAVK 274


>gi|291279429|ref|YP_003496264.1| 3-deoxy-8-phosphooctulonate synthase [Deferribacter desulfuricans
           SSM1]
 gi|290754131|dbj|BAI80508.1| 3-deoxy-8-phosphooctulonate synthase [Deferribacter desulfuricans
           SSM1]
          Length = 256

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 174/249 (69%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
           ++IAGPC  E+ + AF   E L  +C+      VYK+S+DKANRSS+   RG G++KG E
Sbjct: 2   LIIAGPCVYENDNIAFKTCEFLKKLCEKYGFEYVYKTSYDKANRSSVHSYRGPGIEKGVE 61

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
            F  LK+K+G  ILTD H+E++ + I D VDILQ+PA LCRQTD+L AAA++G+++NVKK
Sbjct: 62  FFIKLKEKFGVKILTDFHSEKEADIIKDYVDILQVPAFLCRQTDILKAAAKSGKIVNVKK 121

Query: 166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDAS 225
           GQF++PW+M N+++KL   GAK+++  ERG SFGYN LV D RS PIM      +IFD +
Sbjct: 122 GQFMAPWDMKNVVEKLTYFGAKEIMITERGYSFGYNNLVVDYRSFPIMKEFCDNIIFDVT 181

Query: 226 HSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLP 285
           HSVQ PG  G  S GER++   LA+AAVA G+ G+F+E H DPD+A  DG NM++ +   
Sbjct: 182 HSVQLPGGKGFASSGERRFAPYLARAAVACGVDGLFMEIHPDPDSALCDGANMLDFQMTE 241

Query: 286 KLLSQLLAI 294
           KL  ++  I
Sbjct: 242 KLFDEIKRI 250


>gi|85710299|ref|ZP_01041364.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erythrobacter sp. NAP1]
 gi|85689009|gb|EAQ29013.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erythrobacter sp. NAP1]
          Length = 313

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 176/259 (67%), Gaps = 6/259 (2%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LIAGPC IES DH+  +A++L  I + L + L++KSSFDKANR+S    RG G++ G  I
Sbjct: 40  LIAGPCVIESEDHSLSVADELAKIAERLGVLLIFKSSFDKANRTSGTSFRGPGMEDGLRI 99

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
              ++ + G P+LTDVH   Q   +A+ VD+LQ PA L RQTD + + A TG+ +N+KK 
Sbjct: 100 LEKVRAETGLPVLTDVHEPAQSTPVAEVVDVLQTPAFLARQTDFICSVAATGKPVNIKKA 159

Query: 167 QFLSPWEMHNILQKLHA------HGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           QF++P +M N++ K  +      H   + L CERGTSFGYNTLV+DMR + IM   G PV
Sbjct: 160 QFMAPADMQNVVAKARSAAESAGHRPDNFLLCERGTSFGYNTLVSDMRGLSIMAETGCPV 219

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQQPG  G+ SGG+ +Y+  LA+AAVA G++G+F+ETH DP NA SDGPN + 
Sbjct: 220 VFDATHSVQQPGGLGSKSGGQSEYVPLLARAAVAAGVSGVFMETHPDPANALSDGPNALP 279

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +     L+ QL  ID++ K
Sbjct: 280 LDRFEGLVRQLQRIDEVTK 298


>gi|289208645|ref|YP_003460711.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thioalkalivibrio sp.
           K90mix]
 gi|288944276|gb|ADC71975.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thioalkalivibrio sp.
           K90mix]
          Length = 280

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 170/248 (68%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAGPC IES   A   A  L AI   L I  +YKSSFDKANRSS    RG G++
Sbjct: 11  DRPFFLIAGPCVIESEAMALETAGALTAITDELGIPFIYKSSFDKANRSSTKSFRGPGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I   +K++ G P+LTDVH +   + +A  VD+LQ PA LCRQT+ +   A+ GR +
Sbjct: 71  EGLRILEQVKQQLGVPVLTDVHEDTPLDEVASVVDVLQTPAFLCRQTNFIQNVARQGRPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M N++ K    G + ++ CERG SFGYNTL++DMR +  M   G PV+
Sbjct: 131 NIKKGQFLAPWDMGNVVDKAREAGNEQIMVCERGVSFGYNTLISDMRGLAQMRQTGCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQQPG  G  SGG+R+Y+  LA+AAVA G++G+F+ETH DP+ A SDGPN   +
Sbjct: 191 FDATHSVQQPGGQGATSGGQREYVPVLARAAVASGVSGLFMETHPDPERALSDGPNAWPL 250

Query: 282 KDLPKLLS 289
             + +LL+
Sbjct: 251 PRMAELLT 258


>gi|320355399|ref|YP_004196738.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfobulbus
           propionicus DSM 2032]
 gi|320123901|gb|ADW19447.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfobulbus
           propionicus DSM 2032]
          Length = 283

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 135/262 (51%), Positives = 182/262 (69%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T       +L+AGPC +ES D A+ IA ++ AI   L +  V+K+SFDKANR+SL+  R
Sbjct: 15  ITIGPGAPLLLMAGPCVLESGDLAWEIAREMKAIAARLGVSYVFKASFDKANRTSLSSFR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G +KG  I   L+ + G P+++D+H   Q E  AD +DILQIPA LCRQTDLL AAA+
Sbjct: 75  GPGAEKGLRILGRLRAEVGVPVVSDIHEPGQAELAADCLDILQIPAFLCRQTDLLMAAAR 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+V+NVKKGQF+SPW+M + + KL   G + +L  ERG SFGYN LV DMRS+ +M + 
Sbjct: 135 TGKVVNVKKGQFVSPWDMEHAVNKLRGAGTEKILLTERGASFGYNNLVVDMRSLVVMRAF 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQ PG  G  SGG+R++I  LA+AA+A+GI G+FLE H  PD A  DGP
Sbjct: 195 GYPVVFDATHSVQLPGGAGGSSGGQREFIPALARAAMAVGIDGLFLEVHPQPDKALCDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKII 298
           N + +  +  LL QLLA+ + +
Sbjct: 255 NSLPLDQVEPLLKQLLAVRQAV 276


>gi|87302010|ref|ZP_01084844.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus sp. WH
           5701]
 gi|87283578|gb|EAQ75533.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus sp. WH
           5701]
          Length = 270

 Score =  272 bits (696), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 137/254 (53%), Positives = 185/254 (72%), Gaps = 4/254 (1%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F LIAGPC IES +  F +AE++ AI + L I  ++K+SFDKANRSS    RG G+  G 
Sbjct: 3   FTLIAGPCVIESPELVFQVAERMQAIAERLGITYIFKASFDKANRSSGGSFRGPGVSGGL 62

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ----TGRV 160
           E+ +++K+++G P+LTD+H  QQ   +A+ VD+LQIPA LCRQTDLL AAA+    T + 
Sbjct: 63  EVLKEVKQRFGLPVLTDIHESQQAAQVAEVVDVLQIPAFLCRQTDLLLAAAEAVRGTDKT 122

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           INVKKGQFL+PW+M  ++ KL   G +++   ERG+SFGYNTLV D RS+P + ++G PV
Sbjct: 123 INVKKGQFLAPWDMAQVVTKLREAGVENLWLTERGSSFGYNTLVVDFRSLPQLRALGCPV 182

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           IFDA+HSVQQPG  G+ SGG+R+++ PLA+AA A+GI G+F+E H DPD   SDGPNM+ 
Sbjct: 183 IFDATHSVQQPGGRGSSSGGQREFVAPLARAAAAVGIDGLFMEVHPDPDQGLSDGPNMVP 242

Query: 281 IKDLPKLLSQLLAI 294
           +  +   L QLLAI
Sbjct: 243 LHRVEPFLEQLLAI 256


>gi|149915388|ref|ZP_01903915.1| 3-deoxy-8-phosphooctulonate synthase [Roseobacter sp. AzwK-3b]
 gi|149810677|gb|EDM70518.1| 3-deoxy-8-phosphooctulonate synthase [Roseobacter sp. AzwK-3b]
          Length = 279

 Score =  272 bits (696), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 189/259 (72%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N+Q   LIAGPCQ+ES DHA MIA  + A C +  +  ++K SFDKANR+SL+G+RG+GL
Sbjct: 15  NDQPLTLIAGPCQLESADHAQMIAGTMQAACAAHGLQFIFKGSFDKANRTSLSGRRGLGL 74

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
           ++G ++ + +K   G P+LTD+H   QC  +A   D+LQIPA LCRQTDLL AA +TG  
Sbjct: 75  EEGLKVLQSVKDALGVPVLTDIHLPDQCAPVAQVADVLQIPAFLCRQTDLLIAAGETGAA 134

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           INVKKGQFL+PW+M N++ K+ + G   +L  ERGTSFGYNTLV DMR++P M + G PV
Sbjct: 135 INVKKGQFLAPWDMPNVISKIESTGNTRILLTERGTSFGYNTLVADMRALPQMAATGYPV 194

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           + DA+HSVQQPG  G  SGG+R++   +A+AAVA+G+A +F+ETH+ PD APSDGPNMI 
Sbjct: 195 VMDATHSVQQPGGQGGSSGGQREFAPVMARAAVALGVAAVFIETHEAPDTAPSDGPNMIP 254

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  +  LL  L A+D + K
Sbjct: 255 LAQMDGLLRVLKALDTVAK 273


>gi|87307745|ref|ZP_01089888.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Blastopirellula marina
           DSM 3645]
 gi|87289359|gb|EAQ81250.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Blastopirellula marina
           DSM 3645]
          Length = 275

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 133/269 (49%), Positives = 186/269 (69%), Gaps = 1/269 (0%)

Query: 31  GSGK-NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR 89
           G+ K N +T  + Q  +++AGPC IES D    IA +L  I  +L I LV+K+SFDKANR
Sbjct: 3   GTAKINNLTCGDGQPLLVVAGPCVIESLDLTLSIASRLKEIAANLPIQLVFKASFDKANR 62

Query: 90  SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTD 149
           +S    RGVG+ +G  +  +++++   P+ TD+H   Q   +A+  D+LQIPA L RQTD
Sbjct: 63  TSGGAFRGVGIDEGLRVLDEVRRQLELPVTTDIHESTQAAKVAEVCDLLQIPAFLARQTD 122

Query: 150 LLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRS 209
           LL AAA TG+ INVKKGQF++PW+M +++ KL   G  +V+  ERGT FGY  LV DMR+
Sbjct: 123 LLLAAANTGKAINVKKGQFMAPWDMKHVVAKLKEAGNPNVMLTERGTFFGYGRLVNDMRA 182

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           +  M+S+GVPVI+DA+HSVQ+PG  G  +GG R  + P+A+AA A+GI G+F ETH DPD
Sbjct: 183 LLEMSSLGVPVIYDATHSVQEPGGLGGATGGNRAMVPPMARAAAAVGIDGLFFETHPDPD 242

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKII 298
            +PSDGPNM+ +    KLL Q+LA+ + +
Sbjct: 243 KSPSDGPNMVPLDAAEKLLRQVLAVREAV 271


>gi|218885536|ref|YP_002434857.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio vulgaris
           str. 'Miyazaki F']
 gi|218756490|gb|ACL07389.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio vulgaris
           str. 'Miyazaki F']
          Length = 270

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 130/252 (51%), Positives = 173/252 (68%), Gaps = 1/252 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           +RF+  AGPC +ES + A   A  +    ++  +  V+KSS+DKANR+SL G RG GL +
Sbjct: 13  RRFIF-AGPCALESLELAMDTAHAVREAAEAAGLFAVFKSSWDKANRTSLDGFRGPGLAR 71

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G E    +K++ G P++TD+H   Q + +A+  D+LQIPA LCRQT LL AAAQTGRV+N
Sbjct: 72  GMEWLARIKQETGLPVVTDIHEPDQAKPVAEVADVLQIPAFLCRQTSLLLAAAQTGRVVN 131

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQF++PW+M   L KL + G + +L  ERG SFGYN LV D RS+PIM   GVPV+F
Sbjct: 132 VKKGQFVAPWDMAPALDKLRSTGNQRILLTERGASFGYNNLVVDFRSLPIMQGYGVPVVF 191

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGG+R+++  L++AAVA G+ G+FLETH DPD+A  DGPN   + 
Sbjct: 192 DATHSVQLPGGKGTSSGGDRRFVPMLSRAAVAAGVDGVFLETHPDPDHALCDGPNSWPLD 251

Query: 283 DLPKLLSQLLAI 294
            L  LL    A+
Sbjct: 252 RLAPLLRDFAAL 263


>gi|257454630|ref|ZP_05619886.1| 3-deoxy-8-phosphooctulonate synthase [Enhydrobacter aerosaccus
           SK60]
 gi|257447940|gb|EEV22927.1| 3-deoxy-8-phosphooctulonate synthase [Enhydrobacter aerosaccus
           SK60]
          Length = 287

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 173/265 (65%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T  N+Q FVL  G   +ES D AF IAE    IC+ LNIG V+K+SFDKANRSSL  
Sbjct: 15  NDITIGNDQPFVLFGGMNVLESKDLAFEIAESYIDICKRLNIGYVFKASFDKANRSSLYS 74

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG +   D+KK +  PI+TDVH   Q E +A   DI+Q+PA L RQTDL+ A 
Sbjct: 75  FRGPGLEKGIDWLSDIKKAFNVPIITDVHEPYQAEPVAAVADIIQLPAFLSRQTDLVAAM 134

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K    G   ++ CERG++FGYN LV DM     M 
Sbjct: 135 AKTGAIINVKKAQFLAPHEMKHIINKCLEAGNDKIILCERGSAFGYNNLVVDMLGFDTMK 194

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +HS+QQPG   + +GG R+ I  LA+A +A G+AG+FLE H +PD A  D
Sbjct: 195 KMQVPVFFDVTHSLQQPGARADSAGGRREQITTLARAGMATGLAGLFLEAHPNPDVAKCD 254

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP  + +  L   L+QL  +D ++K
Sbjct: 255 GPCALRLSQLEPFLAQLKQLDTLVK 279


>gi|117924856|ref|YP_865473.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Magnetococcus sp. MC-1]
 gi|158512334|sp|A0L7X4|KDSA_MAGSM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|117608612|gb|ABK44067.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Magnetococcus sp. MC-1]
          Length = 287

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 183/265 (69%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           + V F N     LIAGPC IE  + A   AE L  IC+ + + LVYKSSFDKANR+S   
Sbjct: 9   DTVRFGNHLPMTLIAGPCVIEGLEFALRTAEALKQICEGVGVELVYKSSFDKANRTSEGS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G++ G  I   ++++ G P++TDVH   QC A+A+ VD+LQ PA LCRQTD + AA
Sbjct: 69  FRGPGMEAGLRILERVRREVGVPVITDVHEADQCVAVAEVVDMLQTPAFLCRQTDFIQAA 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+ G+ +N+KKGQFL+P +M  +  K  A G +++L CERG SFGY  LV DMR + IM 
Sbjct: 129 ARPGKPVNIKKGQFLAPQDMARVAAKAAATGNENILLCERGFSFGYQNLVVDMRGLSIMA 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+E H DPD+AP D
Sbjct: 189 QSGYPVIFDATHSVQQPGALGGASGGDRRFVSDLARAAVAVGVAGVFMEVHPDPDHAPCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ +  L  LL QL A+D+I K
Sbjct: 249 GPNMLPMAHLSPLLDQLKALDRIRK 273


>gi|313895179|ref|ZP_07828736.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312976074|gb|EFR41532.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 275

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 177/270 (65%), Gaps = 5/270 (1%)

Query: 35  NQVTFSN-----EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR 89
           N+V  +N      +  VL+AGPC +E  D + MI   +  I   L I  V+K+SFDKANR
Sbjct: 2   NKVKLANFEIGGGEPLVLLAGPCVLEGLDRSLMIGRGIKEITDRLGIPYVFKASFDKANR 61

Query: 90  SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTD 149
           S+    RG GL +G ++ + +KK+ G P++TD+H   Q    A+ VDILQIPA L RQTD
Sbjct: 62  SAFHSFRGPGLIEGLKLLKTIKKELGVPVVTDIHETHQARPAAEVVDILQIPAFLSRQTD 121

Query: 150 LLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRS 209
           LL AAAQT  ++NVKKGQFLSP +M N++ K+H  G++ +L  ERG SFGYN LV DMRS
Sbjct: 122 LLHAAAQTNAIVNVKKGQFLSPNDMRNVVDKIHESGSEKILLTERGASFGYNNLVVDMRS 181

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
            PIM S G PVIFD +HSVQ PG  G  S G+R+++  L +AAV  G+ G+FLE H +P 
Sbjct: 182 FPIMRSFGYPVIFDGTHSVQLPGGAGTSSSGQREFVEYLVRAAVGAGVDGLFLEVHDNPP 241

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDG NM+ +  L  LL   LAI ++++
Sbjct: 242 EALSDGANMVYLDKLEDLLKDALAIYEVVR 271


>gi|121535897|ref|ZP_01667694.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thermosinus
           carboxydivorans Nor1]
 gi|121305516|gb|EAX46461.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thermosinus
           carboxydivorans Nor1]
          Length = 274

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 134/263 (50%), Positives = 177/263 (67%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +T   +    LIAGPC IE  +    I   +  I   L I  ++K+SFDKANRSS    R
Sbjct: 9   ITIGGKNPIALIAGPCVIEDAERTLAIGRAVKQIADRLGIPYIFKASFDKANRSSFKSFR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL +G  I  ++K+  G P+L+D+H   Q  A A  +DILQIPA LCRQTDL+  AAQ
Sbjct: 69  GPGLHEGLAILANIKQALGVPVLSDIHCTTQVTAAAKVLDILQIPAFLCRQTDLVYGAAQ 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGRVINVKKGQFL+P +M N++ K+   G +++L  ERG SFGYN LV DMR++PIM S+
Sbjct: 129 TGRVINVKKGQFLAPRDMKNVVDKIREAGNENILLTERGFSFGYNNLVVDMRALPIMRSL 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA A GI  +F+E H +P+ A SDGP
Sbjct: 189 GYPVVFDATHSVQLPGGAGTSSGGQREFVAHLARAATAAGIDALFMEVHDNPEEALSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ I  L  LL  +LAID +++
Sbjct: 249 NMLYIDQLEDLLKDVLAIDAVVR 271


>gi|270157221|ref|ZP_06185878.1| 3-deoxy-8-phosphooctulonate synthase [Legionella longbeachae
           D-4968]
 gi|289164381|ref|YP_003454519.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) [Legionella longbeachae NSW150]
 gi|269989246|gb|EEZ95500.1| 3-deoxy-8-phosphooctulonate synthase [Legionella longbeachae
           D-4968]
 gi|288857554|emb|CBJ11392.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) [Legionella longbeachae NSW150]
          Length = 277

 Score =  271 bits (694), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 128/253 (50%), Positives = 169/253 (66%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LIAGPC IES + A   A  L  IC  L I  +YKSSFDKANRSS++  RG G +KG  I
Sbjct: 16  LIAGPCVIESEELALETAGYLKEICSELQIPFIYKSSFDKANRSSISSYRGPGFEKGLSI 75

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
              +KK+   P+LTDVH +     ++  VD+LQ PA LCRQT+ +   A   + +N+KKG
Sbjct: 76  LEKVKKQVDVPVLTDVHEDTPLLEVSSVVDVLQTPAFLCRQTNFIQKVAAMNKPVNIKKG 135

Query: 167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASH 226
           QFL+PWEM +++ K  A G   ++ CERG SFGYN LV+DMRS+ IM   G PV++DA+H
Sbjct: 136 QFLAPWEMKHVIAKAKATGNDQIMACERGVSFGYNNLVSDMRSLAIMRETGCPVVYDATH 195

Query: 227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPK 286
           SVQ PG +   SGG+R+++  LA+AAVA GI+G+F+ETH DPD A SDGPN   +  +  
Sbjct: 196 SVQLPGGNNGASGGQREFVPILARAAVAAGISGLFMETHPDPDKALSDGPNSWPLAQMKP 255

Query: 287 LLSQLLAIDKIIK 299
           LL  L A+D + K
Sbjct: 256 LLESLKALDSVYK 268


>gi|85859053|ref|YP_461255.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Syntrophus
           aciditrophicus SB]
 gi|85722144|gb|ABC77087.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Syntrophus
           aciditrophicus SB]
          Length = 292

 Score =  271 bits (694), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 178/255 (69%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
            VLIAGPC IE  +    IA  L  +   ++I  ++K+S+DKANR+S    RG GL++G 
Sbjct: 31  LVLIAGPCVIEDEERTRDIALYLKKLTDEMDIPFIFKASYDKANRTSGKAYRGPGLERGI 90

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           EI + +K   G PIL+DVH+ ++ E  A+ +D++QIPA LCRQTDL+   A+  R +N+K
Sbjct: 91  EILKAIKGDLGIPILSDVHSREEIEKAAEILDVVQIPAFLCRQTDLVREVARLARAVNIK 150

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+PW++ NI++K+ + G + +L  ERGTSFGYN LV D RS+P++   G PVIFDA
Sbjct: 151 KGQFLAPWDVRNIIEKVLSEGNERILVTERGTSFGYNNLVVDFRSLPLLRREGYPVIFDA 210

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G  SGG+R+ +  L +AA A+GI G+FLE H DP+ A  DGPN + +  L
Sbjct: 211 THSVQLPGGQGTASGGQREMVPCLMRAAAAVGIDGLFLEVHPDPEKALCDGPNSLYLDAL 270

Query: 285 PKLLSQLLAIDKIIK 299
           P+LLS + +ID+++K
Sbjct: 271 PELLSTVKSIDRLVK 285


>gi|237748447|ref|ZP_04578927.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oxalobacter formigenes
           OXCC13]
 gi|229379809|gb|EEO29900.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oxalobacter formigenes
           OXCC13]
          Length = 284

 Score =  271 bits (693), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 185/264 (70%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAGPC IESH  A   A  L  +   L I  +YKSS+DKANRSS +  RG+G++
Sbjct: 11  DRPFFLIAGPCVIESHQMAIDTAGALKEMTSELGIPFIYKSSYDKANRSSSSSFRGLGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI  D++K++  P+LTDVHTE +   ++  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  KGLEILADVRKQFDVPVLTDVHTEVEVGPVSAVVDMLQTPAFLCRQTDFIQACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGA------KDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQF++P +M N+++K             +   CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFMAPDDMMNVVKKAKEAAKEAGVPEDNFTVCERGASFGYNNLVSDMRSLAIMRK 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  LA+AA+A+G+AG+F+ETH +P  A SDG
Sbjct: 191 TGCPVVFDATHSVQLPGGLGDASGGQREFVPVLARAAIAVGVAGLFMETHPNPACAMSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  + +LL+QL+ +DK+++
Sbjct: 251 PNAVPLHRMKELLAQLVTLDKVVR 274


>gi|288572978|ref|ZP_06391335.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288568719|gb|EFC90276.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 286

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 178/255 (69%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             +IAGPC +ES + +    +++  I + L +  ++K+S+DKANR+S+   RG GL+KG 
Sbjct: 17  LAVIAGPCSLESLELSMETGKRIKEISEELGLNYIFKASYDKANRTSIHSYRGPGLEKGL 76

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
               ++K+  G P++TD+H   Q   +A+  D+LQIPA LCRQTDLL AA++TG+ +NVK
Sbjct: 77  RWLSEIKETLGVPVITDIHEPWQAAPVAEVADVLQIPAFLCRQTDLLVAASKTGKPLNVK 136

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQF+SP++M  ++ K +  G   V+ CERGT+ GY  LV DMRS+PIM SMG PV+FDA
Sbjct: 137 KGQFMSPYDMKAVVSKCNEAGNDKVMLCERGTTMGYGQLVVDMRSLPIMRSMGCPVVFDA 196

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G+ SGG+R+++  L++AAV +GI  +FLE H +PD A SDGPNM+ +  L
Sbjct: 197 THSVQMPGGRGDTSGGDRRFVPALSRAAVGLGIDALFLEVHPNPDEALSDGPNMVPLDRL 256

Query: 285 PKLLSQLLAIDKIIK 299
             +L+ +  +D ++K
Sbjct: 257 KDILTGIKVLDDLVK 271


>gi|187251003|ref|YP_001875485.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Elusimicrobium minutum
           Pei191]
 gi|186971163|gb|ACC98148.1| 2-Dehydro-3-deoxyphosphooctonate aldolase [Elusimicrobium minutum
           Pei191]
          Length = 275

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 133/263 (50%), Positives = 174/263 (66%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  SN    V + G C IES  H    A+ +  I  + +   V K+SFDKANR+SL   R
Sbjct: 10  IKISNNHPLVFMGGTCIIESEKHYAQAAKDIKKIVNAYSKNYVLKASFDKANRTSLKAFR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+  G EI   +KK    P++ DVH   Q E +A+  DILQIPA LCRQTDLL A  +
Sbjct: 70  GPGINDGLEILAKVKKDLNVPVIVDVHEPWQAETVAEVADILQIPAFLCRQTDLLLACGE 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGRVINVKKGQFL+P  + NI++K+ + G K+++  ERG SFGY  LV DMRS+ IM + 
Sbjct: 130 TGRVINVKKGQFLAPGGVENIIKKIESTGNKNIMLTERGFSFGYGDLVVDMRSLAIMKTF 189

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVI DA+HSVQ+PG  GN +GG+ ++   LAKAA AIGIAGIF E H +P+ A SDGP
Sbjct: 190 GYPVILDATHSVQKPGGLGNATGGDSKFAPILAKAATAIGIAGIFFEAHPNPECALSDGP 249

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           N +  ++L K++SQ   IDK++K
Sbjct: 250 NSLRYEELKKMISQTTQIDKLVK 272


>gi|256827970|ref|YP_003156698.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfomicrobium
           baculatum DSM 4028]
 gi|256577146|gb|ACU88282.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfomicrobium
           baculatum DSM 4028]
          Length = 268

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 128/254 (50%), Positives = 173/254 (68%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           R  LIAGPC +ES D A  +A +L AI + LN+ L++KSS+DKANR++ A  RG GL  G
Sbjct: 11  RPFLIAGPCVLESLDLAMTVAVELQAIARDLNLPLIFKSSYDKANRTAGASFRGPGLDMG 70

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
            +    +K + G P++TD+H  +Q   +A+  D+LQIPA LCRQTDLL AAA+T R++N+
Sbjct: 71  LDWLAQIKSRTGLPVITDIHEPRQASLVAEVADVLQIPAFLCRQTDLLLAAARTERIVNI 130

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQF++PW+M   ++K+ + G   +   ERG+ FGYN LV D RS+ IM   G PV+FD
Sbjct: 131 KKGQFMAPWDMQGPVEKIRSEGFDRIWLTERGSMFGYNNLVVDFRSLIIMKQFGCPVVFD 190

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ PG  G  SGG+R+++ PLA+AAVA G  G+F+E H DPD A  DGPN   +  
Sbjct: 191 ATHSVQLPGGRGMSSGGQREFVPPLARAAVACGCQGLFMEIHPDPDKALCDGPNSWPLAK 250

Query: 284 LPKLLSQLLAIDKI 297
              LLS+L AI  I
Sbjct: 251 ARTLLSELAAIWSI 264


>gi|319790164|ref|YP_004151797.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thermovibrio
           ammonificans HB-1]
 gi|317114666|gb|ADU97156.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thermovibrio
           ammonificans HB-1]
          Length = 269

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 178/258 (68%), Gaps = 3/258 (1%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSL--NIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           ++IAGPC IE     F +A  +  + QSL      ++K+SFDKANRSSL   RG GL++G
Sbjct: 2   IVIAGPCVIEDKGTVFEVARAVKEL-QSLYPEHTFIFKASFDKANRSSLDSFRGPGLERG 60

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
            E+ +++K++ G P+ TD+H   Q E +A+  D++QIPA LCRQTDLL AAA TG+ +N+
Sbjct: 61  LEVLKEVKEELGLPVTTDIHEPWQAEKVAEVADVIQIPAFLCRQTDLLVAAAGTGKTVNI 120

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQF++PW+M N ++K+   G ++V   ERGT+FGYN LV D RSIP+M      V+FD
Sbjct: 121 KKGQFMAPWDMENAVEKVRRSGGREVWVTERGTTFGYNNLVVDFRSIPVMEEFADKVVFD 180

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ+PG  G  SGG+R+++  LA+AAVA+G  G+F ETH +PD A SDGPNM+ +  
Sbjct: 181 ATHSVQRPGGLGRASGGDRRFVPYLARAAVAVGADGLFFETHPNPDKALSDGPNMVPLNG 240

Query: 284 LPKLLSQLLAIDKIIKPL 301
             +L+ +L+ +   +  L
Sbjct: 241 FRELIGKLIKLKSCVGEL 258


>gi|304437446|ref|ZP_07397405.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas sp. oral taxon
           149 str. 67H29BP]
 gi|304369702|gb|EFM23368.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas sp. oral taxon
           149 str. 67H29BP]
          Length = 277

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 178/270 (65%), Gaps = 5/270 (1%)

Query: 35  NQVTFSN-----EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR 89
           N+V  +N      +  VL+AGPC +E  + + MI   +  I   L I  V+K+SFDKANR
Sbjct: 4   NKVKLANFEIGGGEPLVLLAGPCVLEGLERSLMIGRGIKEITDRLGIPYVFKASFDKANR 63

Query: 90  SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTD 149
           S+    RG GL  G ++   +KK+ G P++TD+H   Q E  A  VDILQIPA L RQTD
Sbjct: 64  SAYHSFRGPGLTDGLKMLGQIKKELGVPVVTDIHESCQAEPAAKVVDILQIPAFLSRQTD 123

Query: 150 LLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRS 209
           LL AAAQTG V+NVKKGQFL+P +M N++ K+H  G++ +L  ERG SFGYN LV DMR+
Sbjct: 124 LLHAAAQTGAVVNVKKGQFLAPNDMRNVVDKIHESGSERILLTERGASFGYNNLVVDMRA 183

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           +PIM S G PVIFD +HSVQ PG  G  S G+R+++  L +AAV  G+ G+FLE H +P 
Sbjct: 184 LPIMRSFGYPVIFDGTHSVQLPGGAGTSSSGQREFVEYLVRAAVGAGVDGLFLEVHDNPA 243

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDG NM+ +  L +LL   LAI ++++
Sbjct: 244 EALSDGANMVYLDKLEELLKDALAIYEVVR 273


>gi|307825181|ref|ZP_07655401.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacter
           tundripaludum SV96]
 gi|307733637|gb|EFO04494.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacter
           tundripaludum SV96]
          Length = 277

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 128/258 (49%), Positives = 172/258 (66%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAGPC IES   A   A  L  +   LNI  +YKSSFDKANRSS    RG G++
Sbjct: 11  DQPFFLIAGPCVIESEQMALDTAGYLKELTTQLNIPFIYKSSFDKANRSSHESYRGPGVE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G +I   +K++ G P+LTDVH +     +A  VD++Q PA LCRQT+ +   A  G  +
Sbjct: 71  EGLKILEKVKQQIGVPVLTDVHEDTPLAEVASVVDVMQTPAFLCRQTNFIQQVASQGIPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M ++  K  A G + ++ CERG SFGYN LV+DMRS+ +M     PV+
Sbjct: 131 NIKKGQFLAPWDMVHVANKAKATGNQQIMVCERGVSFGYNNLVSDMRSLAVMRDTDCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GIAG+F+ETH +P  A SDGPN   +
Sbjct: 191 FDATHSVQLPGGQGTVSGGQREFVPVLARAAVAVGIAGLFMETHPNPAEAKSDGPNSWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             + +LL  LL ID  +K
Sbjct: 251 HRMKELLEVLLTIDSAVK 268


>gi|168701695|ref|ZP_02733972.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gemmata obscuriglobus
           UQM 2246]
          Length = 282

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 167/250 (66%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
            + I GPC IESHD    IAE L +    L + LV+K+SFDKANRSS    RG GL++G 
Sbjct: 20  LLWICGPCVIESHDLTLRIAETLKSYADRLGLQLVFKASFDKANRSSGKSFRGPGLQEGL 79

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           +    +K   G P+ TD+H   Q    A+  DILQ+PA L RQTDLL A  +TGRV+NVK
Sbjct: 80  KTLAAVKDATGLPVTTDIHECAQAATAAEVCDILQVPAFLARQTDLLEACGRTGRVVNVK 139

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQF++PW+M N++ KL   G  +VL  ERGT+FGY  LV DMRS+P M   G PVIFD 
Sbjct: 140 KGQFMAPWDMKNVVAKLSEFGTGNVLLTERGTTFGYGMLVNDMRSVPWMQETGAPVIFDG 199

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ+PG  G+ +GG+R  +  + +AAVA G  G+FLETH  PD A SDGPNMI +  L
Sbjct: 200 THSVQKPGALGDRTGGDRAMVPVVTRAAVAAGCDGVFLETHPRPDEAKSDGPNMIPLDVL 259

Query: 285 PKLLSQLLAI 294
           P+++++ + I
Sbjct: 260 PRVIAECVRI 269


>gi|222110128|ref|YP_002552392.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidovorax ebreus TPSY]
 gi|254807739|sp|B9MEQ6|KDSA_ACIET RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|221729572|gb|ACM32392.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidovorax ebreus TPSY]
          Length = 285

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 132/265 (49%), Positives = 174/265 (65%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +QRF LIAG C IE  + +  +A +L   C  L I L+YK SFDKANRSS   KRGVGL 
Sbjct: 11  DQRFFLIAGTCSIEGLEMSLDVAGQLKEACAPLGIPLIYKGSFDKANRSSGTSKRGVGLD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +I  +++++   PILTDVH       +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  AGLKILDEVRRQLQLPILTDVHDTSHVAEVASVVDVLQTPAFLCRQTDFIRAVAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+PW+M N++ K  A  A++V       L CERG SFGYN LV DM S+  M 
Sbjct: 131 NIKKGQFLAPWDMKNVIDKARA-AAREVGLSEDRFLACERGVSFGYNNLVADMTSLAEMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PV+FD +HSVQ+PG  G  SGG R  +  LA+A VA+G+AG+F+ETH  P  A SD
Sbjct: 190 NSGAPVVFDVTHSVQKPGGLGAVSGGARDMVPVLARAGVAVGVAGLFMETHPKPAEAWSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +K +  LL  L+A+D + K
Sbjct: 250 GPNAVPLKHMRALLETLVALDDVTK 274


>gi|288818730|ref|YP_003433078.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hydrogenobacter
           thermophilus TK-6]
 gi|288788130|dbj|BAI69877.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hydrogenobacter
           thermophilus TK-6]
 gi|308752317|gb|ADO45800.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hydrogenobacter
           thermophilus TK-6]
          Length = 260

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 175/247 (70%), Gaps = 2/247 (0%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           ++IAGPC IE+    F +A++L  + +       V+KSSFDKANRSS+   RG GL+KG 
Sbjct: 2   IIIAGPCVIENEKVVFQVAQELKRLSELYPEFSFVFKSSFDKANRSSVKSFRGPGLEKGL 61

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           EI   +K+++G  I TDVH   Q E ++  VDI+QIPA L RQTDLL A+A+TG+ +NVK
Sbjct: 62  EILSKVKEEFGLKITTDVHETWQVEPVSQVVDIIQIPAFLSRQTDLLVASAKTGKPVNVK 121

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+PW++ N+++KL   GAK+    ERG SFGYN LV D RS+ IM+S    VIFDA
Sbjct: 122 KGQFLAPWDVKNVVEKLMYAGAKEYYITERGVSFGYNNLVVDFRSLVIMSSF-TKVIFDA 180

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G+ S G+R++++PL +AAVA+G  GIF+ETH DPD+A SDGPNM+ +  L
Sbjct: 181 THSVQLPGGAGDKSSGQREFVLPLIRAAVAVGCDGIFMETHPDPDSALSDGPNMLPLNSL 240

Query: 285 PKLLSQL 291
             +L  +
Sbjct: 241 ESVLETI 247


>gi|121593417|ref|YP_985313.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidovorax sp. JS42]
 gi|158513898|sp|A1W4R2|KDSA_ACISJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|120605497|gb|ABM41237.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidovorax sp. JS42]
          Length = 285

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 132/265 (49%), Positives = 174/265 (65%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +QRF LIAG C IE  + +  +A +L   C  L I L+YK SFDKANRSS   KRGVGL 
Sbjct: 11  DQRFFLIAGTCSIEGLEMSLDVAGQLKEACAPLGIPLIYKGSFDKANRSSGTSKRGVGLD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +I  +++++   PILTDVH       +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  AGLKILDEVRRQLQLPILTDVHDTSHVAEVASVVDVLQTPAFLCRQTDFIRAVAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+PW+M N++ K  A  A++V       L CERG SFGYN LV DM S+  M 
Sbjct: 131 NIKKGQFLAPWDMKNVIDKARA-AAREVGLSEDRFLACERGVSFGYNNLVADMTSLAEMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PV+FD +HSVQ+PG  G  SGG R  +  LA+A VA+G+AG+F+ETH  P  A SD
Sbjct: 190 NSGAPVVFDVTHSVQKPGGLGAVSGGARDMVPVLARAGVAVGVAGLFMETHPKPAEAWSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +K +  LL  L+A+D + K
Sbjct: 250 GPNAVPLKHMRALLETLVALDDVTK 274


>gi|254430206|ref|ZP_05043909.1| 3-deoxy-8-phosphooctulonate synthase [Cyanobium sp. PCC 7001]
 gi|197624659|gb|EDY37218.1| 3-deoxy-8-phosphooctulonate synthase [Cyanobium sp. PCC 7001]
          Length = 273

 Score =  269 bits (687), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 133/263 (50%), Positives = 182/263 (69%), Gaps = 8/263 (3%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F LIAGPC IES D    +AE++  +CQ L I  V+K+SFDKANRSS    RG G ++G 
Sbjct: 3   FRLIAGPCVIESRDLVLQVAEQVSGLCQELGITYVFKASFDKANRSSGKSFRGPGPEEGL 62

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ----TGRV 160
            I ++++++ G P+LTD+H   Q    A++VD+LQIPA LCRQTDLL AAA+    T +V
Sbjct: 63  RILQEVREQLGIPVLTDIHESHQAAMAAEAVDVLQIPAFLCRQTDLLEAAARAVAGTDKV 122

Query: 161 INVKKGQFLSPWEMHNILQKLHAHG----AKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           +NVKKGQFL+PW+M  ++ KL   G    +  +   ERG+SFGYNTLV D R +P M ++
Sbjct: 123 VNVKKGQFLAPWDMAQVVNKLRESGLEAESGRLWLTERGSSFGYNTLVVDFRGLPQMQAL 182

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVIFDA+H+VQQPG  G  SGG+R+++ PLA+ AVA+G  G+F+E H DP  A SDGP
Sbjct: 183 GCPVIFDATHAVQQPGGQGTTSGGQREFVAPLARGAVAVGADGLFMEVHPDPPQALSDGP 242

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +  L  LL QL+ +  +++
Sbjct: 243 NMVPLHRLEALLRQLMELRAVVQ 265


>gi|148653465|ref|YP_001280558.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychrobacter sp.
           PRwf-1]
 gi|148572549|gb|ABQ94608.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychrobacter sp.
           PRwf-1]
          Length = 286

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 172/265 (64%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T  N+Q FVL  G   +ES + AF IAE    IC  L IG V+K+SFDKANRSSL  
Sbjct: 14  NDMTIGNDQPFVLFGGMNVLESKELAFEIAEGYIDICNRLGIGYVFKASFDKANRSSLNS 73

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG +    +K+KY  PI+TDVH   Q E +A+  D++Q+PA L RQTDL+ A 
Sbjct: 74  YRGPGLEKGVDWLSQIKEKYNVPIITDVHEPYQAEPVAEVADVIQLPAFLSRQTDLVQAM 133

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +IN+KK QFL+P EM +I+ K    G   ++ CERGT+FGYN LV DM     M 
Sbjct: 134 AKTGAIINIKKAQFLAPHEMRHIINKCLEAGNDKIILCERGTAFGYNNLVVDMLGFDTMK 193

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +HS+QQPG   + +GG R+ I  LA+A +A G+AG+FLE H +P+ A  D
Sbjct: 194 QMDVPVFFDVTHSLQQPGARSDSAGGRREQITTLARAGMATGLAGLFLEAHPEPEVAKCD 253

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP  + +  L   LSQL  ID ++K
Sbjct: 254 GPCALRMSQLEAFLSQLKQIDDLVK 278


>gi|304321399|ref|YP_003855042.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Parvularcula bermudensis
           HTCC2503]
 gi|303300301|gb|ADM09900.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Parvularcula bermudensis
           HTCC2503]
          Length = 296

 Score =  268 bits (685), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 145/266 (54%), Positives = 185/266 (69%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             V   N    +L AGPC +ES  HA  +A  +  I   L IG VYKSSFDKANR+SL+ 
Sbjct: 17  GDVRVGNHLPLMLFAGPCAMESRAHALEVAGAIKEITDRLGIGFVYKSSFDKANRTSLSA 76

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           +RG+G+ +   IF ++K++ G P+LTD+H   QC  +A+ VD+LQIPA LCRQTDLL AA
Sbjct: 77  RRGIGMAEALPIFAEVKERLGVPVLTDIHERAQCAPVAEVVDVLQIPAFLCRQTDLLVAA 136

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TGRVI VKKGQFL+PW+M N++ K+   G   VL  ERG SFGYNTLVTD R +  M 
Sbjct: 137 AETGRVIKVKKGQFLAPWDMTNVVAKITGSGNSRVLVTERGASFGYNTLVTDFRGLKTMA 196

Query: 215 -SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
              G P+IFDA+HSVQQPG  G  SGG+R+ +  LA+AA A+G+AG+F ETH DPD+APS
Sbjct: 197 EETGAPIIFDATHSVQQPGGQGGSSGGQREMVPTLARAAAAVGVAGLFAETHPDPDSAPS 256

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGPNMI +  L   L +L  +D+I K
Sbjct: 257 DGPNMIPLSRLEIFLRELQDLDRIAK 282


>gi|87198750|ref|YP_496007.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134431|gb|ABD25173.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 283

 Score =  268 bits (684), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 174/261 (66%), Gaps = 6/261 (2%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
             +R  LI+GPC IE  D    +AE L  +   L+I +V+K+SFDKANR+S A  RG GL
Sbjct: 10  RRRRPFLISGPCVIEGLDLCLGMAEALARLADKLDIAIVFKASFDKANRTSAASFRGPGL 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
           ++G  I   +K++ G P+LTDVH    C  +A+ VD LQ PA L RQTDL+ AAA TGR 
Sbjct: 70  ERGLRILESVKRESGLPVLTDVHEAGHCAEVAEVVDFLQTPAFLARQTDLIEAAAATGRP 129

Query: 161 INVKKGQFLSPWEMHNILQKLH------AHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           +N+KK QF++P +M  ++ K         HGA  +  CERGT+FGY  LV DMRS+  + 
Sbjct: 130 VNLKKAQFMAPADMLAVVDKARMASQRAGHGAGSLAVCERGTAFGYGNLVVDMRSLDELR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PVIFDA+HSVQ PG  G+CSGG+R+++  LA+AAVA+G+ G+FLE H DPD A SD
Sbjct: 190 ATGCPVIFDATHSVQLPGALGSCSGGQRRHVPTLARAAVAVGVDGLFLECHPDPDRALSD 249

Query: 275 GPNMINIKDLPKLLSQLLAID 295
           GPN + + D+  L+  L+ ID
Sbjct: 250 GPNSLALADVGPLMRVLVEID 270


>gi|145589129|ref|YP_001155726.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047535|gb|ABP34162.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 287

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 181/263 (68%), Gaps = 5/263 (1%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           + RF LIAGPC IES   A  IA +L  I  +L I  +YKSSFDKANRSS    RG+G++
Sbjct: 14  DHRFFLIAGPCVIESEQSAIDIAGELKEITSALKIPFIYKSSFDKANRSSGTSFRGLGME 73

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +KK+ G P+LTDVH   +  A+A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 74  KGLEILAKVKKEVGVPVLTDVHDIGEIAAVAKVVDVLQTPAFLCRQTDFIRACAQSGKPV 133

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAK-----DVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           N KKGQFLSP EM N+++K     A+       + CERG SFGYN LV+DMRS+ I+   
Sbjct: 134 NFKKGQFLSPHEMLNVIEKARGAAAEMGLSDQFMVCERGASFGYNNLVSDMRSLAILRES 193

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV+FDA+HSVQ PG  GN SGG+R+++  LA+AAVA+GI+G+F+ETH DP  A SDGP
Sbjct: 194 KAPVVFDATHSVQLPGGQGNSSGGQREFVPVLARAAVAVGISGLFMETHPDPAKALSDGP 253

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           N + +  + +LL  L+ ID ++K
Sbjct: 254 NAVPLNRMKELLQSLVDIDSVVK 276


>gi|257094878|ref|YP_003168519.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257047402|gb|ACV36590.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 278

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 181/260 (69%), Gaps = 2/260 (0%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q   LIAGPC  ES D    +A +++ IC  L +  ++K+S+DKANRSS    RG GL 
Sbjct: 11  DQPLFLIAGPCTAESLDLCLEVAGQMHEICSRLGLPYIFKASYDKANRSSGRSPRGPGLD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +I  +++++ G P+LTDVH EQ   A+A  VD+LQ PA LCRQTD + A A +G+ +
Sbjct: 71  AGLQILAEVRRQIGVPVLTDVHREQDIAAVASVVDVLQTPAFLCRQTDFIEAVAASGKPV 130

Query: 162 NVKKGQFLSPWEMHNIL--QKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
           N+KKGQFL+P +M N++   +  A GA+ ++ CERG SFGYN LV+DMRS+ IM     P
Sbjct: 131 NIKKGQFLAPGDMRNVVAKAREAAAGAESIMVCERGASFGYNNLVSDMRSLAIMRETACP 190

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           V+FDA+HSVQ PG  G+ SGG+R+++  LA+AAVA+GIAG+F+ETH  P+ A SDGPN  
Sbjct: 191 VVFDATHSVQLPGGLGSASGGQREFVPVLARAAVAVGIAGLFMETHPRPETALSDGPNSW 250

Query: 280 NIKDLPKLLSQLLAIDKIIK 299
            +  +  LL+ L+A+D+ +K
Sbjct: 251 PLARMEGLLTTLVALDRAVK 270


>gi|153875642|ref|ZP_02003353.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Beggiatoa sp. PS]
 gi|152067894|gb|EDN66647.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Beggiatoa sp. PS]
          Length = 283

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 175/258 (67%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAGPC IES   A   A +L  I   L I  +YKSSFDKANRSS    R +G++
Sbjct: 11  DKPFFLIAGPCVIESEQLALETAFQLKTITDELAIPFIYKSSFDKANRSSYHSFRSLGIE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I   ++ +   P+LTDVH +   + +A  VD+LQ PA LCRQT+ +   A+ G  +
Sbjct: 71  EGLRILETVRTQIEVPVLTDVHEDTPLQEVASVVDVLQTPAFLCRQTNFIQNVARQGLPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M ++++K  A G K ++ CERG SFGYN LV+DMRS+ +M + G PVI
Sbjct: 131 NIKKGQFLAPWDMTHVVEKARAVGNKKIMVCERGVSFGYNNLVSDMRSLAVMRNTGCPVI 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG  G+ SGG+R+++  LA+AA+A+GI+GIF+ETH  PD A SDG N   +
Sbjct: 191 FDATHSVQLPGGQGHASGGQREFVPVLARAAIAVGISGIFMETHPQPDKALSDGLNAWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
           + +  LL  L AID  +K
Sbjct: 251 EQMFPLLETLKAIDDTVK 268


>gi|94986895|ref|YP_594828.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731144|emb|CAJ54506.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Lawsonia intracellularis PHE/MN1-00]
          Length = 268

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 173/259 (66%), Gaps = 12/259 (4%)

Query: 47  LIAGPCQIESHD----HAFMIAEKLYAICQSLNIGL--VYKSSFDKANRSSLAGKRGVGL 100
           + AGPC +ES +     A +IAE      Q+ N GL  V+KSS+DKANR+S +  RG   
Sbjct: 16  IFAGPCVLESKELACNSATIIAE------QACNTGLLAVFKSSWDKANRTSNSSFRGPTF 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
           K+G E    +KK+ G PI+TD+H  +Q   +A+  DI+QIPA LCRQTDLL  AA T  +
Sbjct: 70  KEGMEWLYSVKKETGLPIVTDIHLPEQAALVAEVADIIQIPAFLCRQTDLLKEAAYTDCI 129

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           INVKKGQFL+PW+M  +  K+ A G K +LF ERGT+FGYN LV D RSIPIM  +GVPV
Sbjct: 130 INVKKGQFLAPWDMKAVRDKIFATGNKKLLFTERGTTFGYNNLVVDFRSIPIMKELGVPV 189

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           IFDA+HSVQ PG  G  S G+RQY+  LA AA A G+ GIFLE H +PD A  DGPN   
Sbjct: 190 IFDATHSVQLPGGKGESSDGQRQYVSTLAYAAAATGVNGIFLECHPNPDKALCDGPNSWP 249

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  L  LL+QL AI  ++K
Sbjct: 250 LNQLGTLLAQLSAIWSVVK 268


>gi|118595042|ref|ZP_01552389.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylophilales
           bacterium HTCC2181]
 gi|118440820|gb|EAV47447.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylophilales
           bacterium HTCC2181]
          Length = 275

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 128/255 (50%), Positives = 177/255 (69%), Gaps = 2/255 (0%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LIAGPC IES      +A +L  +   L I  ++KSSFDKANRSS    RG G+++G  I
Sbjct: 16  LIAGPCVIESESMTIDVAGQLKEMTDQLGIPFIFKSSFDKANRSSNKTFRGFGVEEGLRI 75

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
            +++K + G P+LTD+HT +Q E +A  VD+LQ PA LCRQTD ++A A++G+ +N+KKG
Sbjct: 76  LQEVKSQIGVPVLTDIHTAEQVEEVASVVDVLQTPAFLCRQTDFISAVAKSGKPVNIKKG 135

Query: 167 QFLSPWEMHNILQKL-HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           QFL+P +M  ++ K   A+G  D ++ CERG SFGYNTLV+DMRS+ IM     PV+FDA
Sbjct: 136 QFLAPQDMRQVVNKAKEANGGIDNIMVCERGVSFGYNTLVSDMRSLAIMRDTDCPVVFDA 195

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQQPG  G+ SGG+ +++  LA+AAV+ GIAGIF+ETH +P  A SDGPN + +  +
Sbjct: 196 THSVQQPGGQGDRSGGQSEFVPLLARAAVSSGIAGIFMETHPNPSEALSDGPNAVPLNQM 255

Query: 285 PKLLSQLLAIDKIIK 299
             LL  L  +D  +K
Sbjct: 256 QALLEVLKELDHTVK 270


>gi|332971360|gb|EGK10319.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychrobacter sp.
           1501(2011)]
          Length = 286

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 173/265 (65%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T +N++ FVL  G   +ES + AF IAE    IC  L IG V+K+SFDKANRSSL  
Sbjct: 14  NDMTIANDKPFVLFGGMNVLESKELAFEIAEGYIDICNRLGIGYVFKASFDKANRSSLNS 73

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG +    +K+KY  PI+TDVH   Q + +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 74  YRGPGLEKGVDWLGQIKEKYNVPIITDVHEPYQAQPVAEVADIIQLPAFLSRQTDLVQAM 133

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +IN+KK QFL+P EM +I+ K    G   ++ CERGTSFGYN LV DM     M 
Sbjct: 134 AKTGAIINIKKAQFLAPHEMRHIINKCLEAGNDKIILCERGTSFGYNNLVVDMLGFDTMK 193

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +HS+QQPG   + +GG R+ I  LA+A +A G+AG+FLE H +P+ A  D
Sbjct: 194 QMDVPVFFDVTHSLQQPGARSDSAGGRREQITTLARAGMATGLAGLFLEAHPEPEVAKCD 253

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP  + +  L   LSQL  ID ++K
Sbjct: 254 GPCALRMSQLEPFLSQLKQIDDLVK 278


>gi|297621768|ref|YP_003709905.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Waddlia chondrophila WSU
           86-1044]
 gi|297377069|gb|ADI38899.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Waddlia chondrophila WSU
           86-1044]
          Length = 257

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 171/240 (71%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           +++GPC IES +H    AE+L  +     I  ++KSS+DKANRSS+   RG GL++G  I
Sbjct: 3   VMSGPCVIESEEHCLKAAEELKKMFSGRPINFIFKSSYDKANRSSIHSFRGPGLEEGLRI 62

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
              +KK+   P++TDVH+ +Q  A  + VD++QIPA LCRQTDLL AAA+TG+V++VKKG
Sbjct: 63  LEKVKKELDLPVVTDVHSPEQATAAGEVVDMIQIPAFLCRQTDLLVAAAKTGKVVSVKKG 122

Query: 167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASH 226
           QFL+PW+M N+++K+   G   V+  +RGTSFGYN LV+D R+IPIM  +GVPV FDA+H
Sbjct: 123 QFLAPWDMRNVIEKIKESGNDRVIAVDRGTSFGYNNLVSDFRAIPIMQELGVPVCFDATH 182

Query: 227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPK 286
           SVQ PG  G+ SGG+R++I  LA+AAVA+G   +F+E H DPD A SD  +++     PK
Sbjct: 183 SVQLPGGMGDKSGGQREFIPYLARAAVAVGADCLFMEAHPDPDQAKSDAASVLRFDAFPK 242


>gi|329903712|ref|ZP_08273588.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548233|gb|EGF32932.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 284

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 186/264 (70%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAGPC IES   AF  A +L  I  +L I  +YKSSFDKANRSS    RG+G+ 
Sbjct: 11  DQPFFLIAGPCVIESRQMAFDTAGQLKEITAALGIPFIYKSSFDKANRSSGTSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI  D+K++ G P+LTD+H  ++ + ++  VD+LQ PA LCRQTD + A AQ+GR +
Sbjct: 71  KGLEILADVKRELGVPVLTDIHAIEEIKPVSAVVDVLQTPAFLCRQTDFIHACAQSGRPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAK------DVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K  A   +      + + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMVNVINKARAAAKEAGLAEDNFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G P++FDA+HSVQ PG  G+ SGG+R+++  LA+AAVA+GI+G+F+ETH +P  A SDG
Sbjct: 191 TGCPIVFDATHSVQLPGGQGSSSGGQREFVPVLARAAVAVGISGLFMETHPNPAEAMSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  + +LLS L+ +D+++K
Sbjct: 251 PNAVPLGRMRELLSTLIELDRVVK 274


>gi|167625118|ref|YP_001675412.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella halifaxensis
           HAW-EB4]
 gi|189028417|sp|B0TR22|KDSA_SHEHH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|167355140|gb|ABZ77753.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella halifaxensis
           HAW-EB4]
          Length = 282

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 183/276 (66%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I LGS    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKIISLGS----IEIANDKPFVLFGGMNVLESRDLAMQIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF ++K  +  P++TDVH  QQC  +A+ VD++Q+PA 
Sbjct: 58  FDKANRSSVNSYRGPGMEEGLKIFEEIKSTFNLPLITDVHEVQQCAPVAEVVDVIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN L
Sbjct: 118 LARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIMLCERGSSFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQTGYPVIFDATHALQRPGGRSDSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L+Q+ A+D ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLHQLENYLTQMKAVDDLVK 273


>gi|126172951|ref|YP_001049100.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS155]
 gi|160876835|ref|YP_001556151.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS195]
 gi|217974694|ref|YP_002359445.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS223]
 gi|304410650|ref|ZP_07392268.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS183]
 gi|307304747|ref|ZP_07584497.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           BA175]
 gi|166220458|sp|A3D0G8|KDSA_SHEB5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|189028416|sp|A9L2C8|KDSA_SHEB9 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|254807751|sp|B8E809|KDSA_SHEB2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|125996156|gb|ABN60231.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS155]
 gi|160862357|gb|ABX50891.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS195]
 gi|217499829|gb|ACK48022.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS223]
 gi|304351134|gb|EFM15534.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS183]
 gi|306912149|gb|EFN42573.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           BA175]
 gi|315269038|gb|ADT95891.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS678]
          Length = 282

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/276 (46%), Positives = 183/276 (66%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I+LGS    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKIINLGS----IEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF ++KK +  P++TDVH   QC  +A+ VDI+Q+PA 
Sbjct: 58  FDKANRSSINSYRGPGMEEGLKIFEEIKKTFNLPLITDVHEVHQCAPVAEVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN L
Sbjct: 118 LARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSSFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L Q+ AID ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLHQLENYLKQMKAIDDLVK 273


>gi|269792891|ref|YP_003317795.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100526|gb|ACZ19513.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 283

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 181/261 (69%), Gaps = 1/261 (0%)

Query: 30  LGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR 89
           +G  ++ V+F    R  +IAGPC +E  DHA MI E    +C+ L +G V+K SFDKANR
Sbjct: 2   IGFEESGVSF-GAGRLAVIAGPCALEGLDHALMIGEACLRVCEDLGVGYVFKGSFDKANR 60

Query: 90  SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTD 149
           +S    RG G+++G  I  ++ ++ G P+LTDVH   Q  A+A++V ILQIPA LCRQTD
Sbjct: 61  TSKDSFRGPGMEEGLRILSEVHRRLGVPVLTDVHETHQVGAVAEAVQILQIPAFLCRQTD 120

Query: 150 LLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRS 209
           L+ AAA TGRV+NVKK QFL+P +M +++ K  + G + VL CERG+ FGY  LV D RS
Sbjct: 121 LVLAAAATGRVLNVKKAQFLAPEDMASVVDKCRSVGNRRVLLCERGSVFGYRQLVVDFRS 180

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
            PIM  +G PV+FDA+HSVQ  G  G  SGG+R+++ PL + A ++G+  +FLE HQDPD
Sbjct: 181 FPIMRGLGCPVVFDATHSVQSMGGLGGRSGGDRRFVRPLLRCAASLGVDALFLEVHQDPD 240

Query: 270 NAPSDGPNMINIKDLPKLLSQ 290
           +APSDGPNM+ ++   +LL +
Sbjct: 241 SAPSDGPNMVPLRLFRRLLEE 261


>gi|326567781|gb|EGE17887.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           BC1]
          Length = 287

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 171/263 (65%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +   N++ FVL  G   +ES + AF IAE+   ICQ LNIG V+K+SFDKANRSSL   R
Sbjct: 17  IEIGNDKPFVLFGGMNVLESRELAFEIAEQYINICQRLNIGYVFKASFDKANRSSLHSFR 76

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G  L+ G     D+K+ Y  PI+TDVH   Q   +A   DILQ+PA L RQTDL++A A+
Sbjct: 77  GPSLENGLTWLNDIKETYNVPIITDVHEPYQAAPVAKVADILQLPAFLSRQTDLVSAIAR 136

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG++INVKK QFL+P EM +I+ K    G   V+ CERG++FGYN LV DM     M SM
Sbjct: 137 TGKIINVKKAQFLAPHEMRHIINKCLEAGNDQVILCERGSAFGYNNLVVDMLGFDTMKSM 196

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q+PG  G+ +GG R  I  LA+A +A G+AG+FLE H DPD A  DGP
Sbjct: 197 NVPVFFDVTHALQEPGARGDSAGGRRHQITTLARAGMATGLAGLFLEAHPDPDKAKCDGP 256

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           + + +  L   L Q+  +D ++K
Sbjct: 257 SALRLNQLEPFLIQIKQLDDLVK 279


>gi|296113533|ref|YP_003627471.1| 3-deoxy-8-phosphooctulonate synthase KdsA [Moraxella catarrhalis
           RH4]
 gi|37728655|gb|AAO63018.1| KdsA [Moraxella catarrhalis 7169]
 gi|295921227|gb|ADG61578.1| 3-deoxy-8-phosphooctulonate synthase KdsA [Moraxella catarrhalis
           RH4]
 gi|326559536|gb|EGE09950.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           7169]
 gi|326562726|gb|EGE13028.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           103P14B1]
 gi|326564638|gb|EGE14856.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           46P47B1]
 gi|326565455|gb|EGE15626.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           12P80B1]
 gi|326568582|gb|EGE18653.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           BC7]
 gi|326568707|gb|EGE18777.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           BC8]
 gi|326572576|gb|EGE22565.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           CO72]
 gi|326574172|gb|EGE24120.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           101P30B1]
 gi|326575611|gb|EGE25535.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           O35E]
          Length = 287

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 171/263 (65%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +   N++ FVL  G   +ES + AF IAE+   ICQ LNIG V+K+SFDKANRSSL   R
Sbjct: 17  IEIGNDKPFVLFGGMNVLESRELAFEIAEQYIDICQRLNIGYVFKASFDKANRSSLHSFR 76

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G  L+ G     D+K+ Y  PI+TDVH   Q   +A   DILQ+PA L RQTDL++A A+
Sbjct: 77  GPSLENGLTWLNDIKETYNVPIITDVHEPYQAAPVAKVADILQLPAFLSRQTDLVSAIAR 136

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG++INVKK QFL+P EM +I+ K    G   V+ CERG++FGYN LV DM     M SM
Sbjct: 137 TGKIINVKKAQFLAPHEMRHIINKCLEAGNDQVILCERGSAFGYNNLVVDMLGFDTMKSM 196

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q+PG  G+ +GG R  I  LA+A +A G+AG+FLE H DPD A  DGP
Sbjct: 197 NVPVFFDVTHALQEPGARGDSAGGRRHQITTLARAGMATGLAGLFLEAHPDPDKAKCDGP 256

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           + + +  L   L Q+  +D ++K
Sbjct: 257 SALRLNQLEPFLIQIKQLDDLVK 279


>gi|218779216|ref|YP_002430534.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfatibacillum
           alkenivorans AK-01]
 gi|226722930|sp|B8F9X0|KDSA_DESAA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|218760600|gb|ACL03066.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfatibacillum
           alkenivorans AK-01]
          Length = 273

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 176/252 (69%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
            +LIAGPC IE+ +    IAE++  I + +++  V+K+SFDKANR+S+   RG GL++G 
Sbjct: 19  LLLIAGPCVIENEEKTLEIAERIKGIVRDMDVNFVFKASFDKANRTSIDSFRGPGLEQGL 78

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            I   +K + G P+++DVH+  Q    ++ +DILQIPA LCRQTDLLTAA  +G+ +NVK
Sbjct: 79  AILGKVKSRLGLPVISDVHSPDQVGPASEVLDILQIPAFLCRQTDLLTAAGNSGKPVNVK 138

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQF+ PW+M ++  K+ + G + ++  ERG+SFGYN LV D R+  IM  +G PV+FDA
Sbjct: 139 KGQFVGPWDMKHVTGKVLSTGNERIMLTERGSSFGYNNLVVDFRNFSIMRDLGFPVVFDA 198

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G+CSGG+R Y+  LA+AA A G+ G+F E H DPD A  DGPN + ++ L
Sbjct: 199 THSVQMPGGLGSCSGGDRSYVPLLARAAAAAGVDGVFFEVHTDPDKALCDGPNSLTMEML 258

Query: 285 PKLLSQLLAIDK 296
             +L QLLAI K
Sbjct: 259 ESILPQLLAIRK 270


>gi|153002115|ref|YP_001367796.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS185]
 gi|166220459|sp|A6WSE4|KDSA_SHEB8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|151366733|gb|ABS09733.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS185]
          Length = 282

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 129/276 (46%), Positives = 183/276 (66%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I+LGS    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKIINLGS----IEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF ++KK +  P++TDVH   QC  +A+ VDI+Q+PA 
Sbjct: 58  FDKANRSSINSYRGPGMEEGLKIFEEIKKTFNLPLITDVHEVHQCAPVAEVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN L
Sbjct: 118 LARQTDLVVAMAKTGTIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSSFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQSGYPVIFDATHALQRPGGRADSAGGRRAQAAELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L Q+ AID ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLHQLENYLKQMKAIDDLVK 273


>gi|332526691|ref|ZP_08402793.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rubrivivax
           benzoatilyticus JA2]
 gi|332111094|gb|EGJ11126.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rubrivivax
           benzoatilyticus JA2]
          Length = 285

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 185/264 (70%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LI+GPC +ES      +A +L  I  +L I  ++KSS+DKANRSS +  RG G++
Sbjct: 11  DRPFFLISGPCVVESEQLQMDVAGRLKEITSALGIPFIFKSSYDKANRSSGSSFRGPGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G EI   ++++ G P+LTDVHTE +   +A  VD+LQ PA LCRQTD + A AQ G+ +
Sbjct: 71  RGLEILAKVRRELGVPVLTDVHTEAEVPQVAAVVDMLQTPAFLCRQTDFIRAVAQCGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHA----HGAKDVLF--CERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K  A     G  + LF  CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVVDKARAAAREKGLAEDLFTVCERGASFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAV +G+AG+F+ETH DP NA SDG
Sbjct: 191 TGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVGVGVAGLFMETHPDPANAMSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +K +  LL QL+AID+++K
Sbjct: 251 PNAVPLKHMKALLEQLVAIDRVVK 274


>gi|319943952|ref|ZP_08018232.1| bis(5-nucleosyl)-tetraphosphatase [Lautropia mirabilis ATCC 51599]
 gi|319742713|gb|EFV95120.1| bis(5-nucleosyl)-tetraphosphatase [Lautropia mirabilis ATCC 51599]
          Length = 285

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 180/264 (68%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F L+AGPC IES   A   A +L  IC  L+I  VYKSSFDKANRSS    RG GL+
Sbjct: 11  DQPFFLLAGPCAIESLQLALDTAGQLKEICAELDIPFVYKSSFDKANRSSGKSFRGPGLE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G ++  ++K++ G P++TDVH   Q + +A+ VD+LQ PA LCRQTD + A A +GR +
Sbjct: 71  GGLKVLAEVKRQIGVPVVTDVHEIDQIKPVAEVVDVLQTPAFLCRQTDFINAVAASGRPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKD------VLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M  ++ K  A   +       V+ CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKQVVAKARAAAKEAGVDEDCVMVCERGASFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R++I  LA+AAVA G+AG+F+ETH DP++A SDG
Sbjct: 191 TGCPVVFDATHSVQLPGGQGDRSGGQREFIPVLARAAVATGVAGLFMETHPDPEHALSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN   +  +  LL+ L  +D ++K
Sbjct: 251 PNAWPLARMHDLLATLKELDAVVK 274


>gi|212634001|ref|YP_002310526.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella piezotolerans
           WP3]
 gi|226722937|sp|B8CKA0|KDSA_SHEPW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|212555485|gb|ACJ27939.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella piezotolerans
           WP3]
          Length = 282

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 182/276 (65%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I LGS    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKTIDLGS----IEIANDKPFVLFGGMNVLESRDLAMQIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF ++K  +  P++TDVH   QC  +A+ VDI+Q+PA 
Sbjct: 58  FDKANRSSVNSYRGPGMEEGLKIFEEIKSTFNLPLITDVHEVHQCAPVAEVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN L
Sbjct: 118 LARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIISKFNEAGNDEIILCERGSSFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQSGYPVIFDATHALQKPGGRSDSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L+Q+ A+D ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLHQLENYLTQMKAVDDLVK 273


>gi|157962938|ref|YP_001502972.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella pealeana ATCC
           700345]
 gi|189028418|sp|A8H7A0|KDSA_SHEPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|157847938|gb|ABV88437.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella pealeana ATCC
           700345]
          Length = 282

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 182/276 (65%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I LGS    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKIISLGS----IEIANDKPFVLFGGMNVLESRDLAMQIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF ++K  +  P++TDVH   QC  +A+ VD++Q+PA 
Sbjct: 58  FDKANRSSVNSYRGPGMEEGLKIFEEIKSTFNLPLITDVHEVHQCAPVAEVVDVIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN L
Sbjct: 118 LARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIMLCERGSSFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQTGYPVIFDATHALQRPGGRSDSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L+Q+ AID ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLHQLENYLTQMKAIDDLVK 273


>gi|329121348|ref|ZP_08249974.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dialister micraerophilus
           DSM 19965]
 gi|327469757|gb|EGF15223.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dialister micraerophilus
           DSM 19965]
          Length = 273

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 128/257 (49%), Positives = 179/257 (69%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           ++  LIAGPC IES++   MI +++  IC+ L++  ++K+S+DKANRSS    RG GL+K
Sbjct: 14  KKLFLIAGPCVIESYERTLMIGKEIKRICEKLDVTYIFKASYDKANRSSYDSFRGPGLEK 73

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G +I  D+KK+   PIL+DVH   Q EA A  +DILQIPA LCRQTDL+  AA+TG+ +N
Sbjct: 74  GLKILADIKKELNVPILSDVHETSQLEAAAKVLDILQIPAFLCRQTDLICGAAKTGKAVN 133

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQF++P +M N++ KL   G  ++   ERG SFGY+ LV DM++ PIM   G PVIF
Sbjct: 134 VKKGQFMAPEDMKNVIGKLEKTGNYNISLTERGVSFGYHNLVVDMKAFPIMRKYGYPVIF 193

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG +G  +GG+R++I  LA++A A G  G F+E H +P    SD  NM+ + 
Sbjct: 194 DATHSVQLPGGNGTSTGGQREFIPCLARSAAAAGADGFFMEVHDNPPEGLSDSTNMLYLS 253

Query: 283 DLPKLLSQLLAIDKIIK 299
           DL KLL+ L+ I +++K
Sbjct: 254 DLEKLLTDLVEIHELVK 270


>gi|298530336|ref|ZP_07017738.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509710|gb|EFI33614.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 273

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 171/255 (67%), Gaps = 1/255 (0%)

Query: 40  SNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVG 99
           S+ +    I GPC +ES D A   AE L  +  SL++ +V+KSSFDKANRSSL G RG G
Sbjct: 14  SSRKDLFFILGPCVLESRDMALQTAESLAGMAASLDVNIVFKSSFDKANRSSLDGFRGPG 73

Query: 100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGR 159
           ++KG E  +++KK+ G P++TD+H  QQ +  A   D++QIPALLCRQTDL+ AAA TG+
Sbjct: 74  MEKGLEWLQEIKKRTGLPVITDIHAPQQADEAAGVADVIQIPALLCRQTDLILAAAATGK 133

Query: 160 VINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
           ++N+KKGQF++PW+M  ++ K  +     +   ERGT+FGYN LV D +SI IM+ +G P
Sbjct: 134 IVNIKKGQFMAPWDMAGVVDKAASRN-PGIWLTERGTTFGYNNLVVDFKSIAIMSGLGFP 192

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           VI DA+HSVQ PG     SGG+R+++  LA+A VA G  GIF+E H  P+ A  DGPN  
Sbjct: 193 VILDATHSVQLPGGLKTASGGQREFVPVLARAGVAAGAHGIFMEVHPRPEMALCDGPNSW 252

Query: 280 NIKDLPKLLSQLLAI 294
            I +   LL  LL I
Sbjct: 253 PIDETFSLLQNLLKI 267


>gi|302037868|ref|YP_003798190.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Nitrospira
           defluvii]
 gi|300605932|emb|CBK42265.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Nitrospira
           defluvii]
          Length = 273

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 133/251 (52%), Positives = 173/251 (68%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           R  LIAGPC IES   A   A ++  I +++ +  V+KSSFDKANR+S+   RG GL+KG
Sbjct: 17  RPFLIAGPCVIESEQLAMDTAGRIAEIAKAIGMPYVFKSSFDKANRTSITSFRGPGLEKG 76

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
             +   +K++ G P+LTDVH+E+Q       VDILQIPA LCRQTDLL AAA+TG+V+N+
Sbjct: 77  LAVLARVKQQIGVPVLTDVHSEEQATEAGRVVDILQIPAFLCRQTDLLIAAAKTGKVVNI 136

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQFLSP EM N ++K+   G + ++  ERG+SFGYN LV DMRS PIM   G PV+FD
Sbjct: 137 KKGQFLSPPEMGNAVKKVEDSGNRRIVLTERGSSFGYNNLVVDMRSFPIMRRFGYPVVFD 196

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ PG  G  S G+R+++  LA AA   G  G F+E H DPD+A SDGPNM+ +  
Sbjct: 197 ATHSVQLPGGGGTKSSGQREFVETLACAAAGAGCDGFFMEVHPDPDSALSDGPNMVPLHT 256

Query: 284 LPKLLSQLLAI 294
           L  LL ++L I
Sbjct: 257 LHSLLERVLRI 267


>gi|15605681|ref|NP_213056.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aquifex aeolicus VF5]
 gi|6647545|sp|O66496|KDSA_AQUAE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|14278397|pdb|1FWN|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep
 gi|14278398|pdb|1FWN|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep
 gi|14278399|pdb|1FWS|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep And
           Cadmium
 gi|14278400|pdb|1FWS|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep And
           Cadmium
 gi|14278401|pdb|1FWT|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep, E4p
           And Cadmium
 gi|14278402|pdb|1FWT|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep, E4p
           And Cadmium
 gi|14278403|pdb|1FWW|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep, A5p
           And Cadmium
 gi|14278404|pdb|1FWW|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep, A5p
           And Cadmium
 gi|14278405|pdb|1FX6|A Chain A, Aquifex Aeolicus Kdo8p Synthase
 gi|14278406|pdb|1FX6|B Chain B, Aquifex Aeolicus Kdo8p Synthase
 gi|14278407|pdb|1FXP|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Cadmium
 gi|14278408|pdb|1FXP|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Cadmium
 gi|14278409|pdb|1FXQ|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep And
           A5p
 gi|14278410|pdb|1FXQ|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep And
           A5p
 gi|14278411|pdb|1FY6|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Cadmium
           And A5p
 gi|14278412|pdb|1FY6|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Cadmium
           And A5p
 gi|18655839|pdb|1JCX|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Api And
           Cadmium
 gi|18655840|pdb|1JCX|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Api And
           Cadmium
 gi|18655841|pdb|1JCY|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With R5p, Pep
           And Cadmium
 gi|18655842|pdb|1JCY|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With R5p, Pep
           And Cadmium
 gi|42543281|pdb|1PE1|A Chain A, Aquifex Aeolicus Kdo8ps In Complex With Cadmium And 2-Pga
 gi|42543282|pdb|1PE1|B Chain B, Aquifex Aeolicus Kdo8ps In Complex With Cadmium And 2-Pga
 gi|46015195|pdb|1PCK|A Chain A, Aquifex Aeolicus Kdo8ps In Complex With Z-Methyl-Pep
 gi|46015196|pdb|1PCK|B Chain B, Aquifex Aeolicus Kdo8ps In Complex With Z-Methyl-Pep
 gi|46015199|pdb|1PCW|A Chain A, Aquifex Aeolicus Kdo8ps In Complex With Cadmium And App, A
           Bisubstrate Inhibitor
 gi|46015200|pdb|1PCW|B Chain B, Aquifex Aeolicus Kdo8ps In Complex With Cadmium And App, A
           Bisubstrate Inhibitor
 gi|110590753|pdb|2A21|A Chain A, Aquifex Aeolicus Kdo8ps In Complex With Pep, Po4, And Zn2+
 gi|110590754|pdb|2A21|B Chain B, Aquifex Aeolicus Kdo8ps In Complex With Pep, Po4, And Zn2+
 gi|110590757|pdb|2A2I|A Chain A, Aquifex Aeolicus Kdo8ps In Complex With Pep, A5p, Zn2+
 gi|110590758|pdb|2A2I|B Chain B, Aquifex Aeolicus Kdo8ps In Complex With Pep, A5p, Zn2+
 gi|237640503|pdb|3E0I|A Chain A, Cu2+ Substituted Aquifex Aeolicus Kdo8ps In Complex With
           Pep
 gi|237640504|pdb|3E0I|B Chain B, Cu2+ Substituted Aquifex Aeolicus Kdo8ps In Complex With
           Pep
 gi|237640505|pdb|3E12|A Chain A, Cu2+ Substituted Aquifex Aeolicus Kdo8ps In Complex With
           Kdo8p
 gi|237640506|pdb|3E12|B Chain B, Cu2+ Substituted Aquifex Aeolicus Kdo8ps In Complex With
           Kdo8p
 gi|2982835|gb|AAC06457.1| 3-deoxy-d-manno-octulosonic acid 8-phosphate synthase [Aquifex
           aeolicus VF5]
          Length = 267

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 176/256 (68%), Gaps = 2/256 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGPC IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 2   EKFLVIAGPCAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LCRQTDLL AAA+TGR +
Sbjct: 62  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 122 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQWA-KVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD    + +
Sbjct: 181 YDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDASTQLPL 240

Query: 282 KDLPKLLSQLLAIDKI 297
             L  ++  +L I ++
Sbjct: 241 SQLEGIIEAILEIREV 256


>gi|281356231|ref|ZP_06242724.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Victivallis vadensis
           ATCC BAA-548]
 gi|281317600|gb|EFB01621.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Victivallis vadensis
           ATCC BAA-548]
          Length = 277

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 119/255 (46%), Positives = 178/255 (69%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           R  LIAGPC  E+ +     AE L  +   LN+  ++K+S+DKANR+S   KRG G+++G
Sbjct: 20  RLTLIAGPCMAETLEVCLETAEFLKNLTAELNVQYIFKASYDKANRTSNDSKRGPGMERG 79

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
            E+  ++K+++  P++TDVH  ++   +A+  D+LQIPA LCRQTDLL AA ++GR +N+
Sbjct: 80  LEMLAEVKRRFDVPVITDVHEHEEVPRVAEVADVLQIPAFLCRQTDLLHAAGESGRAVNI 139

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQF++P +M   ++K+ + G   V+  ERGT+FGY+ LV DMRS+  M S GVPV+FD
Sbjct: 140 KKGQFMAPEDMLGAVEKVRSTGNDRVMLTERGTTFGYHNLVVDMRSLMTMRSFGVPVVFD 199

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ PG  GN SGG R+++ PLA+AA A+GI  +F E H  PD A SDGPN ++ + 
Sbjct: 200 ATHSVQLPGGLGNASGGRREFVYPLARAAAAVGIDVLFTEVHPRPDEAWSDGPNSLDFRQ 259

Query: 284 LPKLLSQLLAIDKII 298
           + ++L+++ AI  ++
Sbjct: 260 IREILTKVKAIHDLV 274


>gi|127513832|ref|YP_001095029.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella loihica PV-4]
 gi|158513476|sp|A3QH22|KDSA_SHELP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|126639127|gb|ABO24770.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella loihica PV-4]
          Length = 282

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 183/276 (66%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I LGS    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKTIKLGS----IEIANDKPFVLFGGMNVLESRDLAMQIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF+++K  +  P++TDVH   QC+ +A+ VDI+Q+PA 
Sbjct: 58  FDKANRSSVNSYRGPGMEEGLKIFQEIKDTFNLPLITDVHEPYQCQPVAEVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+ FGYN L
Sbjct: 118 LARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSCFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L+Q+ AID ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLHQLENYLTQMKAIDDLVK 273


>gi|120600158|ref|YP_964732.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. W3-18-1]
 gi|146291914|ref|YP_001182338.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella putrefaciens
           CN-32]
 gi|158512984|sp|A1RND3|KDSA_SHESW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166220460|sp|A4Y3K6|KDSA_SHEPC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|120560251|gb|ABM26178.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. W3-18-1]
 gi|145563604|gb|ABP74539.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella putrefaciens
           CN-32]
 gi|319425205|gb|ADV53279.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella putrefaciens
           200]
          Length = 282

 Score =  264 bits (675), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 182/276 (65%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I+LGS    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKIINLGS----IEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF ++KK +  P++TDVH   QC  +A+ VDI+Q+PA 
Sbjct: 58  FDKANRSSVNSYRGPGMEEGLKIFEEIKKTFNLPLITDVHETYQCAPVAEVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+ FGYN L
Sbjct: 118 LARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSCFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQSGYPVIFDATHALQRPGGRSDSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L Q+ AID ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLHQLENYLKQMKAIDDLVK 273


>gi|114046310|ref|YP_736860.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. MR-7]
 gi|117919227|ref|YP_868419.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. ANA-3]
 gi|122944922|sp|Q0HYK2|KDSA_SHESR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|158512314|sp|A0KT94|KDSA_SHESA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|113887752|gb|ABI41803.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. MR-7]
 gi|117611559|gb|ABK47013.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. ANA-3]
          Length = 282

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 182/276 (65%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I+LGS    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKIINLGS----IEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF ++KK +  P++TDVH   QC  +A+ VDI+Q+PA 
Sbjct: 58  FDKANRSSVNSYRGPGMEEGLKIFEEIKKTFNLPLITDVHETYQCAPVAEVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+ FGYN L
Sbjct: 118 LARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSCFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L Q+ AID ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLHQLENYLKQMKAIDDLVK 273


>gi|44888086|sp|Q7UQ25|KDSA_RHOBA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
          Length = 281

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 177/257 (68%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
            ++IAGPC ++S + A  I E+L  I Q  ++ +++K+SFDKANR+SLA +RG G+++G 
Sbjct: 23  LLVIAGPCVLQSRELALQIGEELARINQRSDVQVIFKASFDKANRTSLAAQRGPGIEQGL 82

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            +   ++   G P+ TD+H  +Q  A+ +  D+LQIPA L RQTDLL AAA TGR +NVK
Sbjct: 83  GLLEAVRANTGLPVTTDIHLPEQAAAVGEVCDLLQIPAFLARQTDLLVAAASTGRPVNVK 142

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQF+SP +M  ++ KL   G   V+ CERGT FGY  LV DM++IPIM S+GVPV+FDA
Sbjct: 143 KGQFMSPGDMRYVVDKLRGSGDGGVMACERGTFFGYGRLVNDMQAIPIMRSLGVPVVFDA 202

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQQPG  G  +GG R+ + PLA+AAVAIG   +F ETH DP  +PSDGPNMI +   
Sbjct: 203 THSVQQPGGLGGATGGNREMVEPLARAAVAIGCDALFFETHPDPQTSPSDGPNMIPLDRF 262

Query: 285 PKLLSQLLAIDKIIKPL 301
              L +LL + + +  L
Sbjct: 263 AGTLDRLLRLREAVDGL 279


>gi|327543015|gb|EGF29462.1| 3-deoxy-8-phosphooctulonate synthase [Rhodopirellula baltica WH47]
          Length = 340

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 177/257 (68%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
            ++IAGPC ++S + A  I E+L  I Q  ++ +++K+SFDKANR+SLA +RG G+++G 
Sbjct: 82  LLVIAGPCVLQSRELALQIGEELARINQRSDVQVIFKASFDKANRTSLAAQRGPGIEQGL 141

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            +   ++   G P+ TD+H  +Q  A+ +  D+LQIPA L RQTDLL AAA TGR +NVK
Sbjct: 142 GLLEAVRANTGLPVTTDIHLPEQAAAVGEVCDLLQIPAFLARQTDLLVAAASTGRPVNVK 201

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQF+SP +M  ++ KL   G   V+ CERGT FGY  LV DM++IPIM S+GVPV+FDA
Sbjct: 202 KGQFMSPGDMRYVVDKLRGSGDGGVMACERGTFFGYGRLVNDMQAIPIMRSLGVPVVFDA 261

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQQPG  G  +GG R+ + PLA+AAVAIG   +F ETH DP  +PSDGPNMI +   
Sbjct: 262 THSVQQPGGLGGATGGNREMVEPLARAAVAIGCDALFFETHPDPQTSPSDGPNMIPLDRF 321

Query: 285 PKLLSQLLAIDKIIKPL 301
              L +LL + + +  L
Sbjct: 322 AGTLDRLLRLREAVDGL 338


>gi|294102477|ref|YP_003554335.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aminobacterium
           colombiense DSM 12261]
 gi|293617457|gb|ADE57611.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aminobacterium
           colombiense DSM 12261]
          Length = 285

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 130/261 (49%), Positives = 177/261 (67%)

Query: 39  FSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGV 98
           F   +   +IAGPC +ES D    I +    IC  L +  ++K+S+DKANR+S+   RG 
Sbjct: 11  FVGGEALTVIAGPCSLESLDLGLEIGQTAKEICDRLGMNYIFKASYDKANRTSIHSYRGP 70

Query: 99  GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTG 158
           GL+KG     ++K+K   P+LTD+H   Q E +A+  DILQIPA LCRQTDLL AAAQT 
Sbjct: 71  GLEKGLAQLAEIKEKLSVPVLTDIHESWQAEPVAEVADILQIPAFLCRQTDLLVAAAQTR 130

Query: 159 RVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGV 218
           R +++KK QFL+P +M  +++K    G + +L CERGT+ GYN LV DMRS+ +M S+G 
Sbjct: 131 RALHIKKAQFLAPQDMKQVVEKCREAGNEKILLCERGTTMGYNQLVVDMRSLVLMRSLGC 190

Query: 219 PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNM 278
           PV+FDA+HSVQ PG  G  SGG+R++ +PLA+AA AIGI G+F+ETH DPD A SDGPNM
Sbjct: 191 PVVFDATHSVQMPGGKGTSSGGDRRFALPLARAAAAIGIDGLFIETHPDPDKAKSDGPNM 250

Query: 279 INIKDLPKLLSQLLAIDKIIK 299
           + +K L   L Q+  I   ++
Sbjct: 251 VPLKKLEYFLFQIKEIWNFVE 271


>gi|113971497|ref|YP_735290.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. MR-4]
 gi|123324720|sp|Q0HFD4|KDSA_SHESM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|113886181|gb|ABI40233.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. MR-4]
          Length = 282

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 182/276 (65%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I+LGS    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKIINLGS----IEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF ++KK +  P++TDVH   QC  +A+ VDI+Q+PA 
Sbjct: 58  FDKANRSSVNSYRGPGMEEGLKIFEEIKKTFNLPLITDVHEPYQCAPVAEVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+ FGYN L
Sbjct: 118 LARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSCFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L Q+ AID ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLHQLENYLKQMKAIDDLVK 273


>gi|114561911|ref|YP_749424.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella frigidimarina
           NCIMB 400]
 gi|122300706|sp|Q087H9|KDSA_SHEFN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|114333204|gb|ABI70586.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella frigidimarina
           NCIMB 400]
          Length = 283

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 178/265 (67%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N V  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+  
Sbjct: 10  NNVQVANDKPFVLFGGMNVLESRDLAMSIAEHYVEVTQKLGIPYVFKASFDKANRSSVNS 69

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G  IF ++K  +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 70  YRGPGMEEGLRIFEEIKSTFNVPMITDVHEIHQCAPVAEVVDIIQLPAFLARQTDLVVAM 129

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN LV DM  +  M 
Sbjct: 130 AKTGAVINVKKPQFLAPHEMRHIITKFNEAGNDNIILCERGSSFGYNNLVVDMLGMDEMK 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  D
Sbjct: 190 QTGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAKCD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP  + +  L K L+Q+ A+D+++K
Sbjct: 250 GPCALPLHLLEKYLTQMKAVDELVK 274


>gi|24375317|ref|NP_719360.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella oneidensis
           MR-1]
 gi|37999694|sp|Q8EAR9|KDSA_SHEON RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|24350130|gb|AAN56804.1|AE015816_1 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella oneidensis
           MR-1]
          Length = 282

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 181/276 (65%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I LGS    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKIIKLGS----IEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF ++KK +  P++TDVH   QC  +A+ VDI+Q+PA 
Sbjct: 58  FDKANRSSVNSYRGPGMEEGLKIFEEIKKTFNLPLITDVHETYQCAPVAEVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+ FGYN L
Sbjct: 118 LARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSCFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L Q+ AID ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLHQLENYLKQMKAIDDLVK 273


>gi|120602554|ref|YP_966954.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio vulgaris
           DP4]
 gi|158513907|sp|A1VDL1|KDSA_DESVV RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|120562783|gb|ABM28527.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio vulgaris
           DP4]
          Length = 273

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 132/252 (52%), Positives = 174/252 (69%), Gaps = 1/252 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           +RF+L AGPC +E  D A   A  +    ++  +  V+KSS+DKANR+S+   RG GL +
Sbjct: 16  RRFIL-AGPCALEDFDVAMETAHAVREAAEAAGLFAVFKSSWDKANRTSITSFRGPGLVR 74

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G E    ++++ G P++TD+H  +Q   +A+  DI+QIPA LCRQTDLL AAA TGRV+N
Sbjct: 75  GMEWLARIREESGLPVVTDIHLPEQAAPVAEVADIIQIPAFLCRQTDLLVAAAATGRVVN 134

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQF++PW+M   ++KL A G + +L  ERGTSFGYN LV D RSIP M   GVPV+F
Sbjct: 135 VKKGQFVAPWDMRPAVEKLRAAGNERILLTERGTSFGYNNLVVDYRSIPTMQGFGVPVVF 194

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGGER+++  LA+AAVA G+ G+FLE H DPD A  DGPN   + 
Sbjct: 195 DATHSVQLPGGLGGSSGGERRHVPVLARAAVAAGVDGVFLECHPDPDKALCDGPNSWPLD 254

Query: 283 DLPKLLSQLLAI 294
            LP LL +L A+
Sbjct: 255 RLPALLKELSAL 266


>gi|32474341|ref|NP_867335.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopirellula baltica
           SH 1]
 gi|32444879|emb|CAD74881.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodopirellula baltica
           SH 1]
          Length = 286

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 177/257 (68%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
            ++IAGPC ++S + A  I E+L  I Q  ++ +++K+SFDKANR+SLA +RG G+++G 
Sbjct: 28  LLVIAGPCVLQSRELALQIGEELARINQRSDVQVIFKASFDKANRTSLAAQRGPGIEQGL 87

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            +   ++   G P+ TD+H  +Q  A+ +  D+LQIPA L RQTDLL AAA TGR +NVK
Sbjct: 88  GLLEAVRANTGLPVTTDIHLPEQAAAVGEVCDLLQIPAFLARQTDLLVAAASTGRPVNVK 147

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQF+SP +M  ++ KL   G   V+ CERGT FGY  LV DM++IPIM S+GVPV+FDA
Sbjct: 148 KGQFMSPGDMRYVVDKLRGSGDGGVMACERGTFFGYGRLVNDMQAIPIMRSLGVPVVFDA 207

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQQPG  G  +GG R+ + PLA+AAVAIG   +F ETH DP  +PSDGPNMI +   
Sbjct: 208 THSVQQPGGLGGATGGNREMVEPLARAAVAIGCDALFFETHPDPQTSPSDGPNMIPLDRF 267

Query: 285 PKLLSQLLAIDKIIKPL 301
              L +LL + + +  L
Sbjct: 268 AGTLDRLLRLREAVDGL 284


>gi|88812396|ref|ZP_01127646.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitrococcus mobilis
           Nb-231]
 gi|88790403|gb|EAR21520.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitrococcus mobilis
           Nb-231]
          Length = 281

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 129/258 (50%), Positives = 170/258 (65%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q   LIAGPC +ES   A   A +L  IC++L I  VYKSSFDKANRSS    RG GL+
Sbjct: 14  DQPLFLIAGPCVVESEQLALDSAGELKEICRTLAIPFVYKSSFDKANRSSHHSFRGPGLE 73

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G  I   ++++ G P+LTDVH +     +A  VD+LQ PA LCRQT+ + + A+ G  +
Sbjct: 74  AGLRILEQVRREIGVPVLTDVHEDTPLNEVAAVVDLLQTPAFLCRQTNFIQSVARQGLPV 133

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M ++ +K  A G + +L CERG SFGYN LV DMRS+  +   G PV+
Sbjct: 134 NIKKGQFLAPWDMVHVAEKARAVGNQRILVCERGVSFGYNNLVCDMRSLAALRQSGSPVV 193

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG  G  SGG+R++I  LA+AAVA G+ G+F+ETH  PD A SDGPN   +
Sbjct: 194 FDATHSVQLPGGQGTVSGGQREFIPVLARAAVAAGVCGVFMETHPRPDEALSDGPNSWPL 253

Query: 282 KDLPKLLSQLLAIDKIIK 299
             +  LL  L  ID  +K
Sbjct: 254 ARMRSLLEMLKEIDSGVK 271


>gi|91792285|ref|YP_561936.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella denitrificans
           OS217]
 gi|122968926|sp|Q12QR3|KDSA_SHEDO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|91714287|gb|ABE54213.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella denitrificans
           OS217]
          Length = 286

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/272 (45%), Positives = 179/272 (65%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I+L +    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKA
Sbjct: 6   INLATEAGAIEIANDKPFVLFGGMNVLESRDLAMSIAEHYVEVTQKLGIPYVFKASFDKA 65

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG G+++G +IF ++K+ +  P++TDVH   QC  +A+ VDI+Q+PA L RQ
Sbjct: 66  NRSSVNSYRGPGMEEGLKIFEEIKRTFNVPLITDVHEVHQCAPVAEVVDIIQLPAFLARQ 125

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG +INVKK QFL+P EM +I+ K +  G   ++ CERG+SFGYN LV DM
Sbjct: 126 TDLVVAMAKTGAIINVKKPQFLAPHEMRHIVTKFNEAGNDKIILCERGSSFGYNNLVVDM 185

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
             +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+GIAG+F+E H D
Sbjct: 186 LGMDDMKKTGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGIAGLFIEAHPD 245

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNA  DGP  + +  L   L Q+ A+D ++K
Sbjct: 246 PDNAKCDGPCALPLHQLENYLKQMKAVDDLVK 277


>gi|171463597|ref|YP_001797710.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171193135|gb|ACB44096.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 287

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 138/262 (52%), Positives = 180/262 (68%), Gaps = 5/262 (1%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++RF LIAGPC IES   A  IA +L  I  SL I  +YKSSFDKANRSS    RG+G++
Sbjct: 14  DRRFFLIAGPCVIESEQSAIDIAGQLKEITASLKIPFIYKSSFDKANRSSGTSFRGLGME 73

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +KK+    +LTDVH   +  A+A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 74  KGLEILSKVKKQIDVLVLTDVHDISEIAAVASVVDVLQTPAFLCRQTDFIRACAQSGKPV 133

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAK-----DVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           N KKGQFLSP EM N+++K  A   +       + CERG SFGYN LV+DMRS+ I+   
Sbjct: 134 NFKKGQFLSPHEMLNVIEKARAAALEIGLPDQFMVCERGASFGYNNLVSDMRSLAILRES 193

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV+FDA+HSVQ PG  GN SGG+R+++  LA+AAVA+GI+G+F+ETH DP  A SDGP
Sbjct: 194 EAPVVFDATHSVQLPGGQGNSSGGQREFVPVLARAAVAVGISGLFMETHPDPAKALSDGP 253

Query: 277 NMINIKDLPKLLSQLLAIDKII 298
           N + +  +  LL+ L+AID I+
Sbjct: 254 NAVPLNRMKDLLASLVAIDDIV 275


>gi|146386977|pdb|2NXG|A Chain A, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386978|pdb|2NXG|B Chain B, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386979|pdb|2NXH|A Chain A, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386980|pdb|2NXH|B Chain B, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386981|pdb|2NXH|C Chain C, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386982|pdb|2NXH|D Chain D, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386983|pdb|2NXH|E Chain E, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386984|pdb|2NXH|F Chain F, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386985|pdb|2NXH|G Chain G, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386986|pdb|2NXH|H Chain H, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386987|pdb|2NXH|I Chain I, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386988|pdb|2NXH|J Chain J, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386989|pdb|2NXH|K Chain K, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386990|pdb|2NXH|L Chain L, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
          Length = 263

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 176/256 (68%), Gaps = 2/256 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGP  IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 1   EKFLVIAGPNAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 60

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LCRQTDLL AAA+TGR +
Sbjct: 61  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAV 120

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 121 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQWA-KVI 179

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD P  + +
Sbjct: 180 YDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDAPTALPL 239

Query: 282 KDLPKLLSQLLAIDKI 297
             L  ++  +L I ++
Sbjct: 240 SQLEGIIEAILEIREV 255


>gi|56552384|ref|YP_163223.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241761572|ref|ZP_04759659.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753937|ref|YP_003226830.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|56543958|gb|AAV90112.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241373880|gb|EER63413.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258553300|gb|ACV76246.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 292

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 174/262 (66%), Gaps = 6/262 (2%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           +  LIAGPC IE+ D     AE+L  I + L I L+YKSSFDKANRSS    RG G+ +G
Sbjct: 24  KLFLIAGPCVIETEDLTLRTAERLKKIAEKLGILLIYKSSFDKANRSSSQSFRGPGIDEG 83

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
             I   +++  G P+LTDVHT  Q + +A+ VD+LQ PA L RQTDL+ AAA +GR +N+
Sbjct: 84  LRILEKVQRDVGLPVLTDVHTASQVQTVAEVVDVLQTPAFLVRQTDLIEAAAASGRPVNI 143

Query: 164 KKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           KKGQFL+P +M N++ K           A  ++  ERG  FGYN LV+DMR + IM    
Sbjct: 144 KKGQFLAPGDMANVVAKARVAAAEVGIAAPSIMVAERGACFGYNNLVSDMRGLVIMRETN 203

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
            P++FDA+HSVQ PG  GN S GERQ++  LA+AAV++GIAG+FLETH DP NA SDGPN
Sbjct: 204 CPLVFDATHSVQLPGGLGNKSSGERQFVSVLARAAVSVGIAGLFLETHPDPANALSDGPN 263

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
            + +  L  LL+ L+ +D  +K
Sbjct: 264 TVPLDHLEPLLTNLVDLDSFVK 285


>gi|146386965|pdb|2NX3|A Chain A, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386966|pdb|2NX3|B Chain B, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386967|pdb|2NX3|C Chain C, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386968|pdb|2NX3|D Chain D, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386969|pdb|2NX3|E Chain E, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386970|pdb|2NX3|F Chain F, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386971|pdb|2NX3|G Chain G, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386972|pdb|2NX3|H Chain H, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386973|pdb|2NX3|I Chain I, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386974|pdb|2NX3|J Chain J, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386975|pdb|2NX3|K Chain K, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386976|pdb|2NX3|L Chain L, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
          Length = 267

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 176/256 (68%), Gaps = 2/256 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGP  IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 2   EKFLVIAGPNAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LCRQTDLL AAA+TGR +
Sbjct: 62  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 122 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQWA-KVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD P  + +
Sbjct: 181 YDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDAPTALPL 240

Query: 282 KDLPKLLSQLLAIDKI 297
             L  ++  +L I ++
Sbjct: 241 SQLEGIIEAILEIREV 256


>gi|294142134|ref|YP_003558112.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella violacea
           DSS12]
 gi|293328603|dbj|BAJ03334.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella violacea
           DSS12]
          Length = 282

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 183/276 (66%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  + LG     +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKVLSLGD----IEIANDKPFVLFGGMNVLESRDLAMKIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF+++K+ +  P++TDVH   QC  +A+ VDI+Q+PA 
Sbjct: 58  FDKANRSSINSYRGPGMEEGLKIFQEIKQTFNLPLITDVHEIDQCAPVAEVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN L
Sbjct: 118 LARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIISKFNEAGNDNIILCERGSSFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L+Q+ A+D ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLNQLENYLTQMKAVDDLVK 273


>gi|115315205|ref|YP_763928.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica OSU18]
 gi|169656693|ref|YP_001429050.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica FTNF002-00]
 gi|254368101|ref|ZP_04984121.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           holarctica 257]
 gi|115130104|gb|ABI83291.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134253911|gb|EBA53005.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           holarctica 257]
 gi|164551761|gb|ABU62094.2| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           holarctica FTNF002-00]
          Length = 282

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 179/259 (69%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   RG+G+
Sbjct: 17  NGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSFRGLGV 76

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG EI   +KK Y  P++TDVH +     +A+ VD+LQIPA LCRQT+ +    + G+ 
Sbjct: 77  DKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQIPAFLCRQTNFILEVCKQGKP 136

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM + G PV
Sbjct: 137 VNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKATGCPV 196

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDGPN   
Sbjct: 197 VFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDGPNSFP 256

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  + + LS L  +D ++K
Sbjct: 257 MYKIKEFLSLLKELDHLVK 275


>gi|254448216|ref|ZP_05061678.1| 3-deoxy-8-phosphooctulonate synthase [gamma proteobacterium
           HTCC5015]
 gi|198262083|gb|EDY86366.1| 3-deoxy-8-phosphooctulonate synthase [gamma proteobacterium
           HTCC5015]
          Length = 277

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 126/258 (48%), Positives = 173/258 (67%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAGPC IE    A   AE L  + Q L I  +YKSSFDKANRSS+   RGVGL+
Sbjct: 11  DQPFFLIAGPCAIEGESLAMHTAETLKRLTQDLGIPFIYKSSFDKANRSSIDSPRGVGLE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +K ++  P++TDVH     + +A  VD++Q PA LCRQTD +   A  G  +
Sbjct: 71  KGLEILAKVKSEFDLPVITDVHEYTPIDEVASVVDVMQTPAFLCRQTDYILKVASAGLPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M  ++ K  + G + ++ C+RGTSFGYN LV+DMR + +M   G PV+
Sbjct: 131 NIKKGQFLAPWDMQQVVSKARSTGNEQIMVCDRGTSFGYNNLVSDMRGLAVMRETGCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG  G+ SGG+R+++  LA+AA+A G++G+F+ETH DP NA SDGPN   +
Sbjct: 191 FDATHSVQLPGGQGSSSGGQREFVPVLARAAIAAGVSGVFMETHPDPANAFSDGPNAWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             +  LL  +  +D  +K
Sbjct: 251 DQMKALLHTMKVLDDTVK 268


>gi|313892339|ref|ZP_07825931.1| 3-deoxy-8-phosphooctulonate synthase [Dialister microaerophilus
           UPII 345-E]
 gi|313119198|gb|EFR42398.1| 3-deoxy-8-phosphooctulonate synthase [Dialister microaerophilus
           UPII 345-E]
          Length = 273

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 178/257 (69%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           ++  LIAGPC IES++   MI +++  IC+ L++  ++K+S+DKANRSS    RG GL+K
Sbjct: 14  KKLFLIAGPCVIESYERTLMIGKEIKRICEKLDVTYIFKASYDKANRSSYDSFRGPGLEK 73

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G +I  D+KK+   PIL+DVH   Q EA A  +DILQIPA LCRQTDL+  AA+TG+ +N
Sbjct: 74  GLKILADIKKELNVPILSDVHETSQLEAAAKVLDILQIPAFLCRQTDLICGAAKTGKAVN 133

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQF++P +M N++ KL   G  ++   ERG SFGY+ LV DM++ PIM   G PVIF
Sbjct: 134 VKKGQFMAPEDMKNVIGKLEKTGNYNIALTERGVSFGYHNLVVDMKAFPIMRKYGYPVIF 193

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG +G  +GG+R++I  LA++A A G  G F+E H +P    SD  NM+ + 
Sbjct: 194 DATHSVQLPGGNGTSTGGQREFIPCLARSAAAAGADGFFMEVHDNPPEGLSDSTNMLYLS 253

Query: 283 DLPKLLSQLLAIDKIIK 299
           DL  LL+ L+ I +++K
Sbjct: 254 DLENLLTDLVEIHELMK 270


>gi|170728005|ref|YP_001762031.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella woodyi ATCC
           51908]
 gi|238688638|sp|B1KDA1|KDSA_SHEWM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|169813352|gb|ACA87936.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella woodyi ATCC
           51908]
          Length = 282

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 181/276 (65%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I LGS    +  +N++ FVL  G   +ES D A  IAE      Q L I  V+K+S
Sbjct: 2   SNKTIGLGS----IEIANDKPFVLFGGMNVLESRDLAMKIAETYAETTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF ++K  +  P++TDVH   QC  +A+ VDI+Q+PA 
Sbjct: 58  FDKANRSSVNSYRGPGMEEGLKIFEEIKSTFNLPLITDVHEIHQCAPVAEVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN L
Sbjct: 118 LARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSSFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQTGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L+Q+ A+D ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLHQLEAYLTQMKAVDDLVK 273


>gi|37728652|gb|AAO63016.1| KdsA [Moraxella catarrhalis O35E]
          Length = 290

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 173/266 (65%), Gaps = 3/266 (1%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +   N++ FVL  G   +ES + AF IAE+   ICQ LNIG V+K+SFDKANRSSL   R
Sbjct: 17  IEIGNDKPFVLFGGMNVLESRELAFEIAEQYIDICQRLNIGYVFKASFDKANRSSLHSFR 76

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G  L+ G     D+K+ Y  PI+TDVH   Q   +A   DILQ+PA L RQTDL++A A+
Sbjct: 77  GPSLENGLTWLNDIKETYNVPIITDVHEPYQAAPVAKVADILQLPAFLSRQTDLVSAIAR 136

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM---RSIPIM 213
           TG++INVKK QFL+P EM +I+ K    G   V+ CERG++FGYN LV DM    ++  M
Sbjct: 137 TGKIINVKKAQFLAPHEMRHIINKCLEAGNDQVILCERGSAFGYNNLVVDMLGFDTMKTM 196

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
            SM VPV FD +H++Q+PG  G+ +GG R  I  LA+A +A G+AG+FLE H DPD A  
Sbjct: 197 KSMNVPVFFDVTHALQEPGARGDSAGGRRHQITTLARAGMATGLAGLFLEAHPDPDKAKC 256

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGP+ + +  L   L Q+  +D ++K
Sbjct: 257 DGPSALRLNQLEPFLIQIKQLDDLVK 282


>gi|124515315|gb|EAY56825.1| 2-Dehydro-3-deoxyphosphooctonate aldolase [Leptospirillum rubarum]
          Length = 289

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 185/266 (69%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           + L   +  V    E +   I GPC IES      +A +L AI + L + +++KSS+DKA
Sbjct: 4   LSLDGPRGPVVLGEEHKPFFILGPCVIESRSLVREVAAELEAIRERLGVSILFKSSYDKA 63

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NR+S    RG+G+ +G  I  +++ ++G P+++DVH   Q    A  +D+LQIPA LCRQ
Sbjct: 64  NRTSAKSFRGIGMNEGLAILSEVRSEWGLPVVSDVHDADQVSEAAGVLDVLQIPAFLCRQ 123

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDLL AA ++G+ ++VKKGQFL+P +M ++++K+ + G + +L CERG SFGY+TLV D 
Sbjct: 124 TDLLLAAGESGKTVHVKKGQFLAPEDMRHVVEKIASTGNRRILVCERGVSFGYHTLVVDF 183

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
           RS+P+++S+G PV+FDA+HSVQ PG  GN SGG+R+++ PLA+AA  +G  GIF+E H D
Sbjct: 184 RSLPVLSSLGYPVVFDATHSVQSPGGGGNRSGGDRRFVWPLARAAAIVGCQGIFMEVHPD 243

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLA 293
           PD APSDGPNM+ +  L  LL ++LA
Sbjct: 244 PDKAPSDGPNMVPLGKLESLLKEILA 269


>gi|89256819|ref|YP_514181.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica LVS]
 gi|167009858|ref|ZP_02274789.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica FSC200]
 gi|290953515|ref|ZP_06558136.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica URFT1]
 gi|295313207|ref|ZP_06803866.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica URFT1]
 gi|123401558|sp|Q2A271|KDSA_FRATH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|89144650|emb|CAJ79974.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica LVS]
          Length = 275

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 179/259 (69%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   RG+G+
Sbjct: 10  NGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSFRGLGV 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG EI   +KK Y  P++TDVH +     +A+ VD+LQIPA LCRQT+ +    + G+ 
Sbjct: 70  DKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQIPAFLCRQTNFILEVCKQGKP 129

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM + G PV
Sbjct: 130 VNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKATGCPV 189

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDGPN   
Sbjct: 190 VFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDGPNSFP 249

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  + + LS L  +D ++K
Sbjct: 250 MYKIKEFLSLLKELDHLVK 268


>gi|28056536|gb|AAO28415.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Temecula1]
          Length = 288

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 168/257 (65%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           Q   LIAGPC IES       A  L  I   L +  ++KSSFDKANR+S +  RG GL++
Sbjct: 24  QPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSFRGPGLEE 83

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G ++   +K + G P+LTDVH     + +A  VD+LQ PA L RQTD +      G+ +N
Sbjct: 84  GLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVCAVGKPVN 143

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           +KKGQFLSPW+M  +++K  + G   +L CERG SFGYN LV+DMRS+ +M   G PV+F
Sbjct: 144 IKKGQFLSPWDMKPVVEKAKSTGNSQILVCERGASFGYNNLVSDMRSLAVMRETGCPVVF 203

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP NA SDGPN   ++
Sbjct: 204 DATHSVQLPGAQGGRSGGQREFVPVLARAAVAVGISGLFAETHPDPPNALSDGPNAWPLR 263

Query: 283 DLPKLLSQLLAIDKIIK 299
            +  LL  L+ +D + K
Sbjct: 264 TMAMLLETLVELDAVTK 280


>gi|71274919|ref|ZP_00651207.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Dixon]
 gi|71902109|ref|ZP_00684143.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Ann-1]
 gi|77747649|ref|NP_778766.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Temecula1]
 gi|170729816|ref|YP_001775249.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa M12]
 gi|182681125|ref|YP_001829285.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa M23]
 gi|32129661|sp|Q87DY7|KDSA_XYLFT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238687968|sp|B0U657|KDSA_XYLFM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238691101|sp|B2I936|KDSA_XYLF2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|71164651|gb|EAO14365.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Dixon]
 gi|71728127|gb|EAO30324.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Ann-1]
 gi|167964609|gb|ACA11619.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa M12]
 gi|182631235|gb|ACB92011.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa M23]
 gi|307579573|gb|ADN63542.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 276

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 168/257 (65%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           Q   LIAGPC IES       A  L  I   L +  ++KSSFDKANR+S +  RG GL++
Sbjct: 12  QPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSFRGPGLEE 71

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G ++   +K + G P+LTDVH     + +A  VD+LQ PA L RQTD +      G+ +N
Sbjct: 72  GLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVCAVGKPVN 131

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           +KKGQFLSPW+M  +++K  + G   +L CERG SFGYN LV+DMRS+ +M   G PV+F
Sbjct: 132 IKKGQFLSPWDMKPVVEKAKSTGNSQILVCERGASFGYNNLVSDMRSLAVMRETGCPVVF 191

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP NA SDGPN   ++
Sbjct: 192 DATHSVQLPGAQGGRSGGQREFVPVLARAAVAVGISGLFAETHPDPPNALSDGPNAWPLR 251

Query: 283 DLPKLLSQLLAIDKIIK 299
            +  LL  L+ +D + K
Sbjct: 252 TMAMLLETLVELDAVTK 268


>gi|208779003|ref|ZP_03246349.1| 3-deoxy-8-phosphooctulonate synthase [Francisella novicida FTG]
 gi|208744803|gb|EDZ91101.1| 3-deoxy-8-phosphooctulonate synthase [Francisella novicida FTG]
          Length = 275

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 178/259 (68%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   RG+G+
Sbjct: 10  NGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSFRGLGV 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    + GR 
Sbjct: 70  DKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVCKQGRP 129

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM + G PV
Sbjct: 130 VNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKATGCPV 189

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDGPN   
Sbjct: 190 VFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDGPNSFP 249

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  + + LS L  +D ++K
Sbjct: 250 MYKIKEFLSLLKELDHLVK 268


>gi|53757046|gb|AAU91337.1| 3-deoxy-8-phosphooctulonate synthase [Methylococcus capsulatus str.
           Bath]
          Length = 252

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 122/246 (49%), Positives = 167/246 (67%)

Query: 54  IESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKK 113
           IE+   A   A  L  I   L I  +YKSSFDKANRSS A  RG G+++G  I  ++K++
Sbjct: 2   IETEQLALDTAGALKEITDGLGIPFIYKSSFDKANRSSHASYRGPGMEEGLRILAEVKRQ 61

Query: 114 YGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWE 173
            G P+LTDVH +   + +A  VD+LQ PA LCRQT+ +   A TG+ +N+KKGQFL+PW+
Sbjct: 62  IGVPVLTDVHEDTPLQEVASVVDVLQTPAFLCRQTNFIQNVANTGKPVNLKKGQFLAPWD 121

Query: 174 MHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGI 233
           M ++  K  A G + ++ CERG SFGYN LV+DMRS+ IM   G PV++DA+HSVQ PG 
Sbjct: 122 MKHVAAKALATGNRHIMVCERGVSFGYNNLVSDMRSLSIMRETGCPVVYDATHSVQLPGG 181

Query: 234 HGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLA 293
            G  SGG+R+++  LA+AAVA+GI+G+F+ETH DPD A SDGPN   +  +  LL  L  
Sbjct: 182 QGTASGGQREFVPALARAAVAVGISGLFMETHPDPDRALSDGPNSWPLDRMKALLELLST 241

Query: 294 IDKIIK 299
           +D+ +K
Sbjct: 242 LDRTVK 247


>gi|290968950|ref|ZP_06560485.1| 3-deoxy-8-phosphooctulonate synthase [Megasphaera genomosp. type_1
           str. 28L]
 gi|290780906|gb|EFD93499.1| 3-deoxy-8-phosphooctulonate synthase [Megasphaera genomosp. type_1
           str. 28L]
          Length = 281

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 173/262 (66%)

Query: 38  TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRG 97
           T   + +  ++AGPC +E  +    I + +  IC  L +  V+K+SFDKANRSS    RG
Sbjct: 13  TVGGDGKLFVLAGPCVLEEEERVLAIGQTMKDICARLGLTYVFKASFDKANRSSYTSFRG 72

Query: 98  VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQT 157
            GL+KG EI + +K     PI++D+HT +Q +  A+ +D+LQIPA LCRQTDLL AAA T
Sbjct: 73  PGLEKGLEILQRIKDTLQVPIVSDIHTAEQAKRAAEVLDVLQIPAFLCRQTDLLEAAAAT 132

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           G+ +NVKKGQF++P +M N+L K+   G ++++  ERG   GY+ LV DMR +PIM   G
Sbjct: 133 GKCVNVKKGQFMAPEDMKNVLAKMVHVGNENLMLTERGFCLGYHNLVVDMRGLPIMREFG 192

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
            PVIFDA+HSVQ PG  G  S G+RQ+I  LA+AA   GI G+F+E H +P+ A SDGPN
Sbjct: 193 YPVIFDATHSVQLPGGAGTKSSGQRQFIGNLARAAAGSGIDGVFMEVHDNPEEALSDGPN 252

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
           M+ +  +  +L  + AI +I K
Sbjct: 253 MLYLSQVEAVLRDMTAIHEITK 274


>gi|328676682|gb|AEB27552.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Francisella cf. novicida Fx1]
          Length = 275

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 178/259 (68%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   RG+G+
Sbjct: 10  NGKPFFLMSGPCVIESEQMAMDTAGYLAEVTRDLGINFVYKSSFDKANRSSINSFRGLGV 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    + GR 
Sbjct: 70  DKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVCKQGRP 129

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM + G PV
Sbjct: 130 VNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKATGCPV 189

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDGPN   
Sbjct: 190 VFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDGPNSFP 249

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  + + LS L  +D ++K
Sbjct: 250 MYKIKEFLSLLKELDHLVK 268


>gi|257464825|ref|ZP_05629196.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus minor
           202]
 gi|257450485|gb|EEV24528.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus minor
           202]
          Length = 284

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 181/278 (65%), Gaps = 6/278 (2%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN  + LG     +  +N + FVL  G   +ES D A  + EK   + Q L +  V+K+S
Sbjct: 2   TNKVVTLG----HIEIANNKPFVLFGGMNVLESRDMAMQVCEKYVEVTQKLGVPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G  IF++LK+ +G  I+TDVH   QC+ +AD VDI+Q+PA 
Sbjct: 58  FDKANRSSIHSYRGPGMEEGLNIFQELKETFGVKIITDVHEIHQCQPVADVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ L
Sbjct: 118 LARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGTNFGYDNL 177

Query: 204 VTDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           V DM    +M   S G PVIFD +HS+Q     G  SGG R  +  LA+A +AIG+AG+F
Sbjct: 178 VVDMLGFNVMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARAGMAIGLAGLF 237

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           LE H DP+NA  DGP+ + +  L   +SQ+ AID ++K
Sbjct: 238 LEAHPDPNNAKCDGPSALPLSKLEAFVSQMKAIDDLVK 275


>gi|291614344|ref|YP_003524501.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sideroxydans
           lithotrophicus ES-1]
 gi|291584456|gb|ADE12114.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sideroxydans
           lithotrophicus ES-1]
          Length = 283

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 135/259 (52%), Positives = 180/259 (69%), Gaps = 1/259 (0%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++   LIAGPC IES   A   A +L  ICQ L I  +YKSS+DKANRSS    RG G++
Sbjct: 11  DKPLFLIAGPCVIESEQMALDTAGQLKEICQKLGIPFIYKSSYDKANRSSGKTFRGFGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +I   +K + G P+LTDVHTE +   +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  AGLKILEKVKAQIGVPVLTDVHTEDEIAPVAAVVDVLQTPAFLCRQTDFIHAVARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-HAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           N+KKGQFLSPW+M N++ K     GA +++ CERG SFGYN LV+DMRS+ +M + G PV
Sbjct: 131 NIKKGQFLSPWDMKNVVDKAREVSGADNIMVCERGASFGYNNLVSDMRSLAVMRNTGCPV 190

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH DP  A SDGPN   
Sbjct: 191 VFDATHSVQLPGGQGTASGGQREFVPVLARAAVAAGVAGLFMETHPDPAKALSDGPNAFP 250

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  L +LL  L A+D ++K
Sbjct: 251 LGHLQELLQTLKALDVLVK 269


>gi|124268031|ref|YP_001022035.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylibium
           petroleiphilum PM1]
 gi|158512863|sp|A2SJR1|KDSA_METPP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|124260806|gb|ABM95800.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase [Methylibium
           petroleiphilum PM1]
          Length = 285

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 131/264 (49%), Positives = 183/264 (69%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LI+GPC +ES      +A +L  I  +L I  ++KSS+DKANRSS    RG G++
Sbjct: 11  DRPFFLISGPCVVESEQLQMDVAGRLKEITAALGIPFIFKSSYDKANRSSGTSFRGPGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +++    P+LTDVH+E +   +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  KGLEILAKVRRDLQVPVLTDVHSEAEIPVVAQHVDVLQTPAFLCRQTDFIRAVAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQK----LHAHGAKDVLF--CERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++QK        G  D +F  CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPGDMKNVIQKARDAAREKGLPDDVFMACERGASFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  L++AA+A+G+AG+F+ETH DP  A SDG
Sbjct: 191 TGSPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAIAVGVAGVFMETHPDPAKALSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +K +  LL QL++ID++IK
Sbjct: 251 PNAVPLKHMKALLEQLVSIDRVIK 274


>gi|114777197|ref|ZP_01452208.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Mariprofundus
           ferrooxydans PV-1]
 gi|114552342|gb|EAU54825.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Mariprofundus
           ferrooxydans PV-1]
          Length = 274

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 180/261 (68%)

Query: 39  FSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGV 98
             NE   VL+AGPC IE        AE + AI     + LV+KSSFDKANR+S  G RG 
Sbjct: 13  LGNELPLVLLAGPCVIEGEAFTLKTAESIAAIAGRCGVPLVFKSSFDKANRTSKDGFRGP 72

Query: 99  GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTG 158
           GL +G  I + +K + G P++TDVH   Q  A+A+  DILQ PA LCRQTD + A A+TG
Sbjct: 73  GLDEGLRILQRVKDELGLPVVTDVHEMHQVAAVAEVADILQTPAFLCRQTDFIEAVARTG 132

Query: 159 RVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGV 218
           + +N+KKGQFL+PW+M ++L+K  A G ++++ CERG SFGYN LV+DMRS+ +M   G 
Sbjct: 133 KPVNIKKGQFLAPWDMKHVLEKAQATGNENIMLCERGASFGYNNLVSDMRSLLVMREFGA 192

Query: 219 PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNM 278
           P+++DA+HSVQQPG  G  +GG R+++  L++AAVA G+A +F+E H +PD A SDGPN 
Sbjct: 193 PLVYDATHSVQQPGGLGGATGGNREFVPGLSRAAVATGVAALFMEVHPEPDKAMSDGPNS 252

Query: 279 INIKDLPKLLSQLLAIDKIIK 299
           + + DL  LL+ L  +D+++K
Sbjct: 253 LALADLEALLTTLKRLDEVVK 273


>gi|258645776|ref|ZP_05733245.1| 3-deoxy-8-phosphooctulonate synthase [Dialister invisus DSM 15470]
 gi|260403147|gb|EEW96694.1| 3-deoxy-8-phosphooctulonate synthase [Dialister invisus DSM 15470]
          Length = 273

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 168/256 (65%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           R  LIAGPC IE +D   MI  ++  IC+ L +  ++K+SFDKANRSS    RG GL++G
Sbjct: 15  RLFLIAGPCVIEGYDRTLMIGREVKRICEKLGVQYIFKASFDKANRSSYHSFRGPGLEEG 74

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
             + + +KK+   P+L+DVH   Q E  A+ +D+LQIPA LCRQTDL+  AA TG+ +NV
Sbjct: 75  LRVLKSIKKELDVPVLSDVHDVTQLEKAAEVLDMLQIPAFLCRQTDLVYGAAMTGKPVNV 134

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQF++P +M N+L K+      ++   ERG SFGY+ LV DMRS PIM   G PVI+D
Sbjct: 135 KKGQFMAPEDMKNVLNKMEEAHNPNLAVTERGVSFGYHNLVVDMRSFPIMRKFGYPVIYD 194

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ PG  G  +GG+R  I  LA+AA A G+ G F+E H +P    SD  NM+ +  
Sbjct: 195 ATHSVQLPGAMGTVTGGQRDMIPYLARAAAASGVDGFFMEVHDNPPEGLSDSTNMLYLSS 254

Query: 284 LPKLLSQLLAIDKIIK 299
           L  LL  L+ I++I+K
Sbjct: 255 LEGLLKDLIKINEIVK 270


>gi|71898807|ref|ZP_00680975.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Ann-1]
 gi|71731393|gb|EAO33456.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Ann-1]
          Length = 276

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 168/257 (65%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           Q   LIAGPC IES       A  L  I   L +  ++KSSFDKANR+S +  RG GL++
Sbjct: 12  QPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSFRGPGLEE 71

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G ++   +K + G P+LTDVH     + +A  VD+LQ PA L RQTD +      G+ +N
Sbjct: 72  GLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVCAVGKPVN 131

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           +KKGQFLSPW+M  +++K  + G   +L CERG SFGYN LV+DMRS+ +M   G PV+F
Sbjct: 132 IKKGQFLSPWDMKPVVEKAKSTGNSQILVCERGASFGYNNLVSDMRSLAVMRETGCPVVF 191

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP NA SDGPN   ++
Sbjct: 192 DATHSVQLPGAQGARSGGQREFVPVLARAAVAVGISGLFAETHPDPPNALSDGPNAWPLR 251

Query: 283 DLPKLLSQLLAIDKIIK 299
            +  LL  L+ +D + K
Sbjct: 252 TMAMLLETLVELDAVTK 268


>gi|46580035|ref|YP_010843.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|48428282|sp|P61654|KDSA_DESVH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|46449451|gb|AAS96102.1| 3-deoxy-8-phosphooctulonate synthase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311233966|gb|ADP86820.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio vulgaris
           RCH1]
          Length = 273

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 131/252 (51%), Positives = 173/252 (68%), Gaps = 1/252 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           +RF+L AGPC +E  D A   A  +    ++  +  V+KSS+DKANR+S+   RG GL +
Sbjct: 16  RRFIL-AGPCALEDFDVAMETAHAVREAAEAAGLFAVFKSSWDKANRTSITSFRGPGLVR 74

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G E    ++++ G P++TD+H  +Q   +A+  DI+QIPA LCRQTDLL AAA TGRV+N
Sbjct: 75  GMEWLARIREESGLPVVTDIHLPEQAAPVAEVADIIQIPAFLCRQTDLLVAAAATGRVVN 134

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQF++PW+M   ++KL A G + +L  ERG SFGYN LV D RSIP M   GVPV+F
Sbjct: 135 VKKGQFVAPWDMRPAVEKLRAAGNERILLTERGASFGYNNLVVDYRSIPTMQGFGVPVVF 194

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGGER+++  LA+AAVA G+ G+FLE H DPD A  DGPN   + 
Sbjct: 195 DATHSVQLPGGLGGSSGGERRHVPVLARAAVAAGVDGVFLECHPDPDKALCDGPNSWPLD 254

Query: 283 DLPKLLSQLLAI 294
            LP LL +L A+
Sbjct: 255 RLPALLKELSAL 266


>gi|239816417|ref|YP_002945327.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Variovorax paradoxus
           S110]
 gi|259494409|sp|C5CSV4|KDSA_VARPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|239802994|gb|ACS20061.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Variovorax paradoxus
           S110]
          Length = 285

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 175/264 (66%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAGPC +ES       A  L  I  SL I  ++KSSFDKANRSS    RG G +
Sbjct: 11  DQPFFLIAGPCVVESEQLQMDTAGTLKEITSSLGIPFIFKSSFDKANRSSGTSFRGPGRE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +K++ G P+LTDVHTE      A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  KGLEILAKVKRELGLPVLTDVHTEDDITEAAKVVDVLQTPAFLCRQTDFIRAVAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAK------DVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K  A   +        + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARAAAKEAGLPEDSFMACERGASFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+ +  L++AAVA+G+AG+F+ETH DP  A SDG
Sbjct: 191 TGAPVVFDATHSVQLPGGQGTTSGGQREMVPVLSRAAVAVGVAGLFMETHPDPAKALSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +K +  LL  LLA+D++ K
Sbjct: 251 PNAVPLKHMKALLETLLALDQVTK 274


>gi|254374034|ref|ZP_04989516.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella novicida
           GA99-3548]
 gi|151571754|gb|EDN37408.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella novicida
           GA99-3548]
          Length = 282

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 126/259 (48%), Positives = 178/259 (68%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   RG+G+
Sbjct: 17  NGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSFRGLGV 76

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    + G+ 
Sbjct: 77  DKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVCKQGKP 136

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM + G PV
Sbjct: 137 VNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKATGCPV 196

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDGPN   
Sbjct: 197 VFDATHSVQLPGGQGSSSGGQREFVPVLSKAAIAVGIDGLFMETHPNPDEAKSDGPNSFP 256

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  + + LS L  +D ++K
Sbjct: 257 MYKIKEFLSLLKELDHLVK 275


>gi|254369703|ref|ZP_04985713.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica FSC022]
 gi|157122662|gb|EDO66791.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica FSC022]
          Length = 282

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 178/259 (68%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   RG+G+
Sbjct: 17  NGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSFRGLGV 76

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    + G+ 
Sbjct: 77  DKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVCKQGKP 136

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM + G PV
Sbjct: 137 VNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKATGCPV 196

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDGPN   
Sbjct: 197 VFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDGPNSFP 256

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  + + LS L  +D +IK
Sbjct: 257 MYKIKEFLSLLKELDHLIK 275


>gi|121609606|ref|YP_997413.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Verminephrobacter
           eiseniae EF01-2]
 gi|158514003|sp|A1WL88|KDSA_VEREI RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|121554246|gb|ABM58395.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Verminephrobacter
           eiseniae EF01-2]
          Length = 285

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 179/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           EQR  LIAGPC IES      +A +L  I   L +  ++KSSFDKANRSS +  RG G  
Sbjct: 11  EQRLFLIAGPCVIESAQLQMDVAGQLREITARLGMPFIFKSSFDKANRSSGSSYRGPGRD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   ++++   P+LTDVHTE    A A  VD+LQ PA LCRQTD ++AAA+ G+ +
Sbjct: 71  KGLEILARVRRELALPVLTDVHTEDDIAAAAQVVDVLQTPAFLCRQTDFISAAARCGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAK------DVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P EMHN++ K  A   +        + CERG SFGYN LV+DMRS+ IM +
Sbjct: 131 NIKKGQFLAPHEMHNVIDKARAAARQAGLSEDRFMACERGASFGYNNLVSDMRSLAIMRA 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+ +  LA+AAVA G+AGIF+ETH DPD A SDG
Sbjct: 191 SGAPVVFDATHSVQLPGSQGSRSGGQREMVPVLARAAVAAGVAGIFMETHPDPDRALSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +K +  LL  L+A+D + K
Sbjct: 251 PNAVPLKHMQALLETLVALDGVTK 274


>gi|119775693|ref|YP_928433.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella amazonensis
           SB2B]
 gi|158513092|sp|A1S8Q7|KDSA_SHEAM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|119768193|gb|ABM00764.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Shewanella amazonensis SB2B]
          Length = 282

 Score =  261 bits (668), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 123/263 (46%), Positives = 178/263 (67%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  IAEK   + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IAIANDKPFVLFGGMNVLESRDLAMSIAEKYLEVTQKLGIPYVFKASFDKANRSSINSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF+++K  +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQEIKDTFNVPLITDVHEPHQCAPVAEVVDIIQLPAFLARQTDLVIAMAR 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG +INVKK QFL+P EM +I++K +  G  +++ CERG+ FGYN LV DM  +  M   
Sbjct: 131 TGAIINVKKPQFLAPHEMRHIVKKFNEAGNDEIILCERGSCFGYNNLVVDMLGMDEMKQS 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  DGP
Sbjct: 191 GYPVIFDATHALQRPGGREDSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   LSQ+ A+D ++K
Sbjct: 251 CALPLHQLEAYLSQMKAVDDLVK 273


>gi|328675738|gb|AEB28413.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Francisella cf. novicida 3523]
          Length = 275

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 126/259 (48%), Positives = 176/259 (67%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F L++GPC IES   A   A  L  +   L I  VYKSSFDKANRSS+   RG+G+
Sbjct: 10  NGKPFFLMSGPCVIESEQMAMDTAGYLTEVTNDLGINFVYKSSFDKANRSSINSFRGLGV 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    + G+ 
Sbjct: 70  DKGLEILAKVKKTYNIPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFIVEVCKQGKP 129

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M N++ K  + G + ++ CERG SFGYN LV+DMRS+ IM + G PV
Sbjct: 130 VNIKKGQFLAPWDMQNVVAKAKSTGNQQIMVCERGVSFGYNNLVSDMRSLEIMKATGCPV 189

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+ I G+F+ETH +PD A SDGPN   
Sbjct: 190 VFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVSIDGLFMETHPNPDEAKSDGPNSFP 249

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  + + LS L  +D ++K
Sbjct: 250 MYKIKEFLSLLKELDHLVK 268


>gi|51244617|ref|YP_064501.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfotalea
           psychrophila LSv54]
 gi|59798233|sp|Q6AQ79|KDSA_DESPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|50875654|emb|CAG35494.1| probable 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfotalea
           psychrophila LSv54]
          Length = 280

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 176/260 (67%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           + +   + Q  +LI GPC +ES      +AE +  IC+ L I  V+K+SFDKANR+S++ 
Sbjct: 15  SDILVGSGQPLLLIGGPCSLESEQLGREVAETVSKICKKLGISYVFKASFDKANRTSISS 74

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GLKKG      +++    P+++D+H   Q    A+ +DI+QIPA LCRQTDLL AA
Sbjct: 75  YRGPGLKKGLASLARIREDLQVPVISDIHDISQVGPAAEVLDIIQIPAFLCRQTDLLVAA 134

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A++G+ +NVKKGQF+SPW+M N + KL   G+  V+  ERG  FGYN LV DMRS+P+M 
Sbjct: 135 AKSGKPVNVKKGQFVSPWDMENAIGKLRDAGSDKVMLVERGACFGYNNLVVDMRSLPVMR 194

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S   PVI+DA+HSVQ PG  G  S G+R++I PL+KAA+A GI G+F+E H DPD A  D
Sbjct: 195 SFNCPVIYDATHSVQLPGGAGGSSSGQREFIEPLSKAAIAAGIDGLFMEIHPDPDKALCD 254

Query: 275 GPNMINIKDLPKLLSQLLAI 294
           GPN I +  + +LL++L+ +
Sbjct: 255 GPNSIALDQVEELLTKLVKV 274


>gi|56707821|ref|YP_169717.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110670292|ref|YP_666849.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis FSC198]
 gi|134302406|ref|YP_001122376.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|254370317|ref|ZP_04986322.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254372575|ref|ZP_04988064.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254874635|ref|ZP_05247345.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|56604313|emb|CAG45334.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320625|emb|CAL08717.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis FSC198]
 gi|134050183|gb|ABO47254.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|151568560|gb|EDN34214.1| hypothetical protein FTBG_00072 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|151570302|gb|EDN35956.1| 3-deoxy-8-phosphooctulonate synthase [Francisella novicida
           GA99-3549]
 gi|254840634|gb|EET19070.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis MA00-2987]
          Length = 282

 Score =  261 bits (667), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 126/259 (48%), Positives = 178/259 (68%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   RG+G+
Sbjct: 17  NGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSFRGLGV 76

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    + G+ 
Sbjct: 77  DKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVCKQGKP 136

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM + G PV
Sbjct: 137 VNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKATGCPV 196

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDGPN   
Sbjct: 197 VFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDGPNSFP 256

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  + + LS L  +D ++K
Sbjct: 257 MYKIKEFLSLLKELDHLVK 275


>gi|62258804|gb|AAX77821.1| unknown protein [synthetic construct]
          Length = 317

 Score =  261 bits (667), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 185/283 (65%), Gaps = 1/283 (0%)

Query: 17  DKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNI 76
           D  HM+      +L    N     N + F L++GPC IES   A   A  L  + + L I
Sbjct: 20  DDKHMLEVYLNKNLMKIAN-FEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGI 78

Query: 77  GLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD 136
             VYKSSFDKANRSS+   RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD
Sbjct: 79  NFVYKSSFDKANRSSINSFRGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVD 138

Query: 137 ILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGT 196
           +LQ PA LCRQT+ +    + G+ +N+KKGQFL+PW+M +++ K  + G + ++ CERG 
Sbjct: 139 VLQTPAFLCRQTNFILEVCKQGKPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGV 198

Query: 197 SFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIG 256
           SFGYN LV+DMRS+ IM + G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+G
Sbjct: 199 SFGYNNLVSDMRSLEIMKATGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVG 258

Query: 257 IAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           I G+F+ETH +PD A SDGPN   +  + + LS L  +D ++K
Sbjct: 259 IDGLFMETHPNPDEAKSDGPNSFPMYKIKEFLSLLKELDHLVK 301


>gi|71041554|pdb|1T8X|A Chain A, R106g Kdo8ps With Pep And A5p
 gi|71041555|pdb|1T8X|B Chain B, R106g Kdo8ps With Pep And A5p
 gi|71041556|pdb|1T96|A Chain A, R106g Kdo8ps With Pep
 gi|71041557|pdb|1T96|B Chain B, R106g Kdo8ps With Pep
 gi|71041558|pdb|1T99|A Chain A, R106g Kdo8ps Without Substrates
 gi|71041559|pdb|1T99|B Chain B, R106g Kdo8ps Without Substrates
 gi|78101063|pdb|1ZHA|A Chain A, A. Aeolicus Kdo8ps R106g Mutant In Complex With Pep And
           R5p
 gi|78101064|pdb|1ZHA|B Chain B, A. Aeolicus Kdo8ps R106g Mutant In Complex With Pep And
           R5p
 gi|78101068|pdb|1ZJI|A Chain A, Aquifex Aeolicus Kdo8ps R106g Mutant In Complex With 2pga
           And R5p
 gi|78101069|pdb|1ZJI|B Chain B, Aquifex Aeolicus Kdo8ps R106g Mutant In Complex With 2pga
           And R5p
          Length = 267

 Score =  261 bits (667), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 175/256 (68%), Gaps = 2/256 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGPC IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 2   EKFLVIAGPCAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LC QTDLL AAA+TGR +
Sbjct: 62  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCGQTDLLLAAAKTGRAV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 122 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQWA-KVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD    + +
Sbjct: 181 YDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDASTQLPL 240

Query: 282 KDLPKLLSQLLAIDKI 297
             L  ++  +L I ++
Sbjct: 241 SQLEGIIEAILEIREV 256


>gi|23296073|gb|AAN12290.1| 3-deoxy-D-manno-2-octulosonate-8-phosphate synthase [Aquifex
           pyrophilus]
          Length = 267

 Score =  261 bits (667), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 125/256 (48%), Positives = 175/256 (68%), Gaps = 2/256 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGPC IES      +AEK+  +     ++  V+KSSFDKANRSS+   RG GL 
Sbjct: 2   EKFLIIAGPCAIESESLVLRVAEKIRELQDKFRDVEFVFKSSFDKANRSSIHSFRGHGLD 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G    TD+H   Q E + + VDI+QIPA LCRQTDLL AAA+TG+ +
Sbjct: 62  YGLKALRRVKEEFGLKTTTDIHESWQAEPVGEVVDIIQIPAFLCRQTDLLLAAAKTGKPV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGTSFGYN LV D RS+PIM      VI
Sbjct: 122 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTSFGYNNLVVDFRSLPIMKQYA-KVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD    + +
Sbjct: 181 YDATHSVQLPGGLGDKSGGMREFIFPLLRAAVAVGCDGVFMETHPEPEKALSDSATQLPL 240

Query: 282 KDLPKLLSQLLAIDKI 297
            +L  ++  +L I ++
Sbjct: 241 GELDGIVEAILEIKQV 256


>gi|332701427|ref|ZP_08421515.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332551576|gb|EGJ48620.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 279

 Score =  261 bits (667), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 136/277 (49%), Positives = 180/277 (64%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           N  I + +    V  SN    V IAGPC +E  D A   A +L  I ++  +  +YKSSF
Sbjct: 3   NKQIIISAPGKSVLMSNSLPLVFIAGPCAMEGRDFALRTALELREIFEAAGVDFIYKSSF 62

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANR+S    RGVG+ +G +I  ++++K G P++TDVH+ +Q   +A  VD+LQ PA L
Sbjct: 63  DKANRTSSGSFRGVGMDEGLDILAEVREKAGVPVITDVHSPEQAAPVAAVVDMLQTPAFL 122

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
           CRQTDL+ A A TG+ +N+KKGQFL+PW+M N+L K    G + +  CERG SFGY  LV
Sbjct: 123 CRQTDLIRAVAATGKPVNIKKGQFLAPWDMKNVLSKALEEGNEQIALCERGASFGYGNLV 182

Query: 205 TDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET 264
            DMRS  IM   G PV+FD +HSVQ PG  G+ SGG+R ++  LA+A VA G+A +F+E 
Sbjct: 183 VDMRSFAIMAETGQPVVFDVTHSVQLPGGLGSSSGGQRHFVPTLARAGVAAGVAALFMEV 242

Query: 265 HQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           H DPD AP DGPNMI   +LPKLL  L  +D + K L
Sbjct: 243 HPDPDKAPCDGPNMIPFSELPKLLRLLKEMDALAKGL 279


>gi|27065434|pdb|1LRN|A Chain A, Aquifex Aeolicus Kdo8p Synthase H185g Mutant In Complex
           With Cadmium
 gi|27065435|pdb|1LRN|B Chain B, Aquifex Aeolicus Kdo8p Synthase H185g Mutant In Complex
           With Cadmium
 gi|27065436|pdb|1LRO|A Chain A, Aquifex Aeolicus Kdo8p Synthase H185g Mutant In Complex
           With Pep And Cadmium
 gi|27065437|pdb|1LRO|B Chain B, Aquifex Aeolicus Kdo8p Synthase H185g Mutant In Complex
           With Pep And Cadmium
 gi|27065438|pdb|1LRQ|A Chain A, Aquifex Aeolicus Kdo8p Synthase H185g Mutant In Complex
           With Pep, A5p And Cadmium
 gi|27065439|pdb|1LRQ|B Chain B, Aquifex Aeolicus Kdo8p Synthase H185g Mutant In Complex
           With Pep, A5p And Cadmium
          Length = 267

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 175/256 (68%), Gaps = 2/256 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGPC IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 2   EKFLVIAGPCAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LCRQTDLL AAA+TGR +
Sbjct: 62  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 122 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQWA-KVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+ SVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD    + +
Sbjct: 181 YDATGSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDASTQLPL 240

Query: 282 KDLPKLLSQLLAIDKI 297
             L  ++  +L I ++
Sbjct: 241 SQLEGIIEAILEIREV 256


>gi|312897539|ref|ZP_07756959.1| 3-deoxy-8-phosphooctulonate synthase [Megasphaera micronuciformis
           F0359]
 gi|310621391|gb|EFQ04931.1| 3-deoxy-8-phosphooctulonate synthase [Megasphaera micronuciformis
           F0359]
          Length = 277

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/254 (49%), Positives = 173/254 (68%), Gaps = 1/254 (0%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           FVL AGPC IE  +    I  ++  IC+ L +  V+K+SFDKANRSS    RG GL++G 
Sbjct: 17  FVL-AGPCVIEDPERTLNIGREMKKICEKLGLPYVFKASFDKANRSSFTSYRGPGLEEGL 75

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           +I   +KK+   P+++D+H  +Q E  A+ +DILQIPA LCRQTDLL AAA TG+ +NVK
Sbjct: 76  KILGHIKKELNVPVVSDIHAVEQVEKAAEVLDILQIPAFLCRQTDLLEAAAATGKCVNVK 135

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+P +M N++QK+   G ++++  ERG + GY+ LV DMRS PIM S G PV+FDA
Sbjct: 136 KGQFLAPEDMGNVVQKILHKGNENLMLTERGVTMGYHNLVVDMRSFPIMRSFGYPVVFDA 195

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G  S G+RQ+I  LA+AA   GI G+F+E H +P  A SDGPN + +  +
Sbjct: 196 THSVQLPGGGGTKSTGQRQFIGNLARAAAGSGIDGVFMEVHDNPAEALSDGPNSLYLSQV 255

Query: 285 PKLLSQLLAIDKII 298
             +L  ++AI  I+
Sbjct: 256 EGVLRDMVAIHSIV 269


>gi|77747541|ref|NP_298578.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa 9a5c]
 gi|20532145|sp|Q9PDU0|KDSA_XYLFA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
          Length = 276

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 167/257 (64%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           Q   LIAGPC IES       A  L  I   L +  ++KSSFDKANR+S +  RG GL++
Sbjct: 12  QPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSFRGPGLEE 71

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G ++   +K + G P+LTDVH     + +A  VD+LQ PA L RQTD +      G+ +N
Sbjct: 72  GLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVCAVGKPVN 131

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           +KKGQFLSPW+M  +++K  + G   +L CERG SFGYN LV+DMRS+ +M   G PV+F
Sbjct: 132 IKKGQFLSPWDMKPVVEKAKSTGNSQILVCERGASFGYNNLVSDMRSLAVMRETGCPVVF 191

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP NA SDGPN   + 
Sbjct: 192 DATHSVQLPGAQGGRSGGQREFVPVLARAAVAVGISGLFAETHPDPPNALSDGPNAWPLH 251

Query: 283 DLPKLLSQLLAIDKIIK 299
            +  LL  L+ +D + K
Sbjct: 252 TMAMLLETLVELDAVTK 268


>gi|118497210|ref|YP_898260.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. novicida U112]
 gi|194323509|ref|ZP_03057286.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           novicida FTE]
 gi|254807746|sp|A0Q5J1|KDSA_FRATN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|118423116|gb|ABK89506.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthase [Francisella
           novicida U112]
 gi|194322364|gb|EDX19845.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           novicida FTE]
          Length = 275

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/259 (48%), Positives = 178/259 (68%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   RG+G+
Sbjct: 10  NGKPFFLMSGPCVIESEQMAMDTAGYLAEVTRDLGINFVYKSSFDKANRSSINSFRGLGV 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    + G+ 
Sbjct: 70  DKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVCKQGKP 129

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM + G PV
Sbjct: 130 VNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKATGCPV 189

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDGPN   
Sbjct: 190 VFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDGPNSFP 249

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  + + LS L  +D ++K
Sbjct: 250 MYKIKEFLSLLKELDHLVK 268


>gi|224456892|ref|ZP_03665365.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|282158997|gb|ADA78388.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis NE061598]
          Length = 275

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/259 (48%), Positives = 178/259 (68%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   RG+G+
Sbjct: 10  NGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSFRGLGV 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    + G+ 
Sbjct: 70  DKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVCKQGKP 129

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM + G PV
Sbjct: 130 VNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKATGCPV 189

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDGPN   
Sbjct: 190 VFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDGPNSFP 249

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  + + LS L  +D ++K
Sbjct: 250 MYKIKEFLSLLKELDHLVK 268


>gi|9106278|gb|AAF84098.1|AE003962_8 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa 9a5c]
          Length = 295

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 167/257 (64%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           Q   LIAGPC IES       A  L  I   L +  ++KSSFDKANR+S +  RG GL++
Sbjct: 31  QPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSFRGPGLEE 90

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G ++   +K + G P+LTDVH     + +A  VD+LQ PA L RQTD +      G+ +N
Sbjct: 91  GLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVCAVGKPVN 150

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           +KKGQFLSPW+M  +++K  + G   +L CERG SFGYN LV+DMRS+ +M   G PV+F
Sbjct: 151 IKKGQFLSPWDMKPVVEKAKSTGNSQILVCERGASFGYNNLVSDMRSLAVMRETGCPVVF 210

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP NA SDGPN   + 
Sbjct: 211 DATHSVQLPGAQGGRSGGQREFVPVLARAAVAVGISGLFAETHPDPPNALSDGPNAWPLH 270

Query: 283 DLPKLLSQLLAIDKIIK 299
            +  LL  L+ +D + K
Sbjct: 271 TMAMLLETLVELDAVTK 287


>gi|225025649|ref|ZP_03714841.1| hypothetical protein EIKCOROL_02551 [Eikenella corrodens ATCC
           23834]
 gi|224941599|gb|EEG22808.1| hypothetical protein EIKCOROL_02551 [Eikenella corrodens ATCC
           23834]
          Length = 283

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 128/262 (48%), Positives = 169/262 (64%)

Query: 38  TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRG 97
           T +N + FVL  G   +ES D A  IAE    IC+ L+I  V+K+SFDKANRSSL   RG
Sbjct: 14  TIANHRPFVLFGGMNVLESRDLAMEIAETYIEICRKLDIPYVFKASFDKANRSSLHSFRG 73

Query: 98  VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQT 157
            GL+KG +   D+K  Y  P++TD+H   Q    A+  DILQ+PA L RQTDL+ A A+T
Sbjct: 74  PGLEKGLQWLADIKAAYNVPVITDIHEPYQAAPAAEVADILQLPAFLSRQTDLVHAMART 133

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           G +INVKK QFL+P EM +I+ K    G   ++ CERG++FGYN LV DM     M  M 
Sbjct: 134 GAIINVKKAQFLAPHEMRHIINKCLEAGNDKIILCERGSAFGYNNLVVDMLGFDTMKQMN 193

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
           VPV FD +HS+QQPG   + +GG R+ IV LA+A +A+G+AG+FLE H DP+ A  DGP 
Sbjct: 194 VPVFFDVTHSLQQPGARSDSAGGRREQIVTLARAGMAVGLAGLFLEAHPDPEQAKCDGPC 253

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
            + +  L   L+QL  ID ++K
Sbjct: 254 ALRLSQLEPFLNQLKQIDNLVK 275


>gi|224369872|ref|YP_002604036.1| KdsA [Desulfobacterium autotrophicum HRM2]
 gi|223692589|gb|ACN15872.1| KdsA [Desulfobacterium autotrophicum HRM2]
          Length = 276

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 131/257 (50%), Positives = 175/257 (68%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F+LIAGPC IE +D  F  A +L  I   L I  ++KSSFDKANRSS+   RG G +KG 
Sbjct: 16  FLLIAGPCVIEDYDTTFHTASQLKKITDGLGIPFIFKSSFDKANRSSIDSYRGPGFEKGL 75

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           EI   +K++ G  I++D+H  +Q    A  +D+LQIPA LCRQTDL+TAAA+TG+ +N+K
Sbjct: 76  EILAAIKQQLGVKIISDIHLPEQAGPAAKVLDVLQIPAFLCRQTDLITAAARTGKPLNIK 135

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+P E  NI++K  A G   +   ERG+SFGYN LV D R+I I+ S+GVPV+FDA
Sbjct: 136 KGQFLAPLECRNIIKKAQAAGCTRLSITERGSSFGYNNLVVDFRAIDIIRSLGVPVVFDA 195

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G  S G+R++   LA+AA+A G  G+F+ETH DPD A  DGPN + +  +
Sbjct: 196 THSVQLPGGAGTTSAGDRKFAPTLARAAIAAGADGLFIETHPDPDRALCDGPNSVPLAQM 255

Query: 285 PKLLSQLLAIDKIIKPL 301
              L  L+AI  ++ PL
Sbjct: 256 QSFLEPLIAIRTVVAPL 272


>gi|284049014|ref|YP_003399353.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidaminococcus
           fermentans DSM 20731]
 gi|283953235|gb|ADB48038.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidaminococcus
           fermentans DSM 20731]
          Length = 274

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 182/253 (71%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
            +++AGPC +E ++ +  I  ++ AIC  L +  V+K+S+DKANRSSL   RG GL++G 
Sbjct: 17  LLIMAGPCVLEGYERSLAIGRRVKAICDKLGLPYVFKASYDKANRSSLDSFRGPGLEEGL 76

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           +I   +KK  G P+++DVH   Q E  A+ +DI+QIPA LCRQTDLL  AA+TG+V+NVK
Sbjct: 77  QILAQIKKDLGVPVISDVHETCQVEKAAEVLDIIQIPAFLCRQTDLLVEAARTGKVVNVK 136

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+PW+M N++ K+   G+++++  ERG SFGYNTLVTDMRS+PIM  +G PVI D 
Sbjct: 137 KGQFLAPWDMKNVVNKIVESGSRNLMLTERGVSFGYNTLVTDMRSLPIMRDLGFPVIMDV 196

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G  SGG+ +Y   +A+AA A+G+ G+F+ETH +P  A SDGPNMI +  L
Sbjct: 197 THSVQIPGGQGTSSGGQSKYAPHMARAAAAVGVDGLFIETHDNPAEALSDGPNMIPLDRL 256

Query: 285 PKLLSQLLAIDKI 297
            ++L+   AID I
Sbjct: 257 EQVLADAKAIDAI 269


>gi|148244893|ref|YP_001219587.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Vesicomyosocius okutanii HA]
 gi|254807753|sp|A5CW13|KDSA_VESOH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|146326720|dbj|BAF61863.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Vesicomyosocius okutanii HA]
          Length = 277

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 171/255 (67%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F LIAGPC IES   A   A  L  + + L I  +YKSS+DKANR+S    RG+G+K+G 
Sbjct: 14  FFLIAGPCVIESEALALETATYLKRVTEDLGINFIYKSSYDKANRTSTNSFRGLGVKEGL 73

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            I + +K + G P+LTDVH +     +A  VD++Q PA L RQT+ +    + G  +N+K
Sbjct: 74  RILQKVKDEVGVPVLTDVHEDTPLSEVASVVDMMQTPAFLVRQTNFIQNVCKQGIPVNIK 133

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQF +PW++ N++ K +  G + +  CERGTSFGYNTL++DMR +  M S G P++FDA
Sbjct: 134 KGQFQAPWDIGNVVNKAYETGNRLITICERGTSFGYNTLISDMRGLSTMRSTGCPIVFDA 193

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQQPG +G  SGG+R+ +  +A+AA+ +G++G F+ETH +P+ A SDGPNM+ I  +
Sbjct: 194 THSVQQPGGNGLTSGGQREMVPVVARAAIGVGVSGFFMETHPNPNEAFSDGPNMVPIDKI 253

Query: 285 PKLLSQLLAIDKIIK 299
            +LL  L  +D + K
Sbjct: 254 DELLKTLQELDAVTK 268


>gi|312879640|ref|ZP_07739440.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aminomonas paucivorans
           DSM 12260]
 gi|310782931|gb|EFQ23329.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aminomonas paucivorans
           DSM 12260]
          Length = 284

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 117/257 (45%), Positives = 174/257 (67%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             + AGPC +E  + A  IAE    +C+    G  +K+SFDKANR+S+   RG GL++G 
Sbjct: 19  LTVFAGPCVLEDPEEALRIAETCQTLCRERGFGYAFKASFDKANRTSIHSFRGPGLEEGL 78

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           ++   ++++ G P+LTD+H   Q + +A+ V  LQIPA LCRQTDL+ AAA+TGR +NVK
Sbjct: 79  KVLAGVRRRLGVPLLTDIHEAAQADPVAEVVQFLQIPAFLCRQTDLVVAAARTGRALNVK 138

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           K QFL+P +M  +++K    G + VL CERG+ FGY+ LV D RS+ I+  +G PV+FD 
Sbjct: 139 KAQFLAPEDMVPVVEKCREAGNERVLLCERGSVFGYHQLVVDFRSLSILRGLGCPVVFDG 198

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ  G  G+ SGG+R+++ PL +AAVA G+  +FLE H +P  A SDGPN++ +  L
Sbjct: 199 THSVQSMGGLGSASGGDRRFVRPLVRAAVAAGVDALFLEVHPEPARAKSDGPNLVPLDAL 258

Query: 285 PKLLSQLLAIDKIIKPL 301
           P+LL ++ A+  +++ L
Sbjct: 259 PRLLDEVKALHDVVRTL 275


>gi|146386957|pdb|2NWR|A Chain A, Crystal Structure Of C11n Mutant Of Kdo8p Synthase In
           Complex With Pep
 gi|146386958|pdb|2NWR|B Chain B, Crystal Structure Of C11n Mutant Of Kdo8p Synthase In
           Complex With Pep
 gi|146386959|pdb|2NWS|A Chain A, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386960|pdb|2NWS|B Chain B, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386963|pdb|2NX1|A Chain A, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386964|pdb|2NX1|B Chain B, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
          Length = 267

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 175/256 (68%), Gaps = 2/256 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGP  IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 2   EKFLVIAGPNAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LCRQTDLL AAA+TGR +
Sbjct: 62  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 122 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQWA-KVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD    + +
Sbjct: 181 YDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDASTQLPL 240

Query: 282 KDLPKLLSQLLAIDKI 297
             L  ++  +L I ++
Sbjct: 241 SQLEGIIEAILEIREV 256


>gi|119898436|ref|YP_933649.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Azoarcus sp. BH72]
 gi|158512911|sp|A1K7F7|KDSA_AZOSB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|119670849|emb|CAL94762.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Azoarcus sp. BH72]
          Length = 279

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 136/255 (53%), Positives = 181/255 (70%), Gaps = 2/255 (0%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LIAGPC IES + AF  A  L  IC  + I  +YKSS+DKANRSS    RG+G++KG +I
Sbjct: 16  LIAGPCVIESREMAFETAGALKDICAEVGIPFIYKSSYDKANRSSGKSYRGMGMEKGLDI 75

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
             D+KK+ G P+LTDVH+ ++  A+A  VD+LQ PA LCRQTD + A A  GR +N+KKG
Sbjct: 76  LADVKKQLGVPVLTDVHSIEEIPAVAAVVDVLQTPAFLCRQTDFIHAVASCGRPVNIKKG 135

Query: 167 QFLSPWEMHNILQKLHAH--GAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           QFL+P +M N++ K      GA +++ CERG SFGYN LV+DMRS+ IM   G PV+FDA
Sbjct: 136 QFLAPGDMKNVVDKAREANGGADNIMVCERGASFGYNNLVSDMRSLAIMRETGCPVVFDA 195

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G  SGG+R+++  LA+AAVA+G+AG+F+ETH +P  A SDGPN   +  +
Sbjct: 196 THSVQLPGGQGTASGGQREFVPVLARAAVAVGVAGLFMETHPNPAQALSDGPNAWPLPRM 255

Query: 285 PKLLSQLLAIDKIIK 299
             LLS L AID+++K
Sbjct: 256 KALLSTLKAIDELVK 270


>gi|240950070|ref|ZP_04754372.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus minor
           NM305]
 gi|240295445|gb|EER46200.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus minor
           NM305]
          Length = 284

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 181/278 (65%), Gaps = 6/278 (2%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN  + LG     +  +N + FVL  G   +ES D A  + EK   + Q L +  V+K+S
Sbjct: 2   TNKVVTLG----HIEIANNKPFVLFGGMNVLESRDMAMQVCEKYVEVTQKLGVPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF++LK+ +G  I+TDVH   QC+ +AD VDI+Q+PA 
Sbjct: 58  FDKANRSSIHSYRGPGMEEGLKIFQELKETFGVKIITDVHEIHQCQPVADVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ L
Sbjct: 118 LARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGTNFGYDNL 177

Query: 204 VTDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           V DM    +M   S G PVIFD +HS+Q     G  SGG R  +  LA+A +AIG+AG+F
Sbjct: 178 VVDMLGFNVMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARAGMAIGLAGLF 237

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           LE H DP+ A  DGP+ + +  L   +SQ+ AID ++K
Sbjct: 238 LEAHPDPNKAKCDGPSALPLSKLEAFVSQMKAIDDLVK 275


>gi|163750762|ref|ZP_02157997.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella benthica
           KT99]
 gi|161329457|gb|EDQ00451.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella benthica
           KT99]
          Length = 282

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 182/276 (65%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I LG     +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKVIVLGD----IEIANDKPFVLFGGMNVLESRDLAMKIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF+++K+ +  P++TDVH   QC  +A+ VDI+Q+PA 
Sbjct: 58  FDKANRSSINSYRGPGMEEGLKIFQEIKQTFNLPLITDVHEIHQCAPVAEVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN L
Sbjct: 118 LARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDNIILCERGSSFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFD +H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQSGYPVIFDVTHALQRPGGRTDSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L+Q+ A+D ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLDQLENYLTQMKAVDDLVK 273


>gi|303257814|ref|ZP_07343824.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderiales bacterium
           1_1_47]
 gi|330998764|ref|ZP_08322492.1| 3-deoxy-8-phosphooctulonate synthase [Parasutterella
           excrementihominis YIT 11859]
 gi|302859417|gb|EFL82498.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderiales bacterium
           1_1_47]
 gi|329576261|gb|EGG57777.1| 3-deoxy-8-phosphooctulonate synthase [Parasutterella
           excrementihominis YIT 11859]
          Length = 284

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 172/261 (65%), Gaps = 6/261 (2%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F+L+AGPC IES      IA K+  I   L I  V+K+S+DKANRSS    RG+G+  G 
Sbjct: 14  FILLAGPCVIESEQLTLDIAGKMKEITDKLGIPYVFKASYDKANRSSDTSFRGLGMTNGL 73

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            I  +++++ G P++TDVHT  +   +A  VD+LQ PA LCRQTD + A A++G+ +N+K
Sbjct: 74  RILEEVRRQIGVPVVTDVHTADEVPEVAAVVDLLQTPAFLCRQTDFIAACAKSGKPVNIK 133

Query: 165 KGQFLSPWEMHNILQKLH------AHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGV 218
           KGQFL+P +M  ++ K               + CERG  FGYN LV+DMRS+ IM     
Sbjct: 134 KGQFLAPQDMKQVVLKARHAAAAAGLSEDRFMVCERGACFGYNNLVSDMRSLVIMRDCDA 193

Query: 219 PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNM 278
           PVIFDA+HSVQ PG  G  SGG R+++ PLA+AAVA+G++G+F+ETH +P  A SDGPNM
Sbjct: 194 PVIFDATHSVQLPGGQGTSSGGRREFVPPLARAAVAVGVSGLFMETHPNPCCAKSDGPNM 253

Query: 279 INIKDLPKLLSQLLAIDKIIK 299
           + +  +  LL+ L  ID+++K
Sbjct: 254 VPLDKMEALLTNLQGIDRLVK 274


>gi|91202075|emb|CAJ75135.1| strongly similar to 3-deoxy-D-manno-octulosonate 8-phosphate
           synthase [Candidatus Kuenenia stuttgartiensis]
          Length = 277

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/270 (46%), Positives = 177/270 (65%), Gaps = 5/270 (1%)

Query: 35  NQVTFSN----EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRS 90
           N++  +N    E     IAGPC IES +  F +AE L  I        ++K+S+DKANR+
Sbjct: 3   NKIPLNNFSIGESELFFIAGPCIIESEESCFRLAETLKDIFLKNKAPFIFKASYDKANRT 62

Query: 91  SLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDL 150
           S+   RG G+ KG EI R +K++   PIL+DVH  ++    AD +DI+QIPA LCRQTDL
Sbjct: 63  SVHSYRGPGITKGLEILRKIKERLKIPILSDVHCTEEISMAADVLDIIQIPAFLCRQTDL 122

Query: 151 LTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSI 210
           + AAA TG+ +N+KKGQFLSPW+M ++++K+ + G   +L  ERG  FGYN LV+DMRS+
Sbjct: 123 IVAAADTGKPVNIKKGQFLSPWDMKSVVEKIRSTGNGQILLTERGACFGYNNLVSDMRSL 182

Query: 211 PIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAI-GIAGIFLETHQDPD 269
            IM ++  PVIFDA+HS Q PG  G+ SGG+R  + PLA+AA+A  G  G+FLE H+ P+
Sbjct: 183 IIMKTLNCPVIFDATHSTQLPGGQGSMSGGDRTMVAPLARAAIATGGCDGLFLEVHEHPE 242

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SD   M+ + +L  L+ Q   I  I++
Sbjct: 243 RALSDAATMLPLNELQFLIEQTKDIYNIVR 272


>gi|71907984|ref|YP_285571.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dechloromonas aromatica
           RCB]
 gi|123760465|sp|Q47DI0|KDSA_DECAR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|71847605|gb|AAZ47101.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dechloromonas aromatica
           RCB]
          Length = 278

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 181/260 (69%), Gaps = 2/260 (0%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAGPC  ES      +A  +  +C  L I  ++K+S+DKANRSS    RG+GL+
Sbjct: 11  DQPFFLIAGPCTAESEQLCLDVAGHMKEVCARLGINYIFKASYDKANRSSGKSVRGLGLE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  IF +++++ G P+LTDVHT +   A+A  VD+LQ PA LCRQTD + A A  G+ +
Sbjct: 71  EGLRIFSEVQRQIGVPVLTDVHTIEDIPAVAAVVDVLQTPAFLCRQTDFIHAVATCGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHA--HGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
           N+KKGQFL+P +M N++ K     +GA +++ CERG SFGYN LV+DMRS+ IM   G P
Sbjct: 131 NIKKGQFLAPGDMKNVVDKAREVNNGADNIMVCERGASFGYNNLVSDMRSLAIMRETGCP 190

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           V+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A+GI+G+F+ETH  P+ A SDGPN  
Sbjct: 191 VVFDATHSVQLPGGQGTTSGGQREFVPVLARAAIAVGISGLFMETHPCPEKAWSDGPNSW 250

Query: 280 NIKDLPKLLSQLLAIDKIIK 299
            +  +  LL+ L+A+DK +K
Sbjct: 251 PLDRMESLLATLVALDKAVK 270


>gi|154497303|ref|ZP_02035999.1| hypothetical protein BACCAP_01596 [Bacteroides capillosus ATCC
           29799]
 gi|150273702|gb|EDN00830.1| hypothetical protein BACCAP_01596 [Bacteroides capillosus ATCC
           29799]
          Length = 258

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 169/247 (68%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F L AGPC IES +     A ++  IC  L I  V K+SFDKANR+S+   RG GL++G 
Sbjct: 2   FTLFAGPCVIESEELVLRTASEIQEICGRLGIPYVCKASFDKANRTSIHSFRGPGLEEGL 61

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            I    K++   P++TD+H   Q +  A   D LQIPA LCRQT+LL AAA+TG+ +NVK
Sbjct: 62  RILDKAKQELNVPVITDIHESWQAKPAAQVADYLQIPAFLCRQTNLLVAAAETGKAVNVK 121

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           K QFL+PW+M ++  KL   G +++L CERGT+FGYN LV DM SIP + S+G PV+FDA
Sbjct: 122 KAQFLAPWDMKHVANKLEEAGCREILLCERGTTFGYNNLVVDMTSIPELKSLGYPVVFDA 181

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ+PG  G+ +GG R ++ PLA+AA+A G   +F+E H DPDNA SDGPNM+ ++ L
Sbjct: 182 THSVQKPGGKGDATGGNRAFVEPLARAALAAGADHLFMEVHPDPDNAKSDGPNMVRLEQL 241

Query: 285 PKLLSQL 291
             +L  L
Sbjct: 242 EHMLEGL 248


>gi|146386784|pdb|2EF9|A Chain A, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386785|pdb|2EF9|B Chain B, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
          Length = 267

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 175/256 (68%), Gaps = 2/256 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAG   IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 2   EKFLVIAGMNAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LCRQTDLL AAA+TGR +
Sbjct: 62  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 122 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQWA-KVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD P  + +
Sbjct: 181 YDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDAPTALPL 240

Query: 282 KDLPKLLSQLLAIDKI 297
             L  ++  +L I ++
Sbjct: 241 SQLEGIIEAILEIREV 256


>gi|157376582|ref|YP_001475182.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sediminis
           HAW-EB3]
 gi|189028419|sp|A8FYY1|KDSA_SHESH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|157318956|gb|ABV38054.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sediminis
           HAW-EB3]
          Length = 282

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 126/276 (45%), Positives = 180/276 (65%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           +N  I LGS    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+S
Sbjct: 2   SNKIIGLGS----IEIANDKPFVLFGGMNVLESRDLAMKIAETYAEVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF ++K  +  P++TDVH   QC  +A+ VDI+Q+PA 
Sbjct: 58  FDKANRSSVNSYRGPGMEEGLKIFEEIKSTFNLPLITDVHEVHQCAPVAEVVDIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+T  +INVKK QFL+P EM +I+ K +  G   ++ CERG+SFGYN L
Sbjct: 118 LARQTDLVVAMAKTDAIINVKKPQFLAPHEMRHIITKFNEAGNDKIILCERGSSFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E
Sbjct: 178 VVDMLGMDEMKQSGYPVIFDATHALQRPGGRSDSAGGRRAQATELARSGMALGLAGLFIE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L+Q+ A+D ++K
Sbjct: 238 AHPDPDNAKCDGPCALPLHQLEAYLTQMKAVDDLVK 273


>gi|145345975|ref|XP_001417473.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144577700|gb|ABO95766.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 296

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/272 (45%), Positives = 181/272 (66%), Gaps = 6/272 (2%)

Query: 29  HLGSGKNQV-TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           HL +G        + Q F L+AGP  I+S +H F +  +L  +   L++  ++KSSFDKA
Sbjct: 3   HLAAGNALFGDLKSSQPFFLMAGPNVIQSEEHIFAMCRELKRVTDELDVPFIFKSSFDKA 62

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NR+S+   RG G+  G  I + +K  +  PI+TD+HTE+Q E ++   D++QIPA LCRQ
Sbjct: 63  NRTSITSFRGPGIDDGLRILQAVKTTFDVPIVTDIHTEEQAEPVSAVADVMQIPAFLCRQ 122

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDLL AA +TGRVIN+KKGQF +P  M N  +K+ + G ++VL CERG++FGY+ LV DM
Sbjct: 123 TDLLLAAGRTGRVINIKKGQFCAPSVMRNSAKKVFSTGNENVLLCERGSTFGYSDLVVDM 182

Query: 208 RSIPIMTSMGVPVIFDASHSVQQP-GIHGN----CSGGERQYIVPLAKAAVAIGIAGIFL 262
           R+IP+M   G P++ D +HS+QQP G+ G      SGG R+ I  +A++ VA G+ G+F+
Sbjct: 183 RNIPLMRDAGCPIVADVTHSLQQPAGLAGADGAVASGGSRELIPTIARSCVAAGVDGLFM 242

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAI 294
           E H DP+++P DGP    ++  P+LL++L AI
Sbjct: 243 EVHNDPNSSPVDGPTQWPLRHFPELLAELKAI 274


>gi|94970696|ref|YP_592744.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Koribacter
           versatilis Ellin345]
 gi|123381265|sp|Q1IKD0|KDSA_ACIBL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|94552746|gb|ABF42670.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 278

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 129/260 (49%), Positives = 177/260 (68%), Gaps = 4/260 (1%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           +  LIAGPC IES  HA  +AE +  +C+++ I  ++K+S+DKANR+SL+  RG GL +G
Sbjct: 16  KLFLIAGPCVIESEAHAMKMAEAISGVCKAMKIPYIFKASYDKANRTSLSSFRGPGLHEG 75

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
             I   +  +   P+LTDVH  +Q  A  D VD+LQIPA LCRQTDLL AAA+TG+V+NV
Sbjct: 76  LRILAKVADEVNVPVLTDVHDTEQATAAGDIVDVLQIPAFLCRQTDLLVAAAKTGKVVNV 135

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQF++P +M   + K+   G + V   ERG SFGYN LV DMR++PIM     PVIFD
Sbjct: 136 KKGQFVAPNDMQYAVTKVRESGNQRVCLTERGASFGYNNLVVDMRALPIMRQFA-PVIFD 194

Query: 224 ASHSVQQP--GIHGNC-SGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           A+HSVQ P  G  G+  SGG+ ++I  L++AAVA G+ G+F+E H DP +A SDG N ++
Sbjct: 195 ATHSVQLPSAGKDGHAVSGGQPEFIPVLSRAAVAAGVDGVFMEVHDDPPHAKSDGANALD 254

Query: 281 IKDLPKLLSQLLAIDKIIKP 300
           +K L  +L+ LL I + + P
Sbjct: 255 LKLLRGVLTSLLRIREAVTP 274


>gi|297569296|ref|YP_003690640.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925211|gb|ADH86021.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 284

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 171/255 (67%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           Q   L+AGPC IES      IA  L  +   L + L++K+SFDKANR+SL   RG G  +
Sbjct: 26  QPLTLLAGPCVIESESIMRQIAGHLKEVSARLGVNLIFKASFDKANRTSLESYRGPGPAE 85

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G  +   + +++  P+++DVH   Q  A A  +D+LQIPA LCRQTDLL AAAQTG+ +N
Sbjct: 86  GLAMLAAIGREFDLPLISDVHESGQAAAAAAVLDVLQIPAFLCRQTDLLVAAAQTGKPVN 145

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQF +PW+M     K+ + G   VL  ERG+SFGYN LV DMRS+P++  +G PVIF
Sbjct: 146 VKKGQFAAPWDMAPATAKVRSAGTGGVLLTERGSSFGYNNLVVDMRSLPLLRQLGSPVIF 205

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G+ SGG+R+++  LA+AA A+GI G+F+E H DP  A  DGPN   + 
Sbjct: 206 DATHSVQLPGGAGDRSGGQRRFVPTLARAAAAVGIDGLFMEVHPDPRQALCDGPNSWPLD 265

Query: 283 DLPKLLSQLLAIDKI 297
            + +LL Q+LAI ++
Sbjct: 266 QVEELLRQVLAIHQL 280


>gi|182411876|ref|YP_001816942.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Opitutus terrae PB90-1]
 gi|177839090|gb|ACB73342.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Opitutus terrae PB90-1]
          Length = 264

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 140/260 (53%), Positives = 183/260 (70%), Gaps = 1/260 (0%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVG 99
           + ++ ++IAGPC +E+      +AE+L  I ++   + LV+K SFDKANR+SLAG RG G
Sbjct: 4   DSKKLLVIAGPCSLENERVCRAVAERLQEIQRAQPELTLVFKGSFDKANRTSLAGDRGTG 63

Query: 100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGR 159
           L+ G E+   ++++YGFP+LTDVH   Q   +A   D+LQIPA LCRQTDLL AAA TGR
Sbjct: 64  LEAGLELLALIRREYGFPVLTDVHERPQVPQVAAVCDVLQIPAFLCRQTDLLLAAAATGR 123

Query: 160 VINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
           V+NVKKGQFLSP EM  +  KL   GA++V   ERGT+FGY  LV DMRS  IM   G P
Sbjct: 124 VVNVKKGQFLSPQEMQFVTGKLREGGAREVWQTERGTTFGYQNLVVDMRSFAIMRQNGYP 183

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
            +FDA+HSVQ PG  G  SGG+R+++ PLA+AA+A G  G+FLETH DP +A SDGPNMI
Sbjct: 184 TVFDATHSVQLPGAAGGKSGGQREFVPPLAQAALAAGADGLFLETHPDPAHAISDGPNMI 243

Query: 280 NIKDLPKLLSQLLAIDKIIK 299
            + DLP LL++ + I K  +
Sbjct: 244 PLADLPALLARCVRIWKAAR 263


>gi|195953972|ref|YP_002122262.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hydrogenobaculum sp.
           Y04AAS1]
 gi|195933584|gb|ACG58284.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hydrogenobaculum sp.
           Y04AAS1]
          Length = 265

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 133/256 (51%), Positives = 180/256 (70%), Gaps = 5/256 (1%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAIC-QSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           E++F++IAGPC IES++  F +A  L     +      V+K+SFDKANR+S+   RG GL
Sbjct: 2   EKKFLIIAGPCVIESYELCFEVASHLKEFSLKYKEFDFVFKASFDKANRTSVNSYRGPGL 61

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
           +KG EI + +K+++  P+ TDVH   Q + +A+ VDI+QIPA LCRQTDLL AAA+TG+ 
Sbjct: 62  EKGLEILKRIKEEFSMPVTTDVHETYQVKPVAEVVDIIQIPAFLCRQTDLLLAAAETGKS 121

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLF--CERGTSFGYNTLVTDMRSIPIMTSMGV 218
           +NVKKGQFL+PW+   I+ KL +   KD  F   ERG+SFGYN LV DMRS+PIM     
Sbjct: 122 VNVKKGQFLAPWDTKYIIDKLKSKN-KDATFYLTERGSSFGYNNLVVDMRSLPIMRQYA- 179

Query: 219 PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNM 278
            VIFDA+HSVQ PG  G  S G+R+++  L +AAVA+G+ G+F+ETH +P+ A SDGPN 
Sbjct: 180 KVIFDATHSVQLPGGAGGSSSGQREFVPYLIRAAVAVGVDGVFMETHPNPEKALSDGPNS 239

Query: 279 INIKDLPKLLSQLLAI 294
           I +KDL  +L Q+ AI
Sbjct: 240 IPLKDLEGILIQIKAI 255


>gi|113867206|ref|YP_725695.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia eutropha H16]
 gi|122946983|sp|Q0KCE4|KDSA_RALEH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|113525982|emb|CAJ92327.1| 2-Dehydro-3-deoxyphosphooctonate aldolase [Ralstonia eutropha H16]
          Length = 289

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 180/264 (68%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAGPC IES   A   A +L AI   L I  +YKSSFDKANRSS    RG+G++
Sbjct: 11  DKPFFLIAGPCVIESEQMALDTAGELKAITAELGIPFIYKSSFDKANRSSGKSFRGLGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +K++ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  KGLEILATVKREIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQK----LHAHGAKDVLF--CERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K        G  D +F  CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAAREAGLPDDVFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA G+AG+F+ETH DP  A SDG
Sbjct: 191 TGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVATGVAGLFMETHPDPSKAMSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  + +LL+ L  +D ++K
Sbjct: 251 PNAVPLSRMKELLAVLKELDTLVK 274


>gi|294055350|ref|YP_003549008.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Coraliomargarita
           akajimensis DSM 45221]
 gi|293614683|gb|ADE54838.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Coraliomargarita
           akajimensis DSM 45221]
          Length = 263

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 129/260 (49%), Positives = 176/260 (67%), Gaps = 1/260 (0%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAI-CQSLNIGLVYKSSFDKANRSSLAGKRGVG 99
           N  + +LIAGPC +E  D    +A+ L A+  Q   + +++K SFDKANR+S+   RG G
Sbjct: 4   NPDQLLLIAGPCSLEGLDTCRPVADALKALQGQHPELNILFKGSFDKANRTSIKSNRGTG 63

Query: 100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGR 159
           L +G EIFR +K +YGF  +TD+H  +QC  + D VD LQIPA LCRQTDLL AAA+T  
Sbjct: 64  LDEGLEIFRTIKAEYGFNCITDIHLPEQCAQVGDVVDALQIPAFLCRQTDLLVAAAETNC 123

Query: 160 VINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
            +NVKKGQFLSP+EM  ++ KL   GAK++   +RGT+FGY  LV DMRS  IM + G P
Sbjct: 124 AVNVKKGQFLSPYEMEFVVSKLKEAGAKEIWQTDRGTTFGYQNLVVDMRSFSIMGAFGTP 183

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
            + DA+HSVQ PG  G  SGG+R+Y+ PLA+AA+A G  G+FLETH +P  A SD  + +
Sbjct: 184 TVIDATHSVQLPGAAGGVSGGQREYVPPLARAALAAGANGVFLETHPNPTQAISDAASQV 243

Query: 280 NIKDLPKLLSQLLAIDKIIK 299
            +++LP L+  LL +   ++
Sbjct: 244 PLEELPDLVESLLRVWNAVR 263


>gi|330807800|ref|YP_004352262.1| 3-deoxy-8-phosphooctulonate synthase
           (2-dehydro-3-deoxyphosphooctonate aldolase) [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327375908|gb|AEA67258.1| 3-deoxy-8-phosphooctulonate synthase
           (2-dehydro-3-deoxyphosphooctonate aldolase) [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 281

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 123/263 (46%), Positives = 169/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++  VL  G   +ES D A  + E+   + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTQKLGIPYVFKASFDKANRSSVTSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G  IF+D+K+ +G PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMRIFQDIKQAFGVPIITDVHEPAQAAVVAEVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TGAVINIKKAQFLAPQEMKHILSKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV FD +H++Q PG   + +GG R  +  LAKA ++  +AG+FLE H DPDNA  DGP
Sbjct: 191 EYPVFFDVTHALQMPGGRSDSAGGRRAQVTDLAKAGISQSLAGLFLEAHPDPDNAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   LSQL A+D+++K
Sbjct: 251 CALRLNKLEPFLSQLKALDELVK 273


>gi|293392125|ref|ZP_06636459.1| 3-deoxy-8-phosphooctulonate synthase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952659|gb|EFE02778.1| 3-deoxy-8-phosphooctulonate synthase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 284

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 181/277 (65%), Gaps = 6/277 (2%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           N  I LG     +  +N++ FVL  G   +ES D A  + EK   + Q L +  V+K+SF
Sbjct: 3   NKLIQLGD----IQIANDKPFVLFGGMNVLESRDMAMRVCEKYVEVTQKLGVPYVFKASF 58

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANRSS+   RG G+++G +IF +LK+ +G  I+TDVH   QC+ +A+ VDI+Q+PA L
Sbjct: 59  DKANRSSIHSYRGPGMEQGLKIFAELKQTFGVKIITDVHEIYQCQPVAEVVDIIQLPAFL 118

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
            RQTDL+ A A+TG VINVKK QFLSP +M NI++KL   G   V+ C+RGT+FGY+ LV
Sbjct: 119 ARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKLAECGNDKVILCDRGTNFGYDNLV 178

Query: 205 TDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
            DM    +M   S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FL
Sbjct: 179 VDMLGFSVMKNVSKGCPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGLAIGLAGLFL 238

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           E H DP NA  DGP+ + +  L  L++Q+ AID ++K
Sbjct: 239 EAHPDPSNAKCDGPSALPLDKLEALVNQMKAIDNLVK 275


>gi|254443166|ref|ZP_05056642.1| 3-deoxy-8-phosphooctulonate synthase [Verrucomicrobiae bacterium
           DG1235]
 gi|198257474|gb|EDY81782.1| 3-deoxy-8-phosphooctulonate synthase [Verrucomicrobiae bacterium
           DG1235]
          Length = 280

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 124/259 (47%), Positives = 171/259 (66%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           NE  F L+AG   +ES D A  IA +   +   L I  ++K+SFDKANRSS+   RG G+
Sbjct: 14  NELPFTLLAGMNVLESRDLALEIASEYKRVTDKLGIPYIFKASFDKANRSSVTSFRGPGM 73

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
           +KG EI  ++K+ +G P++TDVH   Q  A+A+  DI+Q+PA L RQTDL+ A A+TG +
Sbjct: 74  EKGLEIMAEIKETFGVPLITDVHEPYQAAAVAEVCDIIQLPAFLSRQTDLVVAMAKTGAI 133

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +NVKK QFL+P EM +I++KL+  G   ++ CERG+SFGYN LV DM  I  M   G PV
Sbjct: 134 VNVKKAQFLAPREMGHIIKKLNEAGNDKIMLCERGSSFGYNNLVVDMLGIATMKEFGYPV 193

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           IFD +HS+Q PG     +GG R+ +  LAKA +A+G+AG+FLE H DP+NA  DGP  + 
Sbjct: 194 IFDVTHSLQIPGGTATAAGGRRRQVCDLAKAGMAVGLAGLFLEAHPDPENAKCDGPCALP 253

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  L   L Q+  ID ++K
Sbjct: 254 LNRLEGFLEQMKQIDDLVK 272


>gi|288927558|ref|ZP_06421405.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella sp. oral taxon 317
           str. F0108]
 gi|288330392|gb|EFC68976.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella sp. oral taxon 317
           str. F0108]
          Length = 261

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 167/249 (67%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           +   IAGPC IES +  + +AEKL  I Q L + +++K+SFDKANR+S++  RG GL++G
Sbjct: 13  KTTFIAGPCVIESQELLYTVAEKLVEINQKLEVDIIFKASFDKANRTSISSFRGPGLERG 72

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
            E+  ++K KYG  +LTD+H   Q EA+   VD+LQIPA LCRQTDLL AAA+TG+V+N+
Sbjct: 73  LEMLANVKSKYGLKLLTDIHESCQAEAVGQVVDVLQIPAFLCRQTDLLVAAAKTGKVVNI 132

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KK QFLS  +M   ++K    GA +V   ERG +FGYN LV D R+IP M  +   VI D
Sbjct: 133 KKAQFLSGPDMKYPVEKAKEAGAAEVWLTERGNTFGYNNLVVDFRNIPDMKEIVPTVIMD 192

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
            +HSVQ+PG  G  +GG+R+++  +A AA A G  G F E H +PD   SDGPNM+ +  
Sbjct: 193 CTHSVQRPGAMGGKTGGDRRFVPSMALAAKAFGATGYFFEVHPNPDKGLSDGPNMLELDK 252

Query: 284 LPKLLSQLL 292
           L  L++ LL
Sbjct: 253 LENLIANLL 261


>gi|163856111|ref|YP_001630409.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bordetella petrii DSM
           12804]
 gi|226761653|sp|A9IIP6|KDSA_BORPD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|163259839|emb|CAP42140.1| 3-deoxy-8-phosphooctulonate synthase [Bordetella petrii]
          Length = 284

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 180/264 (68%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           E  F LIAGPC IES + AF  A +L  I   L I  +YKSSFDKANRSS    RG+G+ 
Sbjct: 11  EHPFFLIAGPCVIESRELAFDTAGRLKEITSRLGIPFIYKSSFDKANRSSGKSFRGLGID 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G +I  D++ + G P+LTDVH  +Q E +A  VD+LQ PA LCRQTD + A A + + +
Sbjct: 71  EGLKILADVRDQVGVPVLTDVHETEQVEPVAAVVDMLQTPAFLCRQTDFIRACAASLKPV 130

Query: 162 NVKKGQFLSPWEMHNILQK-----LHAHG-AKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M  + QK     + A G   ++L CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMVQVAQKARDAAIEAGGDGSNILVCERGASFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+G++G+F+ETH +P  A SDG
Sbjct: 191 TGCPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVAVGVSGLFMETHPNPACALSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  +P LL  L+ +D++ K
Sbjct: 251 PNAVPLDLMPALLESLVELDRVTK 274


>gi|213157542|ref|YP_002319587.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AB0057]
 gi|213056702|gb|ACJ41604.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AB0057]
          Length = 297

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 169/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL   R
Sbjct: 15  IQMANHLPFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLHSFR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG E   D+KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 75  GPGLEKGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAK 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM  M
Sbjct: 135 TQAIINIKKAQFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMKEM 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE+H DPD A  DGP
Sbjct: 195 NVPVFFDVTHALQTPGGRSDSAGGRRAQITTLARAGMATGLAGLFLESHPDPDKAKCDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           + + +  L   L+QL  +D ++K
Sbjct: 255 SALRLSQLEPFLAQLKELDTLVK 277


>gi|194289290|ref|YP_002005197.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cupriavidus taiwanensis
           LMG 19424]
 gi|238692756|sp|B3R497|KDSA_CUPTR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|193223125|emb|CAQ69130.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Cupriavidus
           taiwanensis LMG 19424]
          Length = 289

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 180/264 (68%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAGPC IES   A   A +L AI   L I  +YKSSFDKANRSS    RG+G++
Sbjct: 11  DKPFFLIAGPCVIESEQMALDTAGELKAITTELGIPFIYKSSFDKANRSSGKSFRGLGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +K++ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  KGLEILAHVKREIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQK----LHAHGAKDVLF--CERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K        G  D +F  CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAAREAGLPDDVFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA G+AG+F+ETH DP  A SDG
Sbjct: 191 TGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVATGVAGLFMETHPDPSKAMSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  + +LL+ L  +D ++K
Sbjct: 251 PNAVPLSRMKELLTVLKELDTLVK 274


>gi|237746036|ref|ZP_04576516.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oxalobacter formigenes
           HOxBLS]
 gi|229377387|gb|EEO27478.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oxalobacter formigenes
           HOxBLS]
          Length = 283

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 183/263 (69%), Gaps = 6/263 (2%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           Q F LIAGPC IES   A   A  L  +   L I  +YKSS+DKANRSS A  RG+G++K
Sbjct: 12  QPFFLIAGPCVIESRQLAIDTAGALKEMTAELGIPFIYKSSYDKANRSSSASFRGLGMEK 71

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G +I  D+KK++  P+LTDVH E + EA+A  VD+LQ PA LCRQTD + A A++G+ +N
Sbjct: 72  GLDILADVKKQFNVPVLTDVHAEDEIEAVAQVVDVLQTPAFLCRQTDFIQACARSGKPVN 131

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVL------FCERGTSFGYNTLVTDMRSIPIMTSM 216
           +KKGQFL+P +M N+++K      +  L       CERG SFGYN LV+DMRS+ IM   
Sbjct: 132 IKKGQFLAPDDMGNVVRKAKEAAREAGLSEDRFTVCERGASFGYNNLVSDMRSLSIMRKT 191

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQ PG  G+ SGG+R+++  LA+AAVA+G+AG+F+ETH +P  A SDGP
Sbjct: 192 GCPVVFDATHSVQLPGGLGDASGGQREFVPVLARAAVAVGVAGLFMETHPNPAEAKSDGP 251

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           N + +  +  LL+QL  +DK++K
Sbjct: 252 NAVPLDRMKALLTQLATLDKVVK 274


>gi|71066195|ref|YP_264922.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychrobacter arcticus
           273-4]
 gi|71039180|gb|AAZ19488.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase protein
           [Psychrobacter arcticus 273-4]
          Length = 291

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 178/281 (63%), Gaps = 1/281 (0%)

Query: 20  HMIHTNAAIHLGSGKNQ-VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGL 78
           +++   + I L +  N+ +   N+Q FVL  G   +ES + AF IAE+   ICQ L IG 
Sbjct: 3   NLLTAQSHIQLNTPNNKSINIGNDQPFVLFGGMNVLESKEMAFEIAEQYVDICQRLGIGY 62

Query: 79  VYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDIL 138
           V+K+SFDKANRSSL   RG GL+KG +    +K+K+  PI+TDVH   Q   +A+  DI+
Sbjct: 63  VFKASFDKANRSSLTSYRGPGLEKGIDWLGQIKEKFQVPIITDVHEPYQAAPVAEVADII 122

Query: 139 QIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSF 198
           Q+PA L RQTDL+ A A+T  +IN+KK QFL+P EM +I+ K    G   ++ CERG++F
Sbjct: 123 QLPAFLSRQTDLVHAMAKTDAIINIKKAQFLAPHEMRHIVNKCLEGGNDKLILCERGSAF 182

Query: 199 GYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIA 258
           GYN LV DM     M  M +PV FD +HS+QQPG   + +GG R+ I  LA+A +A G+A
Sbjct: 183 GYNNLVVDMLGFDTMKQMEIPVFFDVTHSLQQPGARSDSAGGRREQITTLARAGMATGLA 242

Query: 259 GIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           G+FLE H +P+ A  DGP  + +  L   L QL  +D ++K
Sbjct: 243 GLFLEAHPNPETAKCDGPCALRMSQLEPFLRQLKQLDDLVK 283


>gi|187932013|ref|YP_001891998.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|254807745|sp|B2SDK5|KDSA_FRATM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|187712922|gb|ACD31219.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthase [Francisella
           tularensis subsp. mediasiatica FSC147]
          Length = 275

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 177/259 (68%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   RG+G+
Sbjct: 10  NGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSFRGLGV 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    + G+ 
Sbjct: 70  DKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVCKQGKP 129

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM + G PV
Sbjct: 130 VNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKATGCPV 189

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDG N   
Sbjct: 190 VFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDGLNSFP 249

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  + + LS L  +D ++K
Sbjct: 250 MYKIKEFLSLLKELDHLVK 268


>gi|241662670|ref|YP_002981030.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia pickettii 12D]
 gi|309781226|ref|ZP_07675963.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia sp. 5_7_47FAA]
 gi|240864697|gb|ACS62358.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia pickettii 12D]
 gi|308920047|gb|EFP65707.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia sp. 5_7_47FAA]
          Length = 284

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 181/265 (68%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C IES   A   A  L  I  +L I  +YKSSFDKANRSS A  RG+G++
Sbjct: 11  DKPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDASFRGLGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  +++++ G P+LTD+H   + + +A+ VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  EGLRILSEVRRQVGVPVLTDIHEIDEIKPVAEVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K   H A+D        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-HAARDAGLPEDNFMACERGASFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A+GIAG+F+ETH DP  A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAIAVGIAGVFMETHPDPACAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + ++ +  LLS L  +D + K
Sbjct: 250 GPNAVPLRRMKDLLSVLKELDALTK 274


>gi|116625269|ref|YP_827425.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116228431|gb|ABJ87140.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 262

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 176/264 (66%), Gaps = 6/264 (2%)

Query: 37  VTFSN-EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
           + FS+  +R VLIAGPC IES +H   +A  + A         V+K+SFDKANR+S    
Sbjct: 3   IEFSDFGKRLVLIAGPCVIESEEHVHRMARGIRAAVGEF----VFKASFDKANRTSAGAY 58

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GLK+G  I   +K + GFPILTD+H   Q EA A+ VDILQIPA LCRQTDLL AA 
Sbjct: 59  RGPGLKEGLRILAGVKAE-GFPILTDIHEPAQAEAAAEVVDILQIPAFLCRQTDLLVAAG 117

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TGR++N+KKGQF++P +++    K+ + G   V+  ERG+SFGYN LV DMR + IM  
Sbjct: 118 RTGRIVNIKKGQFVAPHDIYRAADKVASTGNTQVVLTERGSSFGYNNLVVDMRGLKIMRD 177

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+ ++I PLA+AAVA+GI G+F+ETH  P+ A SDG
Sbjct: 178 AGWPVVFDATHSVQLPGGAGATSGGQPEFIAPLARAAVAVGIDGVFVETHDAPEKALSDG 237

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
            N + +  L      LL +D  +K
Sbjct: 238 ANALRLDLLADFWRGLLKVDAAVK 261


>gi|120553852|ref|YP_958203.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinobacter aquaeolei
           VT8]
 gi|166220451|sp|A1TZ47|KDSA_MARAV RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|120323701|gb|ABM18016.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinobacter aquaeolei
           VT8]
          Length = 281

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 169/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES + AF +AEK   +C  L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDRPFVLFGGMNVLESRELAFEVAEKYVDVCTRLGIPYVFKASFDKANRSSVNSFR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG +I  D+K K+G PI++DVH   Q    A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEKGLQILADIKSKFGVPIISDVHEPGQAAPAAEVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +I+ K    G   ++ CERGTSFGYN LV DM    IM  M
Sbjct: 131 TGAVINIKKAQFLAPQEMKHIITKCEEAGNDQIILCERGTSFGYNNLVVDMLGFGIMKQM 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q PG   + +GG R  +  LA A ++ G+AG+FLE H DPD A  DGP
Sbjct: 191 NVPVFFDVTHALQMPGGRADSAGGRRAQVTDLALAGMSQGLAGLFLEAHPDPDKARCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L ++ A+D ++K
Sbjct: 251 CALRLSQLEPFLERVKAVDDLVK 273


>gi|162286730|ref|YP_001084928.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           ATCC 17978]
 gi|169795767|ref|YP_001713560.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AYE]
 gi|184158328|ref|YP_001846667.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           ACICU]
 gi|215483252|ref|YP_002325459.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           AB307-0294]
 gi|239503987|ref|ZP_04663297.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AB900]
 gi|260550310|ref|ZP_05824522.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp.
           RUH2624]
 gi|260554830|ref|ZP_05827051.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii ATCC
           19606]
 gi|301347093|ref|ZP_07227834.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AB056]
 gi|301511878|ref|ZP_07237115.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AB058]
 gi|301596844|ref|ZP_07241852.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AB059]
 gi|332853322|ref|ZP_08434701.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           6013150]
 gi|332871180|ref|ZP_08439757.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           6013113]
 gi|332873444|ref|ZP_08441396.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           6014059]
 gi|226722927|sp|B7H226|KDSA_ACIB3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238685516|sp|A3M5Y2|KDSA_ACIBT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238688035|sp|B0V676|KDSA_ACIBY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238691017|sp|B2I2A6|KDSA_ACIBC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|169148694|emb|CAM86560.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AYE]
 gi|183209922|gb|ACC57320.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Acinetobacter baumannii ACICU]
 gi|193077499|gb|ABO12326.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           ATCC 17978]
 gi|213988473|gb|ACJ58772.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           AB307-0294]
 gi|260406622|gb|EEX00103.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp.
           RUH2624]
 gi|260411372|gb|EEX04669.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii ATCC
           19606]
 gi|322508655|gb|ADX04109.1| kdsA [Acinetobacter baumannii 1656-2]
 gi|323518263|gb|ADX92644.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332728721|gb|EGJ60084.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           6013150]
 gi|332731665|gb|EGJ62948.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           6013113]
 gi|332738332|gb|EGJ69207.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           6014059]
          Length = 285

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 169/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL   R
Sbjct: 15  IQMANHLPFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLHSFR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG E   D+KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 75  GPGLEKGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAK 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM  M
Sbjct: 135 TQAIINIKKAQFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMKEM 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE+H DPD A  DGP
Sbjct: 195 NVPVFFDVTHALQTPGGRSDSAGGRRAQITTLARAGMATGLAGLFLESHPDPDKAKCDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           + + +  L   L+QL  +D ++K
Sbjct: 255 SALRLSQLEPFLAQLKELDTLVK 277


>gi|157835450|pdb|2NXI|A Chain A, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|157835451|pdb|2NXI|B Chain B, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|157835452|pdb|2NXI|C Chain C, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|157835453|pdb|2NXI|D Chain D, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|157835454|pdb|2NXI|E Chain E, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|157835455|pdb|2NXI|F Chain F, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|157835456|pdb|2NXI|G Chain G, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|157835457|pdb|2NXI|H Chain H, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|157835458|pdb|2NXI|I Chain I, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|157835459|pdb|2NXI|J Chain J, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|157835460|pdb|2NXI|K Chain K, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|157835461|pdb|2NXI|L Chain L, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
          Length = 263

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 122/256 (47%), Positives = 174/256 (67%), Gaps = 2/256 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAG   IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 1   EKFLVIAGMNAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 60

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LCRQTDLL AAA+TGR +
Sbjct: 61  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAV 120

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 121 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQWA-KVI 179

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD    + +
Sbjct: 180 YDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDASTQLPL 239

Query: 282 KDLPKLLSQLLAIDKI 297
             L  ++  +L I ++
Sbjct: 240 SQLEGIIEAILEIREV 255


>gi|148241384|ref|YP_001226541.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus sp.
           RCC307]
 gi|147849694|emb|CAK27188.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus sp.
           RCC307]
          Length = 278

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 137/260 (52%), Positives = 180/260 (69%), Gaps = 10/260 (3%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F LIAGPC +ES +  F +A  L A+ + L I L++K+SFDKANRSS    RG G+++G 
Sbjct: 5   FTLIAGPCVLESPELVFDMAAALKAMSERLGIRLLFKTSFDKANRSSGGSFRGPGMEQGL 64

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ-------T 157
           E+   LK++ G  +LTD+H   Q   +A  VD+LQIPA LCRQTDLL AAA         
Sbjct: 65  EVLAQLKQELGVQLLTDIHESHQAAVVAQVVDVLQIPAFLCRQTDLLLAAAAAVQNPEAA 124

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAHG---AKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
             V+NVKKGQFL+PW+M  ++ KL   G    + +   ERGT+FGYNTLV DMRS+P + 
Sbjct: 125 ASVVNVKKGQFLAPWDMAQVVSKLREAGLQSPEQLWLTERGTTFGYNTLVVDMRSLPQLR 184

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+HSVQQPG  G+ +GG+R+++ PLA+AA+A+G+ G+F+ETH DPD A SD
Sbjct: 185 QQGCPVIFDATHSVQQPGGRGSSTGGQREFVAPLARAAMAVGVDGLFIETHPDPDQALSD 244

Query: 275 GPNMINIKDLPKLLSQLLAI 294
           GPNM+ +  L  LL QLLAI
Sbjct: 245 GPNMVPLHRLEPLLEQLLAI 264


>gi|262279284|ref|ZP_06057069.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter calcoaceticus
           RUH2202]
 gi|299769905|ref|YP_003731931.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp. DR1]
 gi|262259635|gb|EEY78368.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter calcoaceticus
           RUH2202]
 gi|298699993|gb|ADI90558.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp. DR1]
          Length = 285

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 170/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL   R
Sbjct: 15  IQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICKRLDIPYVFKASFDKANRSSLHSFR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG E   D+KK +  PI+TDVH   Q EA+A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 75  GPGLEKGIEWLGDIKKHFNVPIITDVHEPHQAEAVAEVADIIQLPAFLSRQTDLVEAMAK 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM  M
Sbjct: 135 TQAIINIKKAQFLAPHEMRHILNKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMKEM 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP++A  DGP
Sbjct: 195 NVPVFFDVTHALQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEGHPDPEHAKCDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+Q+  +D ++K
Sbjct: 255 CALRMSQLEPFLAQIKELDTLVK 277


>gi|94309998|ref|YP_583208.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cupriavidus
           metallidurans CH34]
 gi|93353850|gb|ABF07939.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Cupriavidus
           metallidurans CH34]
          Length = 289

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 180/264 (68%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAGPC IES   A   A +L AI   L I  +YKSSFDKANRSS    RG+G++
Sbjct: 11  DKPFFLIAGPCVIESEQMALDTAGELKAITGELGIPFIYKSSFDKANRSSGKSFRGLGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +K++ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  KGLEILATVKRQIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQK----LHAHGAKDVLF--CERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K        G  D +F  CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAAREAGLPDDVFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA G+AG+F+ETH DP  A SDG
Sbjct: 191 TGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVATGVAGLFMETHPDPSKAMSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  + +LL+ L  +D ++K
Sbjct: 251 PNAVPLSRMKELLTVLRDLDGMVK 274


>gi|169633621|ref|YP_001707357.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           SDF]
 gi|238688226|sp|B0VQI5|KDSA_ACIBS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|169152413|emb|CAP01364.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii]
          Length = 285

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 169/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL   R
Sbjct: 15  IQMANHLPFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLHSFR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG E   D+KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 75  GPGLEKGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAK 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM  M
Sbjct: 135 TQAIINIKKAQFLAPHEMRHILHKCLEVGNDKLILCERGSAFGYNNLVVDMLGFDIMKEM 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE+H DPD A  DGP
Sbjct: 195 NVPVFFDVTHALQTPGGRSDSAGGRRAQITTLARAGMATGLAGLFLESHPDPDKAKCDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           + + +  L   L+QL  +D ++K
Sbjct: 255 SALRLSQLEPFLAQLKELDTLVK 277


>gi|187928063|ref|YP_001898550.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia pickettii 12J]
 gi|238691795|sp|B2U9C1|KDSA_RALPJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|187724953|gb|ACD26118.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia pickettii 12J]
          Length = 284

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 181/265 (68%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C IES   A   A  L  I  +L I  +YKSSFDKANRSS A  RG+G++
Sbjct: 11  DKPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDASFRGLGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  +++++ G P+LTD+H   + + +A+ VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  EGLRILSEVRRQVGVPVLTDIHEIDEIKPVAEVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K   H A+D        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-HAARDAGLPEDNFMACERGASFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A+G+AG+F+ETH DP  A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAIAVGVAGVFMETHPDPACAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + ++ +  LLS L  +D + K
Sbjct: 250 GPNAVPLRRMKDLLSVLKELDALTK 274


>gi|225873929|ref|YP_002755388.1| 3-deoxy-8-phosphooctulonate synthase [Acidobacterium capsulatum
           ATCC 51196]
 gi|225791459|gb|ACO31549.1| 3-deoxy-8-phosphooctulonate synthase [Acidobacterium capsulatum
           ATCC 51196]
          Length = 294

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 125/251 (49%), Positives = 166/251 (66%), Gaps = 1/251 (0%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           +  LIAGPC IES  HA  +A+ +  I   L +  ++K+S+DKANR+S+   RG GL +G
Sbjct: 39  QLFLIAGPCVIESEAHARKMADAIQRITADLGVPYIFKASYDKANRTSVTSFRGPGLVEG 98

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
             I + +++++G P+LTDVH    C   A+ VD+LQIPA LCRQTDLL AAA TGR +NV
Sbjct: 99  TRILKTIQQQHGLPVLTDVHEPGHCAVAAEGVDVLQIPAFLCRQTDLLVAAANTGRAVNV 158

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQF++PW+M + + KL + G       ERG SFGYN LV DMRS+ IM  M  PV+FD
Sbjct: 159 KKGQFVAPWDMQHAVGKLESTGNPRFFLTERGASFGYNNLVVDMRSLGIMRKM-APVVFD 217

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
            +HSVQ P      SGG+ ++I  L +AAVA G+ G+FLE H +P  A SDG N +++  
Sbjct: 218 GTHSVQIPSGSNGVSGGQPEFIPLLTRAAVAAGVDGLFLEVHDNPAEAKSDGANALHLDR 277

Query: 284 LPKLLSQLLAI 294
           L  LL  LLAI
Sbjct: 278 LRPLLENLLAI 288


>gi|93006698|ref|YP_581135.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychrobacter
           cryohalolentis K5]
 gi|92394376|gb|ABE75651.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychrobacter
           cryohalolentis K5]
          Length = 291

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 128/281 (45%), Positives = 179/281 (63%), Gaps = 1/281 (0%)

Query: 20  HMIHTNAAIHLGSGKNQ-VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGL 78
           +++   + I L +  N+ ++  N+Q FVL  G   +ES + AF IAE+   ICQ L IG 
Sbjct: 3   NLLTAQSHIQLNTPDNKNISIGNDQPFVLFGGMNVLESKEMAFEIAEQYVDICQRLGIGY 62

Query: 79  VYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDIL 138
           V+K+SFDKANRSSL   RG GL+KG +    +K+K+  PI+TDVH   Q   +A+  DI+
Sbjct: 63  VFKASFDKANRSSLTSYRGPGLEKGIDWLGQIKEKFQVPIITDVHEPYQAAPVAEVADII 122

Query: 139 QIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSF 198
           Q+PA L RQTDL+ A A+T  +IN+KK QFL+P EM +I+ K    G   ++ CERG++F
Sbjct: 123 QLPAFLSRQTDLVHAMAKTDAIINIKKAQFLAPHEMRHIVNKCLEGGNDKLILCERGSAF 182

Query: 199 GYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIA 258
           GYN LV DM     M  M +PV FD +HS+QQPG   + +GG R+ I  LA+A +A GIA
Sbjct: 183 GYNNLVVDMLGFDTMKQMEIPVFFDVTHSLQQPGGRSDSAGGRREQITTLARAGMATGIA 242

Query: 259 GIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           G+FLE H +P+ A  DGP  + +  L   L QL  +D ++K
Sbjct: 243 GLFLEAHPNPEVAKCDGPCALRMSQLEPFLRQLKQLDDLVK 283


>gi|167626447|ref|YP_001676947.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|241668879|ref|ZP_04756457.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254877411|ref|ZP_05250121.1| 3-deoxy-8-phosphooctulonate synthase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254807744|sp|B0TZ07|KDSA_FRAP2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|167596448|gb|ABZ86446.1| 3-deoxy-8-phosphooctulonate synthase [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|254843432|gb|EET21846.1| 3-deoxy-8-phosphooctulonate synthase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 275

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 176/259 (67%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   RG+G+
Sbjct: 10  NGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSFRGLGV 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
            KG EI   +KK Y  P++TDVH +     +A+ VD++Q PA LCRQT+ +    + G+ 
Sbjct: 70  DKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVMQTPAFLCRQTNFILDVCKQGKP 129

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM S G PV
Sbjct: 130 VNIKKGQFLAPWDMQHVVAKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKSTGCPV 189

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           +FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH  P  A SDGPN   
Sbjct: 190 VFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPKPAEALSDGPNSFP 249

Query: 281 IKDLPKLLSQLLAIDKIIK 299
           +  + + LS L  +D ++K
Sbjct: 250 MYKIKEFLSLLKELDHLVK 268


>gi|73540791|ref|YP_295311.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia eutropha
           JMP134]
 gi|123732962|sp|Q473G6|KDSA_RALEJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|72118204|gb|AAZ60467.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia eutropha
           JMP134]
          Length = 289

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 180/264 (68%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAGPC IES   A   A +L AI   L I  +YKSSFDKANRSS    RG+G++
Sbjct: 11  DKPFFLIAGPCVIESEQMALDTAGELKAITGELGIPFIYKSSFDKANRSSGKSFRGLGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG EI   +K++ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  KGLEILATVKREIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQK----LHAHGAKDVLF--CERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K        G  D +F  CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAARDAGLPDDVFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA GIAG+F+ETH DP+ A SDG
Sbjct: 191 TGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVATGIAGLFMETHPDPNKAMSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  + +LL+ L  +D + K
Sbjct: 251 PNAVPLSRMKELLAVLRDLDALTK 274


>gi|222823550|ref|YP_002575124.1| 3-deoxy-D-manno-2-octulosonate-8-phosphate synthase [Campylobacter
           lari RM2100]
 gi|222538772|gb|ACM63873.1| 3-deoxy-D-manno-2-octulosonate-8-phosphate synthase [Campylobacter
           lari RM2100]
          Length = 268

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 133/267 (49%), Positives = 176/267 (65%), Gaps = 12/267 (4%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           ++ +LIAGPC IE+ +  F +A++L    +   I   +KSSFDKANR+S+   RG GL+K
Sbjct: 3   KKMILIAGPCVIENEELVFKVAQELECFLKDDRIDFYFKSSFDKANRTSINSFRGPGLEK 62

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G EI + +K K+G  ILTD+H   Q    A+ VD+LQIPA LCRQTDLL AAA+T   IN
Sbjct: 63  GLEILQKVKDKFGMQILTDIHESSQASIAAEVVDVLQIPAFLCRQTDLLVAAAKTKAKIN 122

Query: 163 VKKGQFLSPWEM-HNILQKLHAHG--------AKD--VLFCERGTSFGYNTLVTDMRSIP 211
           VKKGQFL+P ++ +++ + L   G        AK+  V   ERG+SFGY  LV DMRS+ 
Sbjct: 123 VKKGQFLNPEDIKYSVAKILQTRGVIEEGFEIAKENGVFVAERGSSFGYGNLVVDMRSLV 182

Query: 212 IMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
           IM     PVIFDA+HSVQ PGI+G  SGG+ +++ PLA+AA A+G+ G F ETH DP  A
Sbjct: 183 IMRKYA-PVIFDATHSVQMPGINGGSSGGKSEFVEPLARAAAAVGVDGFFFETHLDPCKA 241

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKII 298
             DGPNM++I  L   +  LL I +II
Sbjct: 242 LCDGPNMLDISRLKNCVDTLLKIQEII 268


>gi|327480173|gb|AEA83483.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas stutzeri DSM
           4166]
          Length = 281

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 170/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A    E+   + + L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPFVLFGGINVLESRDLAMQACEEYVRVTEKLGIPYVFKASFDKANRSSITSFR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF ++KK +G P++TDVH   Q + +AD  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFEEVKKTFGVPVITDVHEPWQAQPVADVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +IL+K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TGAVINIKKAQFLAPQEMKHILKKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV FD +H++Q PG   + +GG R  +  LAKA ++ G+AG+FLE H DPDNA  DGP
Sbjct: 191 EYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGLSQGLAGLFLEAHPDPDNAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL  +D ++K
Sbjct: 251 CALRLNKLEAFLTQLKQLDDLVK 273


>gi|171057860|ref|YP_001790209.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptothrix cholodnii
           SP-6]
 gi|238689110|sp|B1Y4K5|KDSA_LEPCP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|170775305|gb|ACB33444.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptothrix cholodnii
           SP-6]
          Length = 285

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 174/264 (65%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAG C IE    +  +A  L   C  L I L+YK SFDKANRSS    RG+GL+
Sbjct: 11  DQPFFLIAGTCSIEGLQMSLDVAGLLKEACAGLGIPLIYKGSFDKANRSSGTTNRGLGLE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +I  +++++ G P+LTDVH E Q   +A  VD+LQ PA LCRQTD + A A +G+ +
Sbjct: 71  AGLKILDEVRRQTGLPVLTDVHDESQVAEVASVVDVLQTPAFLCRQTDFIRAVAMSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+PW+M N++ K  A            L CERG SFGYN LV DM S+  M +
Sbjct: 131 NIKKGQFLAPWDMKNVIDKARAAARDAGLSEDRFLACERGVSFGYNNLVADMTSLAEMRN 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FD +HSVQ+PG  G  SGG R+ +  LA+A VA+G+AG+F+ETH DP  A SDG
Sbjct: 191 TGAPVVFDVTHSVQKPGGLGGSSGGAREMVPVLARAGVAVGVAGLFMETHPDPAKAFSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +K +  LL QL+A+D+++K
Sbjct: 251 PNAVPLKHMKTLLEQLVALDRVVK 274


>gi|322437054|ref|YP_004219266.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidobacterium sp.
           MP5ACTX9]
 gi|321164781|gb|ADW70486.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidobacterium sp.
           MP5ACTX9]
          Length = 279

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 124/259 (47%), Positives = 171/259 (66%), Gaps = 5/259 (1%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           +  LIAGPC +E   HA  +AE +  I   + I   +K+S+DKANR+S+   RG GL +G
Sbjct: 19  KLFLIAGPCVLEGESHARGLAEAVQKIAAEVGIPYCFKASYDKANRTSIKSFRGPGLVEG 78

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVD----ILQIPALLCRQTDLLTAAAQTGR 159
             I R + K  G P+LTDVHT + C  ++D+V     ++QIPA LCRQTDLL AAA+TGR
Sbjct: 79  TRILRAIAKDTGLPVLTDVHTPEDCARLSDAVGDVELMMQIPAFLCRQTDLLIAAAETGR 138

Query: 160 VINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
            INVKKGQF++P +M + +QK+   G + V  CERG SFGYN LV DMR++PIM     P
Sbjct: 139 AINVKKGQFVAPGDMRHAVQKVRDSGNERVSLCERGASFGYNNLVVDMRALPIMREF-AP 197

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           VIFD +H+VQ P      SGG+ ++I  LA+AAVA G+ G+FLE H +P  A SDG N +
Sbjct: 198 VIFDGTHAVQTPSAGNGVSGGQPEFIPVLARAAVAAGVDGVFLEVHDNPAEAKSDGANAL 257

Query: 280 NIKDLPKLLSQLLAIDKII 298
            +  L  +L +L+A+ +++
Sbjct: 258 RLDRLKGVLEELVAVHEVV 276


>gi|320108462|ref|YP_004184052.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Terriglobus saanensis
           SP1PR4]
 gi|319926983|gb|ADV84058.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Terriglobus saanensis
           SP1PR4]
          Length = 275

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 128/252 (50%), Positives = 170/252 (67%), Gaps = 5/252 (1%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LIAGPC IES +HA  +A  +  I   L +  ++K+S+DKANR+S+   RG GL +G  I
Sbjct: 19  LIAGPCVIESEEHAQKMAAAIAEITSELKVPYLFKASYDKANRTSIKSFRGPGLIEGARI 78

Query: 107 FRDLKKKYGFPILTDVHTEQQC----EAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
            R + K+ G P+LTDVH+ + C    EA+ D   +LQIPA LCRQTDLL AAAQTGR +N
Sbjct: 79  LRAVAKETGLPVLTDVHSAEDCVRLHEALGDVEAMLQIPAFLCRQTDLLIAAAQTGRAVN 138

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQF++P +M + ++K+   G + V   ERG SFGYN LV DMRS+PIM     PVIF
Sbjct: 139 VKKGQFVAPNDMKHAVEKVRESGNERVCLTERGASFGYNNLVVDMRSLPIMRGFA-PVIF 197

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           D +HSVQ P   G  SGG+ ++I  LA+AAVA G+ G+FLE H +P  A SDG N ++++
Sbjct: 198 DGTHSVQTPSSTGGVSGGQPEFIPVLARAAVAAGVDGLFLEVHDNPACAKSDGANALHLE 257

Query: 283 DLPKLLSQLLAI 294
            L  +L QLL +
Sbjct: 258 KLKGVLEQLLRV 269


>gi|319942353|ref|ZP_08016667.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sutterella
           wadsworthensis 3_1_45B]
 gi|319804041|gb|EFW00949.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sutterella
           wadsworthensis 3_1_45B]
          Length = 285

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 181/265 (68%), Gaps = 6/265 (2%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           N + F LIAGPC IES   A  IA ++  I   L I  ++K+S+DKANR+S    RG+G+
Sbjct: 10  NRRPFFLIAGPCVIESEAMALDIAHQMKEITAELGIPYIFKASYDKANRTSGKSFRGLGM 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
           +KG EI   ++ + G P+LTDVHTE +  A+A  VD+LQ PA LCRQTD + A AQ+G+ 
Sbjct: 70  EKGLEILAKVRAEVGVPVLTDVHTEAEVPAVAAVVDVLQTPAFLCRQTDFIRACAQSGKP 129

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKD------VLFCERGTSFGYNTLVTDMRSIPIMT 214
           +N+KKGQFL+P +M N++ K  A   +        + CERG SFGY  LV+DMR + IM 
Sbjct: 130 VNIKKGQFLAPGDMANVIAKARAAAQEAGLDPDRFMCCERGASFGYGNLVSDMRGLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PV+ DA+HSVQ PG +G  SGG+RQ++  LA+AA A+G+AG F+ETH +P  A SD
Sbjct: 190 ATGAPVVMDATHSVQLPGGNGTSSGGQRQFVPVLARAACAVGVAGFFMETHPNPAEALSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  + +LL++L+ ID+++K
Sbjct: 250 GPNAVPLNRMKELLAELVEIDRLVK 274


>gi|167855823|ref|ZP_02478575.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus parasuis
           29755]
 gi|167853036|gb|EDS24298.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus parasuis
           29755]
          Length = 284

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 176/265 (66%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + EK   + Q L +  V+K+SFDKANRSS+   R
Sbjct: 11  IDIANDKPFVLFGGMNVLESRDMAMQVCEKYVEVTQRLGVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVAEVVDIIQLPAFLARQTDLVEAMAR 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGTNFGYDNLVVDMLGFNVMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R  +  LA+A +AIG+AG+FLE H DP+ A  D
Sbjct: 191 SKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARAGMAIGLAGLFLEAHPDPNKAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID ++K
Sbjct: 251 GPSALPLSKLEAFVSQMKAIDDLVK 275


>gi|219870996|ref|YP_002475371.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus parasuis
           SH0165]
 gi|254807748|sp|B8F521|KDSA_HAEPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|219691200|gb|ACL32423.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus parasuis
           SH0165]
          Length = 284

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 176/265 (66%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + EK   + Q L +  V+K+SFDKANRSS+   R
Sbjct: 11  IDIANDKPFVLFGGMNVLESRDMAMQVCEKYVEVTQRLGVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVAEVVDIIQLPAFLARQTDLVEAMAR 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGTNFGYDNLVVDMLGFNVMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R  +  LA+A +AIG+AG+FLE H DP+ A  D
Sbjct: 191 SKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTKLARAGMAIGLAGLFLEAHPDPNKAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID ++K
Sbjct: 251 GPSALPLSKLEAFVSQMKAIDDLVK 275


>gi|282891297|ref|ZP_06299799.1| hypothetical protein pah_c050o071 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498794|gb|EFB41111.1| hypothetical protein pah_c050o071 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 280

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 122/262 (46%), Positives = 189/262 (72%), Gaps = 1/262 (0%)

Query: 39  FSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRG 97
           +  ++  V+++GPC IES +H    AE L  I +   ++ L++KSS+DKANR+S+   RG
Sbjct: 14  YIGQKDLVIMSGPCVIESEEHTLKAAETLQKIFEPFKSVKLIFKSSYDKANRTSVHSFRG 73

Query: 98  VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQT 157
            GL++G  I + ++++ G  ++TD+H+ ++  A +   +I+QIPA LCRQTDL+ AA +T
Sbjct: 74  PGLEEGLRILQKVREQTGLAVVTDIHSAEEAIAASQVCEIIQIPAFLCRQTDLIIAAGKT 133

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           G ++NVKKGQF++PW+M N+++K+H+ G   V+  +RG SFGYN LV+DMR+IPIM   G
Sbjct: 134 GAIVNVKKGQFMAPWDMKNVVEKIHSTGNHQVILTDRGASFGYNNLVSDMRAIPIMQQFG 193

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
           VPV FDA+HSVQ PG  G+ SGG+R++I  LAKAAVA G+  +F+E+H DP +A SD   
Sbjct: 194 VPVCFDATHSVQLPGGQGSVSGGQREFIPVLAKAAVAAGVDCLFIESHPDPKHAKSDAAT 253

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
           +++ K+LPKLL  L ++ ++++
Sbjct: 254 VMDFKELPKLLRLLESLYQLMR 275


>gi|226954260|ref|ZP_03824724.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp. ATCC
           27244]
 gi|294650464|ref|ZP_06727823.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter haemolyticus
           ATCC 19194]
 gi|226834988|gb|EEH67371.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp. ATCC
           27244]
 gi|292823607|gb|EFF82451.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 285

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 126/263 (47%), Positives = 168/263 (63%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL   R
Sbjct: 15  IQMANHLPFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLNSFR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG E   D+KK++  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 75  GPGLEKGIEWLADIKKQFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAK 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM  M
Sbjct: 135 TQAIINIKKAQFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMKEM 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP+ A  DGP
Sbjct: 195 NVPVFFDVTHALQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEAHPDPEKAKCDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL  +D ++K
Sbjct: 255 CALRLSQLEPFLAQLKELDTLVK 277


>gi|146281930|ref|YP_001172083.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas stutzeri
           A1501]
 gi|158514174|sp|A4VJU0|KDSA_PSEU5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|145570135|gb|ABP79241.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas stutzeri
           A1501]
          Length = 281

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 169/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A    E+   + + L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPFVLFGGINVLESRDLAMQACEEYVRVTEKLGIPYVFKASFDKANRSSITSFR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF  +KK +G P++TDVH   Q + +AD  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFEKVKKTFGVPVITDVHEPWQAQPVADVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +IL+K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TGAVINIKKAQFLAPQEMKHILKKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV FD +H++Q PG   + +GG R  +  LAKA ++ G+AG+FLE H DPDNA  DGP
Sbjct: 191 EYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGLSQGLAGLFLEAHPDPDNAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL  +D ++K
Sbjct: 251 CALRLNKLEAFLTQLKQLDDLVK 273


>gi|17545846|ref|NP_519248.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia solanacearum
           GMI1000]
 gi|20532102|sp|Q8Y0B7|KDSA_RALSO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|17428140|emb|CAD14829.1| probable 2-dehydro-3-deoxyphosphooctonate aldolase
           (phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-d-manno-octulosonic acid 8-phosphate
           synthetase) (kdo-8-phosphate synthetase) (kdo 8-p
           synthase) (kdops) protein [Ralstonia solanacearum
           GMI1000]
          Length = 284

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 179/265 (67%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C IES   A   A  L  I  +L I  +YKSSFDKANRSS A  RG+G++
Sbjct: 11  DRPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDASFRGLGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  +++++ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  EGLRILAEVRRQVGVPVLTDIHEIDEIKPVASVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K   H A+D        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-HAARDAGLPEDSFMACERGASFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH DP  A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGVFMETHPDPACAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + ++ +  LLS L  +D + K
Sbjct: 250 GPNAVPLRRMKDLLSVLKELDTLTK 274


>gi|33152005|ref|NP_873358.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus ducreyi
           35000HP]
 gi|44888089|sp|Q7VMV6|KDSA_HAEDU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|33148227|gb|AAP95747.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus ducreyi
           35000HP]
          Length = 286

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 124/266 (46%), Positives = 180/266 (67%), Gaps = 2/266 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
           Q+  +N++ F L  G   +ES D A  + EK  A+   LN+  ++K+SFDKANRSS+   
Sbjct: 10  QLEIANDRPFTLFGGMNVLESRDMAMRVCEKYVAVTNKLNVPYIFKASFDKANRSSIHSY 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G +IF++LK+ +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGMEEGLKIFQELKQTFGVNIITDVHEIYQCQPVAEVVDIIQLPAFLARQTDLVEAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM-- 213
           +TG VINVKK QFLSP +M NI++K+   G + ++ C+RGT+FGY+ LV DM S  IM  
Sbjct: 130 RTGAVINVKKPQFLSPGQMGNIVEKIVECGNQQIILCDRGTNFGYDNLVVDMLSFNIMKK 189

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
            S G PVIFD +H++Q     G+ SGG R  +  LA+A +A G+AG+FLE H DP+ A  
Sbjct: 190 VSDGCPVIFDVTHALQCRDPFGSASGGRRDQVTELARAGLATGLAGLFLEAHPDPNTAKC 249

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGP+ + +  L   ++Q+ AID ++K
Sbjct: 250 DGPSALPLDKLEAFVAQMKAIDNLVK 275


>gi|187924538|ref|YP_001896180.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           phytofirmans PsJN]
 gi|187715732|gb|ACD16956.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           phytofirmans PsJN]
          Length = 284

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 180/264 (68%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES      +A +L  IC  LNI  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDVAGRLKEICAKLNIPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH E + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILSEVKRQLGLPVLTDVHAEHEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-----HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K       A  ++D  + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPGDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+G++G+F+ETH +P  A SDG
Sbjct: 191 TNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVAVGVSGLFMETHPNPAEARSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  +  LL  L+ +D+ +K
Sbjct: 251 PNAVPLHRMADLLETLVTLDQAVK 274


>gi|170699285|ref|ZP_02890334.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           IOP40-10]
 gi|170135777|gb|EDT04056.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           IOP40-10]
          Length = 284

 Score =  254 bits (650), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 127/265 (47%), Positives = 179/265 (67%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAG C +ES       A +L  IC+ LN+  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K     A++        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-EAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETHQ+P  A SD
Sbjct: 190 ETSAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHQNPAEAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LL  L+ +D+ +K
Sbjct: 250 GPNAVPLNRMGALLETLVTLDQAVK 274


>gi|167586763|ref|ZP_02379151.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ubonensis
           Bu]
          Length = 284

 Score =  254 bits (650), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 127/265 (47%), Positives = 179/265 (67%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L  IC+ LNI  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNIPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+ ++ E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILSEVKRQLGLPVLTDVHSIEEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K     A++        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-EAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH  P  A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPKPAEAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LL  L+ +D+ +K
Sbjct: 250 GPNAVPLNRMGALLETLVTLDQAVK 274


>gi|261867618|ref|YP_003255540.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412950|gb|ACX82321.1| 3-deoxy-8-phosphooctulonate synthase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 284

 Score =  254 bits (650), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 180/277 (64%), Gaps = 6/277 (2%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           N  I LG     +  +N++ FVL  G   +ES D A  + EK   + Q L +  V+K+SF
Sbjct: 3   NKLIQLGD----IQIANDKPFVLFGGMNVLESRDMAMRVCEKYVEVTQKLGVPYVFKASF 58

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANRSS+   RG G+++G +IF +LK+ +G  I+TDVH   QC+ +A+ VDI+Q+PA L
Sbjct: 59  DKANRSSIHSYRGPGMEQGLKIFAELKQTFGVKIITDVHEIYQCQPVAEVVDIIQLPAFL 118

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
            RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ LV
Sbjct: 119 ARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIAECGNDKVILCDRGTNFGYDNLV 178

Query: 205 TDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
            DM    +M   S G PVIFD +HS+Q     G  SGG R  +  LA++ +A+G+AG+FL
Sbjct: 179 VDMLGFSVMKNVSKGCPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGLAVGLAGLFL 238

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           E H DP NA  DGP+ + +  L   ++Q+ AID ++K
Sbjct: 239 EAHPDPSNAKCDGPSALPLDKLEAFVNQMKAIDNLVK 275


>gi|300312082|ref|YP_003776174.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Herbaspirillum seropedicae SmR1]
 gi|300074867|gb|ADJ64266.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 284

 Score =  254 bits (650), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 178/262 (67%), Gaps = 8/262 (3%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F LIAG C IES   A   A  L  I   L I  +YKSSFDKANRSS +  RG+G++KG 
Sbjct: 14  FFLIAGTCVIESEQMALDTAGTLKEITAELGIPFIYKSSFDKANRSSGSSFRGLGMEKGL 73

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           EI   +KK+ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A AQ+G+ +N+K
Sbjct: 74  EILAKVKKEIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIK 133

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           KGQFL+P +M N++ K  A  AK+        + CERG SFGYN LV+DMRS+ IM   G
Sbjct: 134 KGQFLAPHDMVNVIDKARA-AAKEAGLPTDQFMACERGVSFGYNNLVSDMRSLAIMRETG 192

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
            PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A+GI+G+F+ETH +P  A SDGPN
Sbjct: 193 APVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAIAVGISGVFMETHPNPAEAKSDGPN 252

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
            + +  +  LL  ++ +D+I+K
Sbjct: 253 AVPLARMKDLLGTMIDLDRIVK 274


>gi|308271831|emb|CBX28439.1| 2-dehydro-3-deoxyphosphooctonate aldolase [uncultured
           Desulfobacterium sp.]
          Length = 283

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 128/263 (48%), Positives = 179/263 (68%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
           +++  +    V+IAGPC IE+ D    IA  L  + + L+I L++K+S+DKANR+SL+  
Sbjct: 20  KISIGDNHPLVIIAGPCVIENKDITLQIAYYLKELSEQLDIPLIFKASYDKANRTSLSSF 79

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL  G  I + +KK+ G  IL+DVH+  + +  AD +DI+QIPA LCRQTD +   A
Sbjct: 80  RGPGLLNGLNILKQIKKELGLTILSDVHSINEIDKAADILDIIQIPAFLCRQTDFILEIA 139

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +N+KKGQFL+PW++ N+++K+ + G K +L  ERGT+FGYN LV D R I IM  
Sbjct: 140 KTGKPVNIKKGQFLAPWDIINVVEKIASTGNKKILITERGTTFGYNNLVVDFRGIEIMQG 199

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFDA+HS+Q PG  G  SGGER++   LAKAAVA G  GIF+E H DPD A  DG
Sbjct: 200 SGYPVIFDATHSIQLPGGAGKSSGGERKFAPILAKAAVAAGADGIFMEVHPDPDKALCDG 259

Query: 276 PNMINIKDLPKLLSQLLAIDKII 298
           PN + +  L  L+ +L AI +++
Sbjct: 260 PNSLVLDSLYDLIKRLKAIRQVV 282


>gi|260911764|ref|ZP_05918336.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella sp. oral taxon 472
           str. F0295]
 gi|260634090|gb|EEX52208.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella sp. oral taxon 472
           str. F0295]
          Length = 250

 Score =  254 bits (649), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 166/249 (66%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           +   IAGPC IES +  + +AEKL  I + L + +++K+SFDKANR+S++  RG GL++G
Sbjct: 2   KTTFIAGPCVIESQELLYTVAEKLVEINKKLKVDIIFKASFDKANRTSISSFRGPGLERG 61

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
            E+  ++K KYG  +LTD+H   Q EA+   VD+LQIPA LCRQTDLL  AA+TG+V+N+
Sbjct: 62  LEMLANVKSKYGLKLLTDIHESHQAEAVGQIVDVLQIPAFLCRQTDLLVTAAKTGKVVNI 121

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KK QFLS  +M   ++K    GA +V   ERG +FGYN LV D R+IP M  +   VI D
Sbjct: 122 KKAQFLSGPDMKYPVEKAKEAGAAEVWLTERGNTFGYNNLVVDFRNIPDMKEIVPTVIMD 181

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
            +HSVQ+PG  G  +GG+R+++  +A AA A G  G F E H +PD   SDGPNM+ +  
Sbjct: 182 CTHSVQRPGAMGGKTGGDRRFVPAMALAAKAFGATGYFFEVHPNPDKGLSDGPNMLELDK 241

Query: 284 LPKLLSQLL 292
           L  L++ LL
Sbjct: 242 LEGLIADLL 250


>gi|146308055|ref|YP_001188520.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas mendocina
           ymp]
 gi|330504225|ref|YP_004381094.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas mendocina
           NK-01]
 gi|166987634|sp|A4XWS2|KDSA_PSEMY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|145576256|gb|ABP85788.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas mendocina
           ymp]
 gi|328918511|gb|AEB59342.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas mendocina
           NK-01]
          Length = 281

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 169/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A    E+   + + L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPFVLFGGINVLESRDLAMQACEEYVRVTEKLGIPYVFKASFDKANRSSITSFR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF ++KK +G P++TDVH   Q  A+A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFEEVKKTFGVPVITDVHEPHQAAAVAEVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV FD +H++Q PG   + +GG R  +  LAKA ++ G+AG+FLE H DP+NA  DGP
Sbjct: 191 EYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGMSQGLAGLFLEAHPDPENAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   LSQL  +D ++K
Sbjct: 251 CALRLNKLEPFLSQLKQLDDLVK 273


>gi|312959412|ref|ZP_07773929.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           WH6]
 gi|311286129|gb|EFQ64693.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           WH6]
          Length = 281

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 170/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++  VL  G   +ES D A  + E+   + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTQKLGIPYVFKASFDKANRSSVTSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G  IF+D+K+ +G PI+TDVH  +Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMRIFQDIKQAFGVPIITDVHEPEQAAVVAEVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TGAVINIKKAQFLAPQEMKHILNKCVEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  DGP
Sbjct: 191 EYPVFFDVTHALQMPGGRADSAGGRRAQVLDLAKAGLSQSLAGLFLEAHPDPDNAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL  +D+++K
Sbjct: 251 CALRLDKLEPFLAQLKQLDELVK 273


>gi|183221033|ref|YP_001839029.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
 gi|189911127|ref|YP_001962682.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167775803|gb|ABZ94104.1| 3-deoxy-8-phosphooctulonate synthase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167779455|gb|ABZ97753.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 281

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 117/257 (45%), Positives = 171/257 (66%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           Q F LI+GPC +E+ D    +  ++ AIC  L I  ++KSSFDKANRSS+   RG GL++
Sbjct: 19  QPFFLISGPCVMENKDLLDRVCGEMKAICDDLGIVYIFKSSFDKANRSSINSYRGPGLEE 78

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           GR++   +K KY  P+LTD+H   Q + + D+VDI QIPA L RQTDL+  AA+TG+ +N
Sbjct: 79  GRKLLDFIKNKYNVPVLTDIHETIQVDPLKDTVDIFQIPAFLSRQTDLIAKAAETGKWVN 138

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQF++P +  +I  K+   G++  +  ERG SFGY  LV D+R IP+M   G+P++F
Sbjct: 139 VKKGQFMAPDDTRHIKTKIQESGSEKYMVTERGASFGYGNLVFDLRGIPMMHKHGIPIVF 198

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           D +HS Q PG  GN +GG R++I  + + AV++G+ G+F+E H DP+ A SD      + 
Sbjct: 199 DGTHSAQLPGAAGNITGGLREFIPHMMRGAVSVGVEGLFMEVHPDPEKALSDATTQFPLA 258

Query: 283 DLPKLLSQLLAIDKIIK 299
               LL+QLL +D+++K
Sbjct: 259 KAKSLLTQLLELDRLVK 275


>gi|152979098|ref|YP_001344727.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           succinogenes 130Z]
 gi|171704317|sp|A6VP95|KDSA_ACTSZ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|150840821|gb|ABR74792.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           succinogenes 130Z]
          Length = 284

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 181/278 (65%), Gaps = 6/278 (2%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN  + +G+    +  +N + FVL  G   +ES D A  + EK   +   L +  V+K+S
Sbjct: 2   TNKTVKIGN----IDVANHKPFVLFGGMNVLESRDMAMQVCEKYVEVTDKLGVPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +IF++LKK +G  ++ DVH   QC  +A+ VD++Q+PA 
Sbjct: 58  FDKANRSSIHSYRGPGMEEGLKIFQELKKTFGVKVIADVHEIYQCNPVAEVVDVIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ L
Sbjct: 118 LARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGTNFGYDNL 177

Query: 204 VTDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           V DM    +M   S G PVIFD +HS+Q     G  SGG R+ +  LA+A +A+GIAG+F
Sbjct: 178 VVDMLGFGVMKKASKGCPVIFDVTHSLQCRDPFGAASGGRREQVTELARAGMAVGIAGLF 237

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           LE H DP+NA  DGP+ + +  L   + Q+ AID+++K
Sbjct: 238 LEAHPDPNNAKCDGPSALPLSALEGFVVQMKAIDELVK 275


>gi|332294922|ref|YP_004436845.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thermodesulfobium
           narugense DSM 14796]
 gi|332178025|gb|AEE13714.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thermodesulfobium
           narugense DSM 14796]
          Length = 272

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 123/264 (46%), Positives = 176/264 (66%), Gaps = 1/264 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N V    +  F  I GPC IES +H   +A  +  I +SLNI +++KSS+DKANR+SL+ 
Sbjct: 5   NDVEIGGKDLF-FILGPCVIESEEHVIKMANIIKEISKSLNIQVIFKSSYDKANRTSLSS 63

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+K+G  I   +KK+ G PI TDVH+ ++    +  +D++Q+PA LCRQTDLL +A
Sbjct: 64  YRGPGIKEGLRILERVKKEVGLPITTDVHSVEEVTLASKVIDLIQLPAFLCRQTDLLVSA 123

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +  R +N+KKGQF++P  +  +++K+ + G + V   ERG +FGYN LV DMRSI IM 
Sbjct: 124 GKAKRPVNIKKGQFVAPHSIGPMIEKVKSTGEERVCITERGYTFGYNNLVVDMRSIQIMK 183

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S  +PVIFDA+HSVQ PG  G+ SGGE+Q++  LA++AVA G  G+F+E H  P+ A  D
Sbjct: 184 SFNIPVIFDATHSVQLPGGLGDSSGGEKQFVPTLARSAVAAGADGVFMECHDCPECALCD 243

Query: 275 GPNMINIKDLPKLLSQLLAIDKII 298
           GPN + + ++  LL  L+AI   I
Sbjct: 244 GPNSMPVNEVEDLLKSLIAIKSAI 267


>gi|70728577|ref|YP_258326.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           Pf-5]
 gi|123762209|sp|Q4KHF7|KDSA_PSEF5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|68342876|gb|AAY90482.1| 3-deoxy-8-phosphooctulonate synthase [Pseudomonas fluorescens Pf-5]
          Length = 281

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 168/263 (63%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKASFDKANRSSVTSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G  IF D+K+ +G PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMRIFEDVKQAFGVPIITDVHEPAQAAVVAEVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TGAVINIKKAQFLAPQEMKHILSKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV FD +H++Q PG   + +GG R  +  LAKA ++  +AG+FLE H DPDNA  DGP
Sbjct: 191 EYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGMSQSLAGLFLEAHPDPDNAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL A+D+++K
Sbjct: 251 CALRLDKLEPFLAQLKALDELVK 273


>gi|83644693|ref|YP_433128.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hahella chejuensis KCTC
           2396]
 gi|123726426|sp|Q2SKX1|KDSA_HAHCH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|83632736|gb|ABC28703.1| 3-deoxy-8-phosphooctulonate synthase [Hahella chejuensis KCTC 2396]
          Length = 281

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 170/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  +AE    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IDIANDRPFVLFGGMNVLESRDLALQVAESYVKVTQKLGIPYVFKASFDKANRSSINSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL +G  IF ++K+ +  P++TD+H   Q + +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLDEGLRIFEEIKRTFNVPVITDIHEPHQAQPVAEVADIIQLPAFLSRQTDLVAAMAR 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG  +N+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TGCPVNIKKAQFLAPQEMKHILSKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV FD +HS+Q PG   + +GG R+ +V LA++ +A+G+AG+FLE H DPD A  DGP
Sbjct: 191 GYPVFFDVTHSLQMPGGLSSSAGGRREQVVQLARSGMAVGLAGLFLEAHPDPDVAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+Q+ A+D ++K
Sbjct: 251 CALRLSQLEPFLAQMKALDDMVK 273


>gi|299067178|emb|CBJ38374.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia solanacearum CMR15]
          Length = 284

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 178/265 (67%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C IES   A   A  L  I  +L I  +YKSSFDKANRSS A  RG+G+ 
Sbjct: 11  DRPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDASFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  +++++ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  EGLRILAEVRRQVGVPVLTDIHEIDEIKPVASVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K   H A+D        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-HAARDAGLPEDSFMACERGASFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH DP  A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGVFMETHPDPACAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + ++ +  LLS L  +D + K
Sbjct: 250 GPNAVPLRRMKDLLSVLKELDALTK 274


>gi|104783176|ref|YP_609674.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas entomophila
           L48]
 gi|122985779|sp|Q1I645|KDSA_PSEE4 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|95112163|emb|CAK16890.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas entomophila
           L48]
          Length = 281

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 169/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPFVLFGGMNVLESRDLALKVCEEYVRVTEKLGIPYVFKASFDKANRSSVNSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF ++K+ +  P++TDVH   QCE +A   DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFEEIKRTFNVPVITDVHEPYQCEPVAQVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TGAVINIKKAQFLAPHEMKHILAKCVEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV FD +HS+Q PG   + +GG R  +  LAKA ++ G+AG+FLE H DPDNA  DGP
Sbjct: 191 EYPVFFDVTHSLQTPGGRADSAGGRRAQVTDLAKAGMSQGLAGLFLEAHPDPDNAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL  +D ++K
Sbjct: 251 CALRLDKLEPFLAQLKQLDDLVK 273


>gi|241764328|ref|ZP_04762356.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidovorax delafieldii
           2AN]
 gi|241366284|gb|EER60827.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidovorax delafieldii
           2AN]
          Length = 285

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 173/264 (65%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +QRF LIAG C IE  + +  +A +L   C +L I L+YK SFDKANRSS   KRGVGL 
Sbjct: 11  DQRFFLIAGTCSIEGLEMSLDVAGQLKEACTALGIPLIYKGSFDKANRSSGTSKRGVGLD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +I  +++++   PILTDVH       +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  AGLKILDEVRRQLQLPILTDVHDTSHVAEVASVVDVLQTPAFLCRQTDFIRAVAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAK------DVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+PW+M N++ K  A  A+        L CERG SFGYN LV DM S+  M +
Sbjct: 131 NIKKGQFLAPWDMKNVIDKARAAAAEVGLSEDRFLACERGVSFGYNNLVADMTSLAEMRN 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FD +HSVQ+PG  G  SGG R+ +  LA+A VA G+AG+F+ETH  P  A SDG
Sbjct: 191 SGAPVVFDVTHSVQKPGGLGAVSGGAREMVPVLARAGVAAGVAGLFMETHPKPAEAWSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +K +  LL  L+A+D I K
Sbjct: 251 PNAVPLKHMKALLETLVALDDITK 274


>gi|229588822|ref|YP_002870941.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           SBW25]
 gi|259494406|sp|C3K6H5|KDSA_PSEFS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|229360688|emb|CAY47546.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           SBW25]
          Length = 281

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 120/263 (45%), Positives = 170/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKANRSSVTSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G  IF+D+K+ +G PI+TDVH  +Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMRIFQDIKQAFGVPIITDVHEPEQAAVVAEVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TGAVINIKKAQFLAPQEMKHILNKCVEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  DGP
Sbjct: 191 EYPVFFDVTHALQMPGGRADSAGGRRAQVLDLAKAGISQSLAGLFLEAHPDPDNAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL  +D+++K
Sbjct: 251 CALRLDKLEPFLAQLKQLDELVK 273


>gi|261493247|ref|ZP_05989774.1| 3-deoxy-8-phosphooctulonate synthase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261496510|ref|ZP_05992890.1| 3-deoxy-8-phosphooctulonate synthase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261307713|gb|EEY09036.1| 3-deoxy-8-phosphooctulonate synthase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261311097|gb|EEY12273.1| 3-deoxy-8-phosphooctulonate synthase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 284

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/265 (46%), Positives = 178/265 (67%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N + F L  G   +ES D A  + E+   + Q LN+  V+K+SFDKANRSS+   R
Sbjct: 11  IEVANHKPFTLFGGMNVLESRDMALRVCEQYVEVTQKLNVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK+ +G  I+TDVH   QC+ +A+ VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKQTFGVNIITDVHEIYQCKPVAEVVDVIQLPAFLARQTDLVEAMAR 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ LV DM    IM   
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVEKIAECGNDKVILCDRGTNFGYDNLVVDMLGFGIMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE H DP++A  D
Sbjct: 191 SKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGVAGLFLEAHPDPNSAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID+++K
Sbjct: 251 GPSALPLSKLEAFVSQMKAIDELVK 275


>gi|107028712|ref|YP_625807.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           AU 1054]
 gi|116690129|ref|YP_835752.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           HI2424]
 gi|122977742|sp|Q1BHS1|KDSA_BURCA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|158512287|sp|A0K8N2|KDSA_BURCH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|105897876|gb|ABF80834.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           AU 1054]
 gi|116648218|gb|ABK08859.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           HI2424]
          Length = 284

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/265 (47%), Positives = 178/265 (67%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAG C +ES       A +L  IC+ LN+  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K     A+D        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-DAARDAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SD
Sbjct: 190 ETNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LL  L+ +D+ +K
Sbjct: 250 GPNAVPLNRMGALLETLVTLDQAVK 274


>gi|50085137|ref|YP_046647.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp. ADP1]
 gi|59798253|sp|Q6FAT8|KDSA_ACIAD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|49531113|emb|CAG68825.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp. ADP1]
          Length = 285

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 166/263 (63%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D AF IAE    IC+ L I  V+K+SFDKANRSSL   R
Sbjct: 15  IQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICKRLEIPYVFKASFDKANRSSLHSFR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG E   ++KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 75  GPGLEKGIEWLGEIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAK 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  +IN+KK QFLSP EM++IL K    G   ++ CERGTSFGYN LV DM     M  M
Sbjct: 135 TQAIINIKKAQFLSPREMNHILNKCLEAGNDKLILCERGTSFGYNNLVVDMLGFDTMKEM 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP+ A  DGP
Sbjct: 195 NVPVFFDVTHALQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEAHPDPEKAKCDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL  +D ++K
Sbjct: 255 CALRLSQLEPFLAQLKELDALVK 277


>gi|158520528|ref|YP_001528398.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfococcus oleovorans
           Hxd3]
 gi|238686883|sp|A8ZU09|KDSA_DESOH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|158509354|gb|ABW66321.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfococcus oleovorans
           Hxd3]
          Length = 279

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 174/261 (66%), Gaps = 1/261 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N ++       V+IAGPC IE +D     AE L  +   L I  ++K+S+DKANRSS+  
Sbjct: 8   NDISIGGGAPLVVIAGPCVIEDYDTTLQAAEFLKTVTDRLGIPFIFKASYDKANRSSVHS 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G   G +I R +K++   P+L+DVHTE Q    A  +DI+Q PA LCRQTD +TA 
Sbjct: 68  FRGPGPDLGLDILRRVKERLHVPVLSDVHTESQIGPAAQVLDIIQTPAFLCRQTDFITAV 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM- 213
           A TG++IN+KKGQFL+PW++  +++K    G +++L  ERG  FGYN LV D R+IPIM 
Sbjct: 128 AATGKIINIKKGQFLAPWDITQVVEKARTAGNENILITERGAMFGYNNLVVDFRAIPIMQ 187

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
              G PVIFDA+HSVQ PG  G CSGG+R+++  LA+AAVA G  GIFLE H++PD A  
Sbjct: 188 QQTGKPVIFDATHSVQLPGGQGTCSGGQREFVPCLARAAVAAGADGIFLEVHRNPDKALC 247

Query: 274 DGPNMINIKDLPKLLSQLLAI 294
           DGPN + ++ +  LL+ L+AI
Sbjct: 248 DGPNSLPLEQVEPLLTALVAI 268


>gi|332666453|ref|YP_004449241.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haliscomenobacter
           hydrossis DSM 1100]
 gi|332335267|gb|AEE52368.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haliscomenobacter
           hydrossis DSM 1100]
          Length = 270

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 165/255 (64%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F LIAGPC IE  D A+ IAEK++ IC  L I  ++K S+ KANRS L    G+G ++  
Sbjct: 16  FFLIAGPCAIEGEDIAYEIAEKVHNICARLEIPYIFKGSYRKANRSRLDSFTGIGDERAL 75

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           E+ + + + YG P+ TD+HT+++    A  VD+LQIPA LCRQT LL AAA TG+V+NVK
Sbjct: 76  EVLQKIGEHYGIPVTTDIHTDEEAAYAAKYVDVLQIPAFLCRQTSLLVAAADTGKVVNVK 135

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQF+SP  M   + K+   G   +   ERG +FGY  LV D R +P+M S GVPV+ D 
Sbjct: 136 KGQFMSPEAMKYAVDKIRQSGNDKIFLTERGVTFGYQDLVIDYRGLPVMQSFGVPVVLDC 195

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HS+QQP      +GG    I  +AKAA+A+G+ G+F+ETH  P  A SDG NM+ ++ L
Sbjct: 196 THSLQQPNQASGVTGGRPALIETVAKAAIAVGVDGLFIETHPRPAEAKSDGANMLPLERL 255

Query: 285 PKLLSQLLAIDKIIK 299
             +L +L+ I + IK
Sbjct: 256 EPMLEKLVKIREAIK 270


>gi|262370257|ref|ZP_06063583.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthase
           [Acinetobacter johnsonii SH046]
 gi|262314599|gb|EEY95640.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthase
           [Acinetobacter johnsonii SH046]
          Length = 285

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 126/263 (47%), Positives = 166/263 (63%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D AF IAE    IC+ L I  V+K+SFDKANRSSL   R
Sbjct: 15  IQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICKRLEIPYVFKASFDKANRSSLNSFR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG E   D+KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 75  GPGLEKGIEWLADIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAK 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM  M
Sbjct: 135 TDAIINIKKAQFLAPHEMRHILHKCLEAGNDKLIICERGSAFGYNNLVVDMLGFDIMKEM 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP+ A  DGP
Sbjct: 195 NVPVFFDVTHALQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEAHPDPEKAKCDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL  +D ++K
Sbjct: 255 CALRMSQLEPFLAQLKELDTLVK 277


>gi|171912109|ref|ZP_02927579.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Verrucomicrobium
           spinosum DSM 4136]
          Length = 280

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 169/256 (66%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           R V I GPC IES D  + +A KL  I   L I  ++K+S+DKANRS+ +  RG+GL+ G
Sbjct: 24  RPVFILGPCVIESEDFIWDMARKLKVIADGLGIQWIFKASYDKANRSAGSSYRGLGLETG 83

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
             I   + K+   P+ TDVH+ ++    A+ +D LQIPA L RQTDL+ AA +TGR +NV
Sbjct: 84  CGILGAIGKELAVPVTTDVHSPEEATKAAEWIDFLQIPAFLSRQTDLILAAGRTGRAVNV 143

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQF++PW++ N+  KL + G ++  F ERGT+FGY  LV DMRS+  M  +G   + D
Sbjct: 144 KKGQFMAPWDVKNVADKLLSVGCENFTFTERGTTFGYQNLVADMRSLYWMRELGYRAVMD 203

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ+PG  G  +GG+ +    LA+AAVA G  G+FLETH +P  A SDGPN I + D
Sbjct: 204 ATHSVQRPGGLGTATGGDGKLAPVLARAAVAAGCDGVFLETHINPAEAFSDGPNQIPLAD 263

Query: 284 LPKLLSQLLAIDKIIK 299
           LP L+ QLL I +I +
Sbjct: 264 LPALIQQLLRIHEIAR 279


>gi|254362304|ref|ZP_04978416.1| 3-deoxy-8-phosphooctulonate synthase [Mannheimia haemolytica
           PHL213]
 gi|153093884|gb|EDN74812.1| 3-deoxy-8-phosphooctulonate synthase [Mannheimia haemolytica
           PHL213]
          Length = 284

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/265 (46%), Positives = 178/265 (67%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N + F L  G   +ES D A  + E+   + Q LN+  V+K+SFDKANRSS+   R
Sbjct: 11  IEVANHKPFTLFGGMNVLESRDMALRVCEQYVEVTQKLNVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK+ +G  I+TDVH   QC+ +A+ VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKQTFGVNIITDVHEIYQCKPVAEVVDVIQLPAFLARQTDLVEAMAR 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ LV DM    IM   
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVEKIAECGNDQVILCDRGTNFGYDNLVVDMLGFGIMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE H DP++A  D
Sbjct: 191 SKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGLFLEAHPDPNSAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID+++K
Sbjct: 251 GPSALPLSKLEAFVSQMKAIDELVK 275


>gi|256822075|ref|YP_003146038.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Kangiella koreensis DSM
           16069]
 gi|256795614|gb|ACV26270.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Kangiella koreensis DSM
           16069]
          Length = 286

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 169/258 (65%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LI GPC IES   A   A  +  +   L I  +YKSSFDKANRSS    RG GL+
Sbjct: 11  DKPFFLICGPCVIESEQLAIDTAGFMKEMTDRLGIPYIYKSSFDKANRSSSKSFRGPGLE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I + +K + G P+LTDVH +   + +AD VD++Q PA LCRQT+ +    + G  +
Sbjct: 71  EGLRILQKVKDQVGVPVLTDVHEDTPMQEVADVVDVMQTPAFLCRQTNFIRKVCEPGIPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFLSPW+M N++ K    G ++++ CERG SFGYN LV+DMRS+ IM   G P++
Sbjct: 131 NIKKGQFLSPWDMKNVVDKARETGNQNIMVCERGVSFGYNNLVSDMRSLSIMRETGCPIV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HS Q PG  G+ SGG R  I  LA+AA+A G++G+F+E+H +P+ A  DGPN   +
Sbjct: 191 YDATHSAQLPGGQGSTSGGLRDVIPVLARAAIAAGVSGVFMESHPNPEVAKCDGPNSFPM 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             + ++L  +  +D ++K
Sbjct: 251 YRIEEMLRVMKELDDVVK 268


>gi|262375246|ref|ZP_06068479.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter lwoffii SH145]
 gi|262309500|gb|EEY90630.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter lwoffii SH145]
          Length = 285

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 126/263 (47%), Positives = 165/263 (62%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D AF IAE    IC  L I  V+K+SFDKANRSSL   R
Sbjct: 15  IQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICTRLGIPYVFKASFDKANRSSLNSFR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG E   D+KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 75  GPGLEKGLEWLADIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAK 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM  M
Sbjct: 135 TDAIINIKKAQFLAPHEMRHILHKCLEAGNDKLIICERGSAFGYNNLVVDMLGFDIMKEM 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP+ A  DGP
Sbjct: 195 NVPVFFDVTHALQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEAHPDPEKAKCDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL  +D ++K
Sbjct: 255 CALRMSQLEPFLAQLKELDTLVK 277


>gi|83748262|ref|ZP_00945288.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia solanacearum
           UW551]
 gi|207722862|ref|YP_002253296.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-d-manno-octulosonic acid 8-phosphate
           synthetase) (kdo-8-phosphate synthetase) (kdo 8-p
           synthase) (kdops) protein [Ralstonia solanacearum MolK2]
 gi|207743533|ref|YP_002259925.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-d-manno-octulosonic acid 8-phosphate
           synthetase) (kdo-8-phosphate synthetase) (kdo 8-p
           synthase) (kdops) protein [Ralstonia solanacearum
           IPO1609]
 gi|300704503|ref|YP_003746106.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia solanacearum
           CFBP2957]
 gi|83725103|gb|EAP72255.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia solanacearum
           UW551]
 gi|206588046|emb|CAQ18626.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-d-manno-octulosonic acid 8-phosphate
           synthetase) (kdo-8-phosphate synthetase) (kdo 8-p
           synthase) (kdops) protein [Ralstonia solanacearum MolK2]
 gi|206594931|emb|CAQ61858.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-d-manno-octulosonic acid 8-phosphate
           synthetase) (kdo-8-phosphate synthetase) (kdo 8-p
           synthase) (kdops) protein [Ralstonia solanacearum
           IPO1609]
 gi|299072167|emb|CBJ43499.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia solanacearum
           CFBP2957]
          Length = 284

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 178/265 (67%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C IES   A   A  L  I  +L I  +YKSSFDKANRSS    RG+G++
Sbjct: 11  DRPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDTSFRGLGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G  I  +++++ G P+LTDVH   + + +A+ VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  AGLRILGEVRRQVGVPVLTDVHEIDEIKPVAEVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K   H A+D        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-HAARDAGLPEDSFMACERGASFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G+AG+F+ETH DP  A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAIATGVAGVFMETHPDPACAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + ++ +  LLS L  +D + K
Sbjct: 250 GPNAVPLRRMKDLLSVLKELDALTK 274


>gi|258648425|ref|ZP_05735894.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella tannerae ATCC
           51259]
 gi|260851173|gb|EEX71042.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella tannerae ATCC
           51259]
          Length = 252

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 167/248 (67%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
           +LIAGPC IES +   +IA +L  I  +LN  +++K+SFDKANR+SL   RG G+ +G +
Sbjct: 5   ILIAGPCVIESAELLDVIARELVRINAALNRQIIFKASFDKANRTSLHSFRGPGISRGLQ 64

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
           +  D+K+KYG  + TD+H   Q E + + VD+LQIPA LCRQTDLL AAA+T  ++N+KK
Sbjct: 65  MLADIKEKYGLMLTTDIHESTQAEQVGEVVDVLQIPAFLCRQTDLLVAAAKTSCIVNIKK 124

Query: 166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDAS 225
            QFLS  +M   ++K    GAK+V   ERG+ FGYN LV D R+IPIM      VI D +
Sbjct: 125 AQFLSGEDMQYPVEKCREAGAKEVWLTERGSMFGYNNLVVDFRNIPIMHQYADRVIMDCT 184

Query: 226 HSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLP 285
           HSVQ+PG  G  +GG R+YI  +A AA A G  G F ETH  PD A SDGPNM+ ++DL 
Sbjct: 185 HSVQRPGAAGGKTGGNREYIPAMALAAQAFGADGFFFETHPTPDEAKSDGPNMLYLRDLQ 244

Query: 286 KLLSQLLA 293
           +++  L++
Sbjct: 245 QVIQSLIS 252


>gi|206560542|ref|YP_002231307.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           J2315]
 gi|238693116|sp|B4EDA2|KDSA_BURCJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|198036584|emb|CAR52481.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           cenocepacia J2315]
          Length = 284

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 179/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAG C +ES       A +L  IC+ LN+  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILSEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-----HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K       A  ++D  + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SDG
Sbjct: 191 TNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  +  LL  L+ +D+ +K
Sbjct: 251 PNAVPLNRMGALLETLVTLDQAVK 274


>gi|118602804|ref|YP_904019.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|118567743|gb|ABL02548.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 277

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 176/260 (67%)

Query: 40  SNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVG 99
           S +Q F LIAG C IES       A  L  +  +L +  +YKSS+DKANR+S+   RG+G
Sbjct: 9   SIDQPFFLIAGLCVIESEALVMETATYLAKVTNNLGVNFIYKSSYDKANRTSVNSFRGLG 68

Query: 100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGR 159
           L++G  I + +K + G P+LTDVH +   + +A  VD++Q PA L RQT+ +    + G 
Sbjct: 69  LEQGLRILQKVKDEVGVPVLTDVHEDTPLDEVASVVDMMQTPAFLVRQTNFIQNVCKQGL 128

Query: 160 VINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
            +N+KKGQF +PW+M+N+++K HA G + +  C+RGTSFGYNTL++DMR +  M +   P
Sbjct: 129 PVNIKKGQFQAPWDMNNVVEKAHATGNQQITVCDRGTSFGYNTLISDMRGLVSMRNTNCP 188

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           V+FDA+HSVQQPG  G  SGG+R+ +  LA+AAVA+GI+GIF+ETH +P NA SDGPN I
Sbjct: 189 VVFDATHSVQQPGGQGTTSGGQREMVPVLARAAVAVGISGIFMETHPNPTNAKSDGPNSI 248

Query: 280 NIKDLPKLLSQLLAIDKIIK 299
            I  + +LL  L  +D + K
Sbjct: 249 PINKMDELLKILQELDNVTK 268


>gi|126667574|ref|ZP_01738544.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinobacter sp. ELB17]
 gi|126628000|gb|EAZ98627.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinobacter sp. ELB17]
          Length = 281

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 123/263 (46%), Positives = 170/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N + FVL AG   +ES + AF +AE    +C+ L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANHKPFVLFAGMNVLESRELAFEVAETYVEVCRKLGIPFVFKASFDKANRSSVNSFR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL KG +I  D+K ++G PI++DVH   Q    A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLDKGLQILADIKARFGVPIISDVHEAAQAAPAAEVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +I+ K    G   ++ CERG+SFGYN LV DM    IM SM
Sbjct: 131 TGAVINIKKAQFLAPQEMRHIIAKFEEAGNDQIILCERGSSFGYNNLVVDMLGFGIMKSM 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV+FD +HS+Q PG   + +GG R  +  LA A ++ G+AG+FLE H +PD A  DGP
Sbjct: 191 NVPVMFDVTHSLQMPGGRADSAGGRRAQVTELALAGMSQGLAGLFLEAHPNPDEAMCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L ++ A+D ++K
Sbjct: 251 CSLRLSQLEPFLERVKAVDDLVK 273


>gi|116749505|ref|YP_846192.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Syntrophobacter
           fumaroxidans MPOB]
 gi|189028420|sp|A0LK05|KDSA_SYNFM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|116698569|gb|ABK17757.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Syntrophobacter
           fumaroxidans MPOB]
          Length = 288

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 127/256 (49%), Positives = 173/256 (67%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           RF +I GPC IE+ D    IAE L   C  L+I  V+KSS+DKANR+S+   RG G+++G
Sbjct: 15  RFFVIGGPCVIENRDMTLRIAEFLRNACARLHIPCVFKSSYDKANRTSIHSYRGPGIEEG 74

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
             I  +++++ G P+LTDVH   +     + VDILQ+PA L RQTDL+ A   TG+ +N+
Sbjct: 75  LAILSEVRREIGIPVLTDVHGVSEVAPAKEVVDILQVPAFLARQTDLVVAVGLTGKPVNL 134

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KK QFL+P +M  +++K+   G   +L  ERGT FGYN LV DMRSIPI++  G PV+FD
Sbjct: 135 KKAQFLAPRDMSLVIEKVRGTGNDKILVTERGTQFGYNNLVVDMRSIPILSESGCPVVFD 194

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ PG  G  SGGER+Y+  LA AAVA G  G+FLE H+DPD A  DGPN + ++ 
Sbjct: 195 ATHSVQLPGGQGTRSGGERRYVAALACAAVAAGAHGVFLEMHEDPDRALCDGPNSLPLEQ 254

Query: 284 LPKLLSQLLAIDKIIK 299
           +  LL +LL I +I++
Sbjct: 255 VSPLLEKLLDIHRIVR 270


>gi|148556392|ref|YP_001263974.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingomonas wittichii
           RW1]
 gi|148501582|gb|ABQ69836.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingomonas wittichii
           RW1]
          Length = 283

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 132/260 (50%), Positives = 168/260 (64%), Gaps = 6/260 (2%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           +E  FV IAGPC IES      +AE+L AI   L +  ++KSSFDKANRSS A  RG GL
Sbjct: 11  DEPLFV-IAGPCVIESEALVLSVAERLRAIADRLGLFAIFKSSFDKANRSSGASFRGPGL 69

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
             G  I   ++ + G P+LTDVH   Q  A A  VD+LQ PA L RQTDL+ A   +GRV
Sbjct: 70  DDGLRILEKVRAETGLPVLTDVHDVDQVRAAAQVVDVLQTPAFLARQTDLIEAVGASGRV 129

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGA-----KDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
            N+KK QF++P +M +++ K             VL  ERGTSFGYN LVTD+R + IM  
Sbjct: 130 ANIKKAQFMAPHDMAHVVAKAQGAARAAGVETPVLVTERGTSFGYNNLVTDLRGLAIMRD 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+Y+  LA+ AVA+GIAG+F+ETH DP +A SDG
Sbjct: 190 TGCPVVFDATHSVQLPGGLGASSGGQREYVPVLARGAVAVGIAGLFMETHPDPASAMSDG 249

Query: 276 PNMINIKDLPKLLSQLLAID 295
           PN   +  L  LL++L A+D
Sbjct: 250 PNAWPLDRLEPLLAELQALD 269


>gi|32033822|ref|ZP_00134107.1| COG2877: 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate
           synthase [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|126209494|ref|YP_001054719.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae L20]
 gi|190151396|ref|YP_001969921.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|303250475|ref|ZP_07336672.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307244796|ref|ZP_07526895.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307251516|ref|ZP_07533423.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307253750|ref|ZP_07535604.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307256015|ref|ZP_07537803.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307258207|ref|ZP_07539950.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307262575|ref|ZP_07544206.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|238692364|sp|B3GZI6|KDSA_ACTP7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|126098286|gb|ABN75114.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|189916527|gb|ACE62779.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302650463|gb|EFL80622.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306854241|gb|EFM86447.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306860980|gb|EFM92986.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306863234|gb|EFM95174.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865437|gb|EFM97332.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306867667|gb|EFM99512.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306872073|gb|EFN03786.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 284

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 124/266 (46%), Positives = 177/266 (66%), Gaps = 2/266 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +N++ F L  G   +ES D A  + E+   +   L +  V+K+SFDKANRSS+   
Sbjct: 10  NIEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKASFDKANRSSIHSY 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGMEEGLKIFQELKDTFGVNIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM-- 213
           +TG VINVKK QFLSP +M NI++K+   G ++V+ C+RGT+FGY+ LV DM    IM  
Sbjct: 130 RTGAVINVKKPQFLSPGQMGNIVEKIAECGNENVILCDRGTNFGYDNLVVDMLGFNIMKK 189

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
            S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE H DP+NA  
Sbjct: 190 VSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGLFLEAHPDPNNAKC 249

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGP+ + +  L   +SQ+ AID ++K
Sbjct: 250 DGPSALPLSKLEAFVSQMKAIDDLVK 275


>gi|218262774|ref|ZP_03477132.1| hypothetical protein PRABACTJOHN_02811 [Parabacteroides johnsonii
           DSM 18315]
 gi|218223145|gb|EEC95795.1| hypothetical protein PRABACTJOHN_02811 [Parabacteroides johnsonii
           DSM 18315]
          Length = 269

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 167/261 (63%)

Query: 39  FSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGV 98
             ++  F L+AGPC IE  D A  IAEK+  I   LNI  V+K S+ KANRS L    G+
Sbjct: 7   LKDKDNFFLMAGPCVIEGEDMALRIAEKVVGITNKLNIPYVFKGSYRKANRSRLDSFTGI 66

Query: 99  GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTG 158
           G +K  +I R + + +G P +TD+H   +    A+ VD+LQIPA LCRQTDLL AAA+TG
Sbjct: 67  GDEKALKILRKVGETFGIPTVTDIHETTEAAMAAEYVDVLQIPAFLCRQTDLLVAAAKTG 126

Query: 159 RVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGV 218
           +++N+KKGQFLSP  M   +QK+   G  +V+  ERGT+FGY  LV D R IP M   G 
Sbjct: 127 KIVNIKKGQFLSPGAMQFAVQKVADAGNDNVMITERGTTFGYTDLVVDYRGIPQMQQFGY 186

Query: 219 PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNM 278
           PVI D +HS+QQP      +GG    I  +AKAA+A+G  G+F+ETH +P  A SDG NM
Sbjct: 187 PVIMDVTHSLQQPNQTSGVTGGLPALIETIAKAAIAVGTDGLFIETHPEPSKAKSDGANM 246

Query: 279 INIKDLPKLLSQLLAIDKIIK 299
           + +  L ++L++L+ I + ++
Sbjct: 247 LQLDLLEEMLTKLVRIREAVR 267


>gi|297170491|gb|ADI21521.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [uncultured verrucomicrobium HF0070_15G23]
          Length = 226

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 119/226 (52%), Positives = 162/226 (71%)

Query: 74  LNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIAD 133
           + I  ++K+S+DKANR+S   +RG GLK+G  I + +++K G P+LTDVH   Q  + A+
Sbjct: 1   MGITYIFKASYDKANRTSGKSRRGPGLKEGLRILKTVREKVGVPVLTDVHDAVQSTSAAE 60

Query: 134 SVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCE 193
            VDI+QIPA LCRQTDL+T A +T  ++N+KKGQFLSP EM  ++ K  + G K VL  E
Sbjct: 61  VVDIIQIPAFLCRQTDLITTAVKTPVIVNLKKGQFLSPQEMSQVVLKAESAGGKMVLVTE 120

Query: 194 RGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAV 253
           RGT+FGYN LV+DMRSIP+M   G PV+FDA+HSVQ PG  G+ SGG  ++   LA+AAV
Sbjct: 121 RGTTFGYNNLVSDMRSIPVMKQSGYPVVFDATHSVQMPGGRGDKSGGNGEFAPVLARAAV 180

Query: 254 AIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           A G+ G+F+ETH  P+ A SDGPNMI +  + +LL QL+ I K ++
Sbjct: 181 AAGVNGLFIETHPTPEKAWSDGPNMIPLIKMRRLLQQLVKIHKALR 226


>gi|288800038|ref|ZP_06405497.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella sp. oral taxon 299
           str. F0039]
 gi|288333286|gb|EFC71765.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella sp. oral taxon 299
           str. F0039]
          Length = 253

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 123/247 (49%), Positives = 163/247 (65%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
           + IAGPC IES +   ++AE+L AI   L I +++K+SFDKANR+S+   RG GL+KG E
Sbjct: 7   IFIAGPCVIESQELLNVVAEELKAINNDLGIDIIFKASFDKANRTSIRSFRGPGLEKGLE 66

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
           +  ++K++YG  ILTD+H   Q EA+    D++QIPA LCRQTDLL AAA+TGR++N+KK
Sbjct: 67  MLANVKERYGLRILTDIHESCQAEAVGQVCDVIQIPAFLCRQTDLLVAAAKTGRIVNIKK 126

Query: 166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDAS 225
            QFLS  +M   L+K    GAKDV   ERG SFGYN LV D R+IP M +    VI D +
Sbjct: 127 AQFLSGLDMKYPLEKAKEAGAKDVWLTERGNSFGYNNLVVDFRNIPDMLNYTPNVIMDCT 186

Query: 226 HSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLP 285
           HSVQ+PG     +GG+R+++  +A AA A G  G F E H DPD   SD  NM+ +  L 
Sbjct: 187 HSVQRPGAGDGKTGGDRRFVPSMAMAAKAFGATGYFFEVHPDPDEGLSDAANMLELNKLK 246

Query: 286 KLLSQLL 292
            L+  LL
Sbjct: 247 GLIKNLL 253


>gi|330444045|ref|YP_004377031.1| 3-deoxy-8-phosphooctulonate synthase [Chlamydophila pecorum E58]
 gi|328807155|gb|AEB41328.1| 3-deoxy-8-phosphooctulonate synthase [Chlamydophila pecorum E58]
          Length = 269

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 122/250 (48%), Positives = 164/250 (65%), Gaps = 2/250 (0%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSL--NIGLVYKSSFDKANRSSLAGKRGV 98
           N+ + +LIAGPC IES + A   A KL+ +       I  ++KSS+DKANRSSLA  RG 
Sbjct: 2   NKDKMILIAGPCVIESEEAALQTAAKLHELLAPYADRIRWIFKSSYDKANRSSLASYRGP 61

Query: 99  GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTG 158
           G+++G  I   +K  YG  ILTDVH+ Q+    A+  DILQIPA LCRQTDLL AA +TG
Sbjct: 62  GIREGLNILAKIKATYGVEILTDVHSPQEAHQAAEVCDILQIPAFLCRQTDLLVAAGETG 121

Query: 159 RVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGV 218
             +N+KKGQFLSPW+M   + K+ +    +++  ERG SFGY  L+ DMRS+ +M  MG 
Sbjct: 122 ACVNIKKGQFLSPWDMQGPIDKILSTRNDNIMLTERGCSFGYQNLIVDMRSLAVMKGMGF 181

Query: 219 PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNM 278
           PVIFD +H+VQ PG     SGG+ ++I  L +AA+A GI G+F+ETH  P  A SD  +M
Sbjct: 182 PVIFDGTHAVQLPGALTTQSGGQTEFIPTLTRAAIATGIHGLFIETHLQPAMAKSDAASM 241

Query: 279 INIKDLPKLL 288
           ++I+    LL
Sbjct: 242 LDIETFASLL 251


>gi|115352196|ref|YP_774035.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           AMMD]
 gi|171321918|ref|ZP_02910809.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           MEX-5]
 gi|115282184|gb|ABI87701.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           AMMD]
 gi|171092783|gb|EDT38055.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           MEX-5]
          Length = 284

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 178/265 (67%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAG C +ES       A +L  IC+ LN+  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K     A++        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-EAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SD
Sbjct: 190 ETSAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LL  L+ +D+ +K
Sbjct: 250 GPNAVPLNRMGALLETLVTLDQAVK 274


>gi|77457347|ref|YP_346852.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           Pf0-1]
 gi|123605782|sp|Q3KH93|KDSA_PSEPF RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|77381350|gb|ABA72863.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           Pf0-1]
          Length = 281

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 168/263 (63%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKANRSSVTSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G  IF+D+K+ +G PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMRIFQDIKQAFGVPIITDVHEPDQAAVVAEVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TNAVINIKKAQFLAPQEMKHILNKCVEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV FD +HS+Q PG   + +GG R  +  LAKA ++  +AG+FLE H DPDNA  DGP
Sbjct: 191 EYPVFFDVTHSLQMPGGRSDSAGGRRAQVTDLAKAGMSQSLAGLFLEAHPDPDNAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL A+D+++K
Sbjct: 251 CALRLDKLEPFLAQLKALDELVK 273


>gi|303251817|ref|ZP_07337988.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307249117|ref|ZP_07531124.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307260445|ref|ZP_07542140.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|302649247|gb|EFL79432.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306854405|gb|EFM86601.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306869848|gb|EFN01630.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 284

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 124/266 (46%), Positives = 177/266 (66%), Gaps = 2/266 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +N++ F L  G   +ES D A  + E+   +   L +  V+K+SFDKANRSS+   
Sbjct: 10  NIEVANDKPFTLFGGMNVLESRDMAMGVCEQYVEVTNKLGVPYVFKASFDKANRSSIHSY 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGMEEGLKIFQELKDTFGVNIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM-- 213
           +TG VINVKK QFLSP +M NI++K+   G ++V+ C+RGT+FGY+ LV DM    IM  
Sbjct: 130 RTGAVINVKKPQFLSPGQMGNIVEKIAECGNENVILCDRGTNFGYDNLVVDMLGFNIMKK 189

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
            S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE H DP+NA  
Sbjct: 190 VSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGLFLEAHPDPNNAKC 249

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGP+ + +  L   +SQ+ AID ++K
Sbjct: 250 DGPSALPLSKLEAFVSQMKAIDDLVK 275


>gi|254524316|ref|ZP_05136371.1| 3-deoxy-8-phosphooctulonate synthase [Stenotrophomonas sp. SKA14]
 gi|219721907|gb|EED40432.1| 3-deoxy-8-phosphooctulonate synthase [Stenotrophomonas sp. SKA14]
          Length = 276

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 170/258 (65%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q   LIAGPC IES       A KL  I   L +  ++KSSFDKANR+S    RG G++
Sbjct: 11  DQPLFLIAGPCVIESMQLQLDTAGKLKEITDRLGVNFIFKSSFDKANRTSGTAFRGPGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G ++  ++KK+ G P+LTDVH     E +A  VD+LQ PA L RQTD +      G+ +
Sbjct: 71  EGLKVLAEVKKQIGVPVLTDVHEYTPMEEVASVVDVLQTPAFLVRQTDFIRKVCSAGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M  +++K  A G + ++ CERG SFGYN LV+DMRS+ +M   G PV+
Sbjct: 131 NIKKGQFLAPWDMKPVVEKAKATGNEQIMVCERGASFGYNNLVSDMRSLAVMRDTGCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP  A SDGPN   +
Sbjct: 191 FDATHSVQLPGGQGTSSGGQREHVPVLARAAVAVGISGLFAETHPDPSKALSDGPNAWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             +  LL  L+ +D + K
Sbjct: 251 DQMEALLETLMELDAVTK 268


>gi|325526448|gb|EGD04030.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia sp. TJI49]
          Length = 284

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 180/264 (68%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L  IC+ LN+  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+ ++ E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILSEVKRQLGLPVLTDVHSIEEIEPVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-----HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K       A  ++D  + CERG SFGYN LV+DMR++ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRALAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SDG
Sbjct: 191 TNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  +  LL  L+ +D+ +K
Sbjct: 251 PNAVPLNRMSALLETLVTLDQAVK 274


>gi|170733462|ref|YP_001765409.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           MC0-3]
 gi|254247800|ref|ZP_04941121.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Burkholderia cenocepacia PC184]
 gi|238688558|sp|B1JUY7|KDSA_BURCC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|124872576|gb|EAY64292.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Burkholderia cenocepacia PC184]
 gi|169816704|gb|ACA91287.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           MC0-3]
          Length = 284

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 179/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAG C +ES       A +L  IC+ LN+  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-----HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K       A  ++D  + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SDG
Sbjct: 191 TNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  +  LL  L+ +D+ +K
Sbjct: 251 PNAVPLNRMGALLETLVTLDQAVK 274


>gi|330817643|ref|YP_004361348.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia gladioli
           BSR3]
 gi|327370036|gb|AEA61392.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia gladioli
           BSR3]
          Length = 284

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 173/264 (65%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L   C  LNI  +YKSSFDKANRSS    RG G+ 
Sbjct: 11  DRPFFLIAGTCVVESEQMTIDTAGRLKESCAKLNIPFIYKSSFDKANRSSGTSFRGPGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH   + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILSEVKRQLGLPVLTDVHEVDEIEPVAAVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAK------DVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K  A   +        + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARAAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SDG
Sbjct: 191 TGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  +  LL  L+ +D  +K
Sbjct: 251 PNAVPLHRMAALLETLVTLDAAVK 274


>gi|186476198|ref|YP_001857668.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia phymatum
           STM815]
 gi|238691312|sp|B2JIX1|KDSA_BURP8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|184192657|gb|ACC70622.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia phymatum
           STM815]
          Length = 284

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 129/264 (48%), Positives = 178/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A KL  IC  L I  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGKLKEICAKLKIPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G  +LTDVH+E + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILSEVKRQLGLHVLTDVHSEHEIEPVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-----HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K       A  ++D  + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA GIAG+F+ETH +P  A SDG
Sbjct: 191 TGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGIAGLFMETHPNPAEAKSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  +  LL  L+ +D+ +K
Sbjct: 251 PNAVPLHRMADLLETLMTLDQAVK 274


>gi|322513492|ref|ZP_08066602.1| 3-deoxy-8-phosphooctulonate synthase [Actinobacillus ureae ATCC
           25976]
 gi|322120711|gb|EFX92595.1| 3-deoxy-8-phosphooctulonate synthase [Actinobacillus ureae ATCC
           25976]
          Length = 284

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 124/266 (46%), Positives = 177/266 (66%), Gaps = 2/266 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +N++ F L  G   +ES D A  + EK   +   L +  V+K+SFDKANRSS+   
Sbjct: 10  NIEVANDKPFTLFGGMNVLESRDMAMRVCEKYIEVTNKLGVPYVFKASFDKANRSSIHSY 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGMEEGLKIFQELKDTFGVNIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM-- 213
           +TG VINVKK QFLSP +M NI++K+   G ++V+ C+RGT+FGY+ LV DM    IM  
Sbjct: 130 RTGAVINVKKPQFLSPGQMGNIVEKIAECGNENVILCDRGTNFGYDNLVVDMLGFNIMKK 189

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
            S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE H DP++A  
Sbjct: 190 VSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGLFLEAHPDPNSAKC 249

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGP+ + +  L   +SQ+ AID ++K
Sbjct: 250 DGPSALPLSKLEAFVSQMKAIDDLVK 275


>gi|315127036|ref|YP_004069039.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas sp.
           SM9913]
 gi|315015550|gb|ADT68888.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas sp.
           SM9913]
          Length = 284

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 121/265 (45%), Positives = 174/265 (65%), Gaps = 1/265 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N++  +N + FVL  G   +ES D A  IAE    +   LNI  V+K+SFDKANRSS+  
Sbjct: 9   NEIELANNKPFVLFGGMNVLESRDLAMRIAEHYVEVTTKLNIPYVFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++K  +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKNTFNIPLITDVHEPHQAAPVAEVVDVIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +V  CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNNNVALCERGSSFGYNNLVVDMLGMDDMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           +M  PVIFDA+H++Q+PG   + + G R     LA++ +A+GIAG+F+E H +P+ A  D
Sbjct: 189 TMA-PVIFDATHALQRPGGRADSADGRRAQAAELARSGMALGIAGLFIEAHPNPNEAKCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP  + +  L   LSQ+ A+D +IK
Sbjct: 248 GPCALALSKLEGYLSQMKAVDDLIK 272


>gi|118586600|ref|ZP_01544041.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oenococcus oeni ATCC
           BAA-1163]
 gi|290890876|ref|ZP_06553941.1| hypothetical protein AWRIB429_1331 [Oenococcus oeni AWRIB429]
 gi|118432979|gb|EAV39704.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oenococcus oeni ATCC
           BAA-1163]
 gi|290479455|gb|EFD88114.1| hypothetical protein AWRIB429_1331 [Oenococcus oeni AWRIB429]
          Length = 284

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 164/247 (66%), Gaps = 1/247 (0%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           + +  L+AGPC IES++    +AEKL  I + L+I  V+KSSFDKANRSS    RG GL+
Sbjct: 16  DSQLTLLAGPCAIESYETCAQVAEKLKEITEKLHINYVFKSSFDKANRSSADSDRGSGLE 75

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG  I   +KK +  PI+TDVH   QC+ +++  D+LQIPA L RQTDLL AAA+TG+V+
Sbjct: 76  KGLAILERIKKNFDLPIVTDVHESYQCQPVSEVADVLQIPAFLSRQTDLLLAAAKTGKVV 135

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQF++P ++ +   K+    +K +L  ERGTSFGY+ LV DM  +  M   G P+I
Sbjct: 136 NIKKGQFMAPEDIKSATSKIDPITSK-ILITERGTSFGYHRLVVDMTGLIEMREAGFPII 194

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ P  HGN SGG R Y  PL +AA+ IG+ GIF E H +P  A SD  N + +
Sbjct: 195 FDATHSVQVPSAHGNHSGGNRDYAFPLMRAALEIGVDGIFAEVHPNPPEAISDADNQLYL 254

Query: 282 KDLPKLL 288
             +  +L
Sbjct: 255 SKIEPIL 261


>gi|226329849|ref|ZP_03805367.1| hypothetical protein PROPEN_03761 [Proteus penneri ATCC 35198]
 gi|225200644|gb|EEG82998.1| hypothetical protein PROPEN_03761 [Proteus penneri ATCC 35198]
          Length = 292

 Score =  251 bits (641), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 174/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D A  I E    + Q LNI  V+K+SFDKANRSS+   R
Sbjct: 19  IKVANNLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLNIPYVFKASFDKANRSSIHSYR 78

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK+ +G  I+TDVH   Q + +++ VD++Q+PA L RQTDL+ A A+
Sbjct: 79  GPGLEEGLKIFQELKETFGVKIITDVHEAAQAQPVSEVVDVIQLPAFLARQTDLVEAMAK 138

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ LV DM    +M   
Sbjct: 139 TGAVINVKKPQFVSPGQMGNIVDKFKEGGNDQVILCDRGSNFGYDNLVVDMLGFHVMMQA 198

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R  +  LA+A +A+G+AG+FLE H DPDNA  D
Sbjct: 199 SQGAPVIFDVTHSLQCRDPFGAASGGRRAQVAELARAGMAVGLAGLFLEAHPDPDNALCD 258

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L+Q+ AID+++K
Sbjct: 259 GPSALPLAKLEPFLAQIKAIDEVVK 283


>gi|262372545|ref|ZP_06065824.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter junii SH205]
 gi|262312570|gb|EEY93655.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter junii SH205]
          Length = 285

 Score =  251 bits (641), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 125/263 (47%), Positives = 168/263 (63%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL   R
Sbjct: 15  IQMANHLPFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLNSFR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG +   D+KK++  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 75  GPGLEKGIKWLADIKKQFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAK 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM  M
Sbjct: 135 TQAIINIKKAQFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMKEM 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +HS+Q PG   + +GG R  I  LA+A +A G+AG+FLE H +P+ A  DGP
Sbjct: 195 NVPVFFDVTHSLQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEAHPEPELAKCDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL  +D ++K
Sbjct: 255 CALRLSQLEPFLAQLKELDTLVK 277


>gi|289549331|ref|YP_003474319.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thermocrinis albus DSM
           14484]
 gi|289182948|gb|ADC90192.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thermocrinis albus DSM
           14484]
          Length = 260

 Score =  251 bits (641), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 124/254 (48%), Positives = 171/254 (67%), Gaps = 2/254 (0%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           ++IAGPC IES +    +A  L  + +       V+K+SFDKANRSS+   RG GL++G 
Sbjct: 2   LIIAGPCVIESEELVLEVATFLRKLAEKYPQFRFVFKASFDKANRSSVKSFRGPGLEEGL 61

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
            I + +K++ G  + TDVH   Q + +A  VDI+QIPA L RQTDLL  AA++G+ +NVK
Sbjct: 62  RILQKVKEETGLEVTTDVHETWQVKPVAQVVDIIQIPAFLSRQTDLLLEAARSGKPVNVK 121

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFL+PW++ N+++KL   GA D    ERG  FGYN LV D RS+ IM+S    VIFDA
Sbjct: 122 KGQFLAPWDVKNVVEKLRFGGAVDYYVTERGVCFGYNNLVVDFRSLVIMSSF-TKVIFDA 180

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G+ S G+R+++VPL +AAVA+G  GIF+ETH DPD A SDGPNM+ +  L
Sbjct: 181 THSVQLPGGAGDRSSGQREFVVPLIRAAVAVGCDGIFMETHPDPDRALSDGPNMVPLSWL 240

Query: 285 PKLLSQLLAIDKII 298
             ++  +  I + +
Sbjct: 241 EGIMENVQRIREAV 254


>gi|226945922|ref|YP_002800995.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Azotobacter vinelandii
           DJ]
 gi|259494401|sp|C1DSS7|KDSA_AZOVD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226720849|gb|ACO80020.1| 3-deoxy-8-phosphooctulonate synthase [Azotobacter vinelandii DJ]
          Length = 281

 Score =  251 bits (641), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 124/276 (44%), Positives = 169/276 (61%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           T   I +G     +  +N++   L  G   +ES D A  + E+   +   L I  V+K+S
Sbjct: 2   TQKTIRVGD----IEIANDRPMALFGGMNVLESRDLALRVCEEYVRVTGKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG GL++G  IF ++KK +G P+LTDVH   Q   +A+  DILQ+PA 
Sbjct: 58  FDKANRSSITSFRGPGLEEGMRIFEEVKKAFGVPVLTDVHEPWQAAPVAEVCDILQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+T  VIN+KK QFL+P EM +IL+K    G   ++ CERGTSFGYN L
Sbjct: 118 LSRQTDLVVAMAKTSAVINIKKAQFLAPQEMQHILRKCEEAGNDQLILCERGTSFGYNNL 177

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM    IM     PV FD +H++Q PG   + +GG R  +  LAKA ++ G+AG+FLE
Sbjct: 178 VVDMLGFGIMKQFEYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGISQGLAGLFLE 237

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DPDNA  DGP  + +  L   L+QL  +D ++K
Sbjct: 238 AHPDPDNAKCDGPCALRLDKLEPFLAQLAQLDALVK 273


>gi|319956405|ref|YP_004167668.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitratifractor
           salsuginis DSM 16511]
 gi|319418809|gb|ADV45919.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitratifractor
           salsuginis DSM 16511]
          Length = 266

 Score =  251 bits (641), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 173/266 (65%), Gaps = 13/266 (4%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
           +LIAGPC IE+ ++ F IAE L    +       +K+SFDKANR+SL   RG GL++G +
Sbjct: 2   ILIAGPCVIENRENIFRIAEALMPYHEDCTKEFYFKASFDKANRTSLDSFRGPGLEEGLK 61

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
           I +++K+++G+ ILTD+H   Q   +A+  D+LQIPA LCRQTDLL AAA+TG  +N+KK
Sbjct: 62  ILQEVKERFGYSILTDIHEPAQAAPVAEVADVLQIPAFLCRQTDLLVAAAKTGAKVNIKK 121

Query: 166 GQFLSPWEM-HNILQKLHAHGAK-----------DVLFCERGTSFGYNTLVTDMRSIPIM 213
           GQFL+P  M +++ + L   G +            V   ERGT+FGY  LV DMRS PIM
Sbjct: 122 GQFLAPQAMEYSVAKVLKTRGYEGEVNYEASEKYGVWLTERGTTFGYGNLVVDMRSFPIM 181

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
                PV+FDA+HSVQ P   G  SGG+ +++  LA+AA   G+ G F ETH DP  A S
Sbjct: 182 RRFA-PVVFDATHSVQMPASGGATSGGDSRFVPTLARAAAGAGVDGFFFETHFDPSVALS 240

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGPNMI ++DL +L+ Q+ AI  I++
Sbjct: 241 DGPNMIKLQDLERLIPQIDAIRSIVE 266


>gi|300691893|ref|YP_003752888.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia solanacearum PSI07]
 gi|299078953|emb|CBJ51613.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia solanacearum PSI07]
          Length = 284

 Score =  251 bits (641), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 178/265 (67%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C IES   A   A  L  I  +L I  +YKSSFDKANRSS A  RG+G+ 
Sbjct: 11  DRPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDASFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  +++++ G P+LTDVH   + + +A+ VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  EGLRILGEVRRQVGVPVLTDVHEIDEIKPVAEVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K   H A+D        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-HAARDAGLPEDSFMACERGASFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G++G+F+ETH DP  A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAIATGVSGVFMETHPDPACAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LLS L  +D + K
Sbjct: 250 GPNAVPLHRMKDLLSVLKELDALTK 274


>gi|254427740|ref|ZP_05041447.1| 3-deoxy-8-phosphooctulonate synthase [Alcanivorax sp. DG881]
 gi|196193909|gb|EDX88868.1| 3-deoxy-8-phosphooctulonate synthase [Alcanivorax sp. DG881]
          Length = 282

 Score =  251 bits (641), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 120/267 (44%), Positives = 168/267 (62%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N + F+N++   L  G   +ES D A  +AE    +   LN+  V+K+SFDKANRSSL+ 
Sbjct: 10  NGLEFANDKPMALFGGMNVLESRDMAMQVAEAYAEVTSKLNMPWVFKASFDKANRSSLSS 69

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL +G +IF ++KK +  P++TDVH   Q   +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 70  YRGPGLDEGLKIFEEVKKTFNCPVITDVHEPYQAAPVAEVVDIIQLPAFLARQTDLVVAM 129

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 130 AKTGAIINIKKPQFLAPHEMSHILHKCEDAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +H++Q+PG   + + G R  +  L +A ++ GIAG+FLE H DPDNA  D
Sbjct: 190 QFNYPVFFDVTHALQKPGGRADSADGRRAQVAELGRAGISQGIAGLFLEAHPDPDNAKCD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GP  + +  L   L+Q+  +D  +K L
Sbjct: 250 GPCALRLDRLEPFLAQMQTLDNTVKAL 276


>gi|221198413|ref|ZP_03571459.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia multivorans
           CGD2M]
 gi|221208910|ref|ZP_03581907.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia multivorans
           CGD2]
 gi|221171193|gb|EEE03643.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia multivorans
           CGD2]
 gi|221182345|gb|EEE14746.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia multivorans
           CGD2M]
          Length = 284

 Score =  251 bits (641), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 178/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L  IC  LNI  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGRLKEICGKLNIPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILSEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-----HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K       A  ++D  + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SDG
Sbjct: 191 TNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  +  LL  L+ +D+ +K
Sbjct: 251 PNAVPLNRMSALLETLVTLDRAVK 274


>gi|46445996|ref|YP_007361.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Protochlamydia amoebophila UWE25]
 gi|59798300|sp|Q6MEB3|KDSA_PARUW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|46399637|emb|CAF23086.1| probable 2-dehydro-3-deoxyphosphooctonate aldolase (KDO synthetase)
           [Candidatus Protochlamydia amoebophila UWE25]
          Length = 275

 Score =  251 bits (641), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 183/258 (70%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++  V+++GPC IES  H    AE L  + +  N+ L++KSS+DKANRS+    RG GL+
Sbjct: 14  KEPLVIMSGPCVIESETHCLKAAETLKNMFEKYNVSLIFKSSYDKANRSAYDSFRGPGLE 73

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I   ++K++G  ++TDVH+ Q+        +I+QIPA LCRQTDL+ AAAQTG ++
Sbjct: 74  EGLRILERIQKEFGLAVVTDVHSPQEATTAGSVCEIIQIPAFLCRQTDLILAAAQTGAIV 133

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           ++KKGQFL+PW+M N+++K+ + G  +++  +RGT+FGYN L++DMR IPIM  +G PV 
Sbjct: 134 SIKKGQFLAPWDMENVIRKMESGGNSNIILVDRGTTFGYNNLISDMRGIPIMQELGYPVC 193

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ+PG  G+ SGG+R++I  LAKAA+A G   +F+E+H +P  A SD  ++++ 
Sbjct: 194 FDATHSVQKPGGLGSKSGGDREFIPILAKAALAAGANCLFIESHPNPSEAKSDAASVMDF 253

Query: 282 KDLPKLLSQLLAIDKIIK 299
           KDL +LL Q   + ++I+
Sbjct: 254 KDLDQLLPQFKELYELIQ 271


>gi|172061063|ref|YP_001808715.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           MC40-6]
 gi|171993580|gb|ACB64499.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           MC40-6]
          Length = 284

 Score =  251 bits (641), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 177/265 (66%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAG C +ES       A +L  IC  LN+  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DQPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K     A++        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-EAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SD
Sbjct: 190 ETSAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LL  L+ +D+ +K
Sbjct: 250 GPNAVPLNRMGALLETLVTLDQAVK 274


>gi|167032178|ref|YP_001667409.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida GB-1]
 gi|189028412|sp|B0KSB8|KDSA_PSEPG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166858666|gb|ABY97073.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida GB-1]
          Length = 281

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 168/263 (63%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPFVLFGGMNVLESRDLAMKVCEEYVRVTEKLGIPYVFKASFDKANRSSVTSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF ++K+ +  P++TDVH   Q E +A   DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFEEIKRTFNVPVITDVHEPYQAEPVAKVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TGAVINIKKAQFLAPQEMKHILAKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV FD +H++Q PG   + +GG R  +  LAKA ++ G+AG+FLE H DPDNA  DGP
Sbjct: 191 EYPVFFDVTHALQMPGGRSDSAGGRRAQVTDLAKAGMSQGLAGLFLEAHPDPDNAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL  +D ++K
Sbjct: 251 CALRLDKLEPFLAQLKQLDDLVK 273


>gi|268680369|ref|YP_003304800.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfurospirillum
           deleyianum DSM 6946]
 gi|268618400|gb|ACZ12765.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 266

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 174/265 (65%), Gaps = 12/265 (4%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
           +LIAGPC IES ++   +AEKL +  +  +I   +KSSFDKANR+S+   RG GL +G +
Sbjct: 2   ILIAGPCVIESRENLLRVAEKLVSYHEDESIDFYFKSSFDKANRTSIDSFRGPGLDEGLK 61

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
           +  ++++ +GF +LTD+H   Q + + + VD+LQIPA LCRQTDLL AAAQT  V+NVKK
Sbjct: 62  LLDEVRRTFGFKLLTDIHDYTQAKPVGEVVDVLQIPAFLCRQTDLLVAAAQTKCVVNVKK 121

Query: 166 GQFLSPWEMHNILQK-LHAHGAKD----------VLFCERGTSFGYNTLVTDMRSIPIMT 214
           GQFL+P +M   ++K L   G K+          V   ERG++FGY  LV DMRS  IM 
Sbjct: 122 GQFLNPADMRYSVKKVLETRGVKEEGYEAAKRAGVWLTERGSTFGYGNLVVDMRSFGIMR 181

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PVIFDA+HSVQ PG  G  SGG+R+++ PL++AA A+G+ G F ETH +P  A  D
Sbjct: 182 EFA-PVIFDATHSVQMPGAEGGKSGGKREFVRPLSRAAAAVGVDGFFFETHFNPCEALCD 240

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ ++DL   +  + AI   +K
Sbjct: 241 GPNMLYLEDLDLAIKDIKAIQNALK 265


>gi|161524337|ref|YP_001579349.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia multivorans
           ATCC 17616]
 gi|189350907|ref|YP_001946535.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia multivorans
           ATCC 17616]
 gi|221214759|ref|ZP_03587728.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia multivorans
           CGD1]
 gi|238687034|sp|A9AGW1|KDSA_BURM1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|160341766|gb|ABX14852.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia multivorans
           ATCC 17616]
 gi|189334929|dbj|BAG43999.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia multivorans
           ATCC 17616]
 gi|221165298|gb|EED97775.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia multivorans
           CGD1]
          Length = 284

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 178/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L  IC  LNI  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNIPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILSEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-----HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K       A  ++D  + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SDG
Sbjct: 191 TNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  +  LL  L+ +D+ +K
Sbjct: 251 PNAVPLNRMSALLETLVTLDQAVK 274


>gi|161830037|ref|YP_001597504.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii RSA
           331]
 gi|161761904|gb|ABX77546.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii RSA
           331]
          Length = 278

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 129/253 (50%), Positives = 172/253 (67%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LIAGPC IES      +A +L +I Q L++  ++K+SFDKANRSS    RG G++KG  I
Sbjct: 16  LIAGPCVIESEALVMDVAGELKSITQQLDMPFIFKASFDKANRSSHLSYRGPGIEKGLTI 75

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
              +KK    PI+TDVH +   + +A  VD+LQ PA LCRQ++ + + A  G+ +N+KKG
Sbjct: 76  LEKVKKTLEVPIITDVHEDTPLQEVAAVVDVLQTPAFLCRQSNFIRSVAACGKPVNIKKG 135

Query: 167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASH 226
           QFLSPWEM  ++ K  A G K ++ CERG SFGYN L++DMR++ I+     PVIFDA+H
Sbjct: 136 QFLSPWEMKQVVAKAWATGNKKIMVCERGYSFGYNNLISDMRALAILRETACPVIFDATH 195

Query: 227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPK 286
           SVQ PG HG  SGG+R+++  LA+AA A GIAGIF+ETH DPD A SDGPN   +  +  
Sbjct: 196 SVQLPGGHGTNSGGQREFVPVLARAATAAGIAGIFMETHPDPDRALSDGPNSWPLAKMQP 255

Query: 287 LLSQLLAIDKIIK 299
           LL  L  +DKI+K
Sbjct: 256 LLETLKELDKIVK 268


>gi|52425244|ref|YP_088381.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Mannheimia
           succiniciproducens MBEL55E]
 gi|59798188|sp|Q65TB4|KDSA_MANSM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|52307296|gb|AAU37796.1| KdsA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 284

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 175/265 (66%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  + EK   +   L +  V+K+SFDKANRSS+   R
Sbjct: 11  INVANDNPFVLFGGMNVLESRDMAMQVCEKYVEVTNKLGVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK+ +G  I+TDVH   QC+ +A+  D++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKQTFGVKIITDVHEIYQCKPVAEVADVIQLPAFLARQTDLVEAMAR 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   V+ C+RG++FGY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGSNFGYDNLVVDMLGFGVMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R  +  LA+A +A+GIAG+FLE H DP+NA  D
Sbjct: 191 SKGAPVIFDVTHSLQCRDPFGAASGGRRDQVTELARAGLAVGIAGLFLEAHPDPNNAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ A+D ++K
Sbjct: 251 GPSALPLSVLEGFVSQMKALDDLVK 275


>gi|78066883|ref|YP_369652.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia sp. 383]
 gi|77967628|gb|ABB09008.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia sp. 383]
          Length = 284

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 177/265 (66%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L  IC  LNI  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNIPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILSEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K     A++        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-EAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SD
Sbjct: 190 ETSAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LL  L+ +D+ +K
Sbjct: 250 GPNAVPLNRMGALLETLVTLDQAVK 274


>gi|300723057|ref|YP_003712355.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629572|emb|CBJ90175.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Xenorhabdus
           nematophila ATCC 19061]
          Length = 284

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 174/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IKVANNLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIRSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKQTFGVKIITDVHEPAQAQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VIN+KK QF+SP +M NI++K    G + ++ C+RG++FGY+ LV DM    +M   
Sbjct: 131 TGAVINIKKPQFVSPGQMGNIVEKFKEGGNEQIILCDRGSNFGYDNLVVDMLGFGVMQQA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PVIFD +HS+Q     G  SGG R  +  LA+A +A+GIAG+FLE H DP+NA  D
Sbjct: 191 TGGAPVIFDVTHSLQCRDPFGAASGGRRAQVAELARAGMAVGIAGLFLEAHPDPENARCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L+Q+ AID ++K
Sbjct: 251 GPSALPLAKLEPFLAQMKAIDDVVK 275


>gi|45657414|ref|YP_001500.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|45600653|gb|AAS70137.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 289

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 116/265 (43%), Positives = 170/265 (64%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N      ++ F LI+GPC +E+ D    +  ++  +C  L I  ++KSSFDKANRSS+  
Sbjct: 15  NGTKIGGDEPFFLISGPCVMENRDLLDRVCAEMIEVCGELKIPYIFKSSFDKANRSSVNS 74

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL +G +    +K KY  P+LTD+H   Q   + D +D+ QIPA LCRQTDL++ +
Sbjct: 75  YRGPGLAEGIKNLEYIKNKYNVPVLTDIHETSQISPLKDVIDVYQIPAFLCRQTDLISQS 134

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           AQTG+ +NVKKGQFL+P +  +I  K++  G   +L  ERGTSFGY  L+ D R+IPI+ 
Sbjct: 135 AQTGKWVNVKKGQFLAPADTRHIAVKMNESGNNKLLVTERGTSFGYGNLIFDGRAIPIIH 194

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
              +P++FDA+HS Q PG  GN +GG+R++I  + ++AV+ GI GIF+E H DP NA SD
Sbjct: 195 GFDIPLVFDATHSAQLPGAAGNSTGGQREFIPSILRSAVSFGIEGIFMEVHPDPPNALSD 254

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
                 +  +  LL +++ +D+ IK
Sbjct: 255 ATTQYPLSQIKSLLKEMIGLDRYIK 279


>gi|34556730|ref|NP_906545.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Wolinella succinogenes
           DSM 1740]
 gi|44888081|sp|Q7MAF1|KDSA_WOLSU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|34482444|emb|CAE09445.1| 2-DEHYDRO-3-DEOXYPHOSPHOOCTONATE ALDOLASE [Wolinella succinogenes]
          Length = 263

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 124/264 (46%), Positives = 172/264 (65%), Gaps = 12/264 (4%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
            +LIAGPC IES +    IA +L  + +   I   +K+SFDKANR+SL   RG GL+KG 
Sbjct: 1   MILIAGPCVIESQEMLRKIASELQPLSEDARIDFYFKASFDKANRTSLESYRGPGLEKGL 60

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           E+   +K+++G+ +LTD+H  QQ    A  VDILQIPA LCRQTDL+  AA++  ++N+K
Sbjct: 61  EMLGRIKEEFGYKLLTDIHETQQVAKAAQVVDILQIPAFLCRQTDLIVEAAKSQSIVNIK 120

Query: 165 KGQFLSPWEM-HNILQKLHAHGAKD----------VLFCERGTSFGYNTLVTDMRSIPIM 213
           KGQF++P +M H++L+ +   G  +          +   ERG+SFGY  LV DMRS+ IM
Sbjct: 121 KGQFMNPADMSHSVLKAIKTRGGSEASYEEAKRLGIWLTERGSSFGYGNLVVDMRSLMIM 180

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
                PVIFDA+H+VQ PG  G  SGG+ +++ PL++AA A+G+ G F ETH  P  A S
Sbjct: 181 RQFA-PVIFDATHAVQMPGAAGGKSGGDSRFVAPLSRAAAAVGVDGFFTETHVSPKEALS 239

Query: 274 DGPNMINIKDLPKLLSQLLAIDKI 297
           DGPNMI  + L  L+ QLLA+ +I
Sbjct: 240 DGPNMITPQALKVLVHQLLALSEI 263


>gi|152991107|ref|YP_001356829.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitratiruptor sp.
           SB155-2]
 gi|151422968|dbj|BAF70472.1| 3-deoxy-8-phosphooctulonate synthase [Nitratiruptor sp. SB155-2]
          Length = 266

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 124/264 (46%), Positives = 170/264 (64%), Gaps = 12/264 (4%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
           +LIAGPC IES +   +IA  L    +S  I   +K+SFDKANR+SL   RG GL+KG E
Sbjct: 2   ILIAGPCVIESQEQLEIIASDLKRYHKSDEIDFYFKASFDKANRTSLDSYRGPGLEKGLE 61

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
           +   +K+ +G+ ILTDVH   Q EA+A+  D++QIPA LCRQTDLL AAA T R++N+KK
Sbjct: 62  MLAKIKEDFGYKILTDVHESYQVEAVAEVADVIQIPAFLCRQTDLLVAAATTERIVNIKK 121

Query: 166 GQFLSPWEM-HNILQKLHAHGAKD----------VLFCERGTSFGYNTLVTDMRSIPIMT 214
           GQF+ P +M +++L+ L   G +           V   ERGTSFGY  LV DMRS+ IM 
Sbjct: 122 GQFMHPEDMKYSVLKVLKTRGVETADYETSQKAGVWLTERGTSFGYRNLVVDMRSLVIMR 181

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PVIFDA+H+VQ PG  G  S G ++++ PL++A  A+G+ G F ETH DP  A SD
Sbjct: 182 EFA-PVIFDATHAVQMPGGAGGKSSGNKEFVAPLSRAVAAVGVDGFFFETHYDPSCALSD 240

Query: 275 GPNMINIKDLPKLLSQLLAIDKII 298
           GPNM+   +L  ++  +  I++ +
Sbjct: 241 GPNMVTPSELEAIVDDIFKIERAL 264


>gi|255318122|ref|ZP_05359366.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter radioresistens
           SK82]
 gi|262379827|ref|ZP_06072983.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter radioresistens
           SH164]
 gi|255304833|gb|EET84006.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter radioresistens
           SK82]
 gi|262299284|gb|EEY87197.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter radioresistens
           SH164]
          Length = 285

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 125/263 (47%), Positives = 167/263 (63%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL   R
Sbjct: 15  IQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICKRLDIPYVFKASFDKANRSSLNSFR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG E   ++KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 75  GPGLEKGIEWLGEIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAK 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM  M
Sbjct: 135 TQAIINIKKAQFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMKEM 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP+ A  DGP
Sbjct: 195 NVPVFFDVTHALQTPGGRADSAGGRRAQIATLARAGMATGLAGLFLEAHPDPELAKCDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL  +D ++K
Sbjct: 255 CALRLNQLEPFLAQLKELDTLVK 277


>gi|330995729|ref|ZP_08319627.1| 3-deoxy-8-phosphooctulonate synthase [Paraprevotella xylaniphila
           YIT 11841]
 gi|329574788|gb|EGG56349.1| 3-deoxy-8-phosphooctulonate synthase [Paraprevotella xylaniphila
           YIT 11841]
          Length = 250

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/247 (48%), Positives = 166/247 (67%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
           + IAGPC IES D    +A +L  I Q  NI + +K+SFDKANR+S+   RG GL+KG +
Sbjct: 4   IFIAGPCVIESADLLDEVACELVRIKQKFNIEIYFKASFDKANRTSVHSYRGPGLEKGLQ 63

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
           +  D+++KYG  +LTD+H   Q   + + VD+LQIPA LCRQTDLL AAA+TG+++N+KK
Sbjct: 64  MLDDVREKYGLKLLTDIHESFQAAPVGEVVDVLQIPAFLCRQTDLLVAAARTGKIVNIKK 123

Query: 166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDAS 225
            QFLS  +M   ++K    GAK++   ERG  +GYN LV D R+IP M +    V+ D +
Sbjct: 124 AQFLSGLDMKYPVEKAQESGAKEIWLTERGNIYGYNNLVVDFRNIPDMKAFVPRVVMDCT 183

Query: 226 HSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLP 285
           HSVQ+PG  G  +GG R+++  +A AA A G  G F ETH DP+ A SDGPNM+ +KDL 
Sbjct: 184 HSVQRPGAAGGKTGGNREFVPAMALAAKAFGADGYFFETHPDPEKAMSDGPNMLYLKDLE 243

Query: 286 KLLSQLL 292
            +++ LL
Sbjct: 244 TVIASLL 250


>gi|294828100|ref|NP_712589.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospira interrogans
           serovar Lai str. 56601]
 gi|302393696|sp|P61656|KDSA_LEPIC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|302393697|sp|Q8F3J4|KDSA_LEPIN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|293385947|gb|AAN49607.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospira interrogans
           serovar Lai str. 56601]
          Length = 287

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 116/265 (43%), Positives = 170/265 (64%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N      ++ F LI+GPC +E+ D    +  ++  +C  L I  ++KSSFDKANRSS+  
Sbjct: 13  NGTKIGGDEPFFLISGPCVMENRDLLDRVCAEMIEVCGELKIPYIFKSSFDKANRSSVNS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL +G +    +K KY  P+LTD+H   Q   + D +D+ QIPA LCRQTDL++ +
Sbjct: 73  YRGPGLAEGIKNLEYIKNKYNVPVLTDIHETSQISPLKDVIDVYQIPAFLCRQTDLISQS 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           AQTG+ +NVKKGQFL+P +  +I  K++  G   +L  ERGTSFGY  L+ D R+IPI+ 
Sbjct: 133 AQTGKWVNVKKGQFLAPADTRHIAVKMNESGNNKLLVTERGTSFGYGNLIFDGRAIPIIH 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
              +P++FDA+HS Q PG  GN +GG+R++I  + ++AV+ GI GIF+E H DP NA SD
Sbjct: 193 GFDIPLVFDATHSAQLPGAAGNSTGGQREFIPSILRSAVSFGIEGIFMEVHPDPPNALSD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
                 +  +  LL +++ +D+ IK
Sbjct: 253 ATTQYPLSQIKSLLKEMIGLDRYIK 277


>gi|113461089|ref|YP_719157.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus somnus
           129PT]
 gi|123327271|sp|Q0I3B9|KDSA_HAES1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|112823132|gb|ABI25221.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus somnus
           129PT]
          Length = 284

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 180/277 (64%), Gaps = 6/277 (2%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           N  I LG+    +   N + FVL  G   +ES D A  + EK   + Q L +  ++K+SF
Sbjct: 3   NQVIQLGN----IEIGNNKPFVLFGGMNVLESRDMAMQVCEKYVEVTQKLGVPYIFKASF 58

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANRSS+   RG G+++G +IF++LK+ +G  ++TDVH   QC  +A+ VDI+Q+PA L
Sbjct: 59  DKANRSSIHSYRGPGMEEGLKIFQELKETFGVKVITDVHEIYQCRPVAEVVDIIQLPAFL 118

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
            RQTDL+ A A+TG VINVKK QFLSP ++ NI++K+   G   V+ C+RGT+FGY+ LV
Sbjct: 119 ARQTDLVEAMARTGAVINVKKPQFLSPGQIGNIVEKIAECGNNKVILCDRGTNFGYDNLV 178

Query: 205 TDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
            DM    IM   S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FL
Sbjct: 179 VDMLGFNIMKKVSQGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGLFL 238

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           E+H +P+ A  DGP+ + +  L   ++Q+ AID ++K
Sbjct: 239 ESHPNPNQAKCDGPSALPLSKLEPFIAQMKAIDDLVK 275


>gi|226939475|ref|YP_002794548.1| KdsA [Laribacter hongkongensis HLHK9]
 gi|254807749|sp|C1DCC2|KDSA_LARHH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226714401|gb|ACO73539.1| KdsA [Laribacter hongkongensis HLHK9]
          Length = 283

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 132/265 (49%), Positives = 175/265 (66%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q   LIAGPC IE    A   A +L  +   L +  +YKSS+DKANRSS    RG G+ 
Sbjct: 11  DQPLFLIAGPCVIEGEQFAIDTAGQLKEMAGRLGLPFIYKSSYDKANRSSDQSFRGFGID 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G  I   +KK+ G P+LTDVHT ++    A  VD+LQ PA LCRQTD + A A TG+ +
Sbjct: 71  AGLTILDKVKKQVGVPVLTDVHTAEEAPLAASVVDVLQTPAFLCRQTDFIRAVAATGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKD-------VLFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K   HGA++       ++ CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPGDMLNVVAKAR-HGAREAGFDGDTIMVCERGASFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV++DA+HSVQ PG  G  SGG+R+++  LA+AAVA GIAGIF+ETH DP  A SD
Sbjct: 190 GTGCPVVYDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGIAGIFMETHPDPCKALSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN   +  L  LL+ L+ +D+++K
Sbjct: 250 GPNAWPLPRLYDLLATLVELDRLVK 274


>gi|212217995|ref|YP_002304782.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii
           CbuK_Q154]
 gi|226761655|sp|B6J4X2|KDSA_COXB1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|212012257|gb|ACJ19637.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii
           CbuK_Q154]
          Length = 280

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 172/253 (67%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LIAGPC IES      +A +L +I Q L++  ++K+SFDKANRSS    RG G++KG  I
Sbjct: 18  LIAGPCVIESEALVMDVAGELKSITQQLDMPFIFKASFDKANRSSHLSYRGPGIEKGLTI 77

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
              +KK    PI+TDVH +   + +A  VD+LQ PA LCRQ++ + + A  G+ +N+KKG
Sbjct: 78  LEKVKKTLEVPIITDVHEDTPLQEVAAVVDVLQTPAFLCRQSNFIRSVAACGKPVNIKKG 137

Query: 167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASH 226
           QFL+PWEM  ++ K  A G K ++ CERG SFGYN L++DMR++ I+     PVIFDA+H
Sbjct: 138 QFLAPWEMKQVVAKAWATGNKKIMVCERGYSFGYNNLISDMRALAILRETACPVIFDATH 197

Query: 227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPK 286
           SVQ PG HG  SGG+R+++  LA+AA A GIAGIF+ETH DPD A SDGPN   +  +  
Sbjct: 198 SVQLPGGHGTSSGGQREFVPVLARAATAAGIAGIFMETHPDPDRALSDGPNSWPLAKMQP 257

Query: 287 LLSQLLAIDKIIK 299
           LL  L  +DK++K
Sbjct: 258 LLETLKELDKVVK 270


>gi|196232240|ref|ZP_03131094.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Chthoniobacter flavus
           Ellin428]
 gi|196223608|gb|EDY18124.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Chthoniobacter flavus
           Ellin428]
          Length = 273

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 124/254 (48%), Positives = 173/254 (68%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
           + I GPC IES +  + +A +L AI   + I  V+K+S+DKANR+S+   RG+ +++G +
Sbjct: 20  LYILGPCVIESEEFVWRMARQLKAIASEVGIQFVFKASYDKANRTSVKSFRGLDVREGCQ 79

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
           I  ++ K+ G P+ TDVH+ ++ +  A+ +DILQIPA LCRQTDL+ AAA+T RV+NVKK
Sbjct: 80  ILANIGKELGVPVTTDVHSPEETKIAAEYIDILQIPAFLCRQTDLIQAAAETKRVVNVKK 139

Query: 166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDAS 225
           GQFL+PW++ NI  KL + G     F ERG +FGYN LV DMRS+  +   G PV+FDA+
Sbjct: 140 GQFLAPWDVKNIADKLLSFGNDQFFFTERGATFGYNNLVADMRSLYWIREAGYPVVFDAT 199

Query: 226 HSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLP 285
           HSVQ+PG  G+ + G+      LA+AA A G  GIF+ETH+DP  A SDGPN I +  LP
Sbjct: 200 HSVQRPGGGGDKTSGDGVLAPVLARAAAAAGCDGIFIETHEDPSKALSDGPNQIPLAQLP 259

Query: 286 KLLSQLLAIDKIIK 299
            LL QL  I  +++
Sbjct: 260 SLLKQLRQIHDLVR 273


>gi|2498500|sp|P95514|KDSA_PASHA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|1683632|gb|AAB36513.1| 3-deoxy-D-manno-octulosonic acid synthetase KdsA [Mannheimia
           haemolytica]
          Length = 284

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/262 (46%), Positives = 172/262 (65%), Gaps = 2/262 (0%)

Query: 40  SNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVG 99
           +N++ F L  G   +ES D A  + EK   +   L +  V+K+SFDKANRSS+   RG G
Sbjct: 14  ANDKPFTLFGGMNVLESRDMAMAVCEKYVEVTNKLGVPYVFKASFDKANRSSIHSYRGPG 73

Query: 100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGR 159
           +++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A A+TG 
Sbjct: 74  MEEGLKIFQELKDTFGVKIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMARTGA 133

Query: 160 VINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--TSMG 217
           VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ LV DM    +M   S G
Sbjct: 134 VINVKKPQFLSPGQMGNIVEKIEECGNDQVILCDRGTNFGYDNLVVDMLGFSVMKQVSKG 193

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
            PVIFD +HS+Q     G  S G R  +  LA+A +A+GIAG+FLE H DP+NA  DGP+
Sbjct: 194 CPVIFDVTHSLQCRDPFGAASSGRRAQVTELARAGLAVGIAGLFLEAHPDPNNAKCDGPS 253

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
            + +  L   + Q+ AID ++K
Sbjct: 254 ALPLSTLEAFVGQMKAIDDLVK 275


>gi|170717665|ref|YP_001784741.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus somnus 2336]
 gi|238688018|sp|B0UUE2|KDSA_HAES2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|168825794|gb|ACA31165.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus somnus 2336]
          Length = 284

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 180/277 (64%), Gaps = 6/277 (2%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           N  I LG+    +   N + FVL  G   +ES D A  + EK   + Q L +  ++K+SF
Sbjct: 3   NQVIQLGN----IEIGNNKPFVLFGGMNVLESRDMAMQVCEKYVEVTQKLGVPYIFKASF 58

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANRSS+   RG G+++G +IF++LK+ +G  ++TDVH   QC  +A+ VDI+Q+PA L
Sbjct: 59  DKANRSSIHSYRGPGMEEGLKIFQELKETFGVKVITDVHEIYQCRPVAEVVDIIQLPAFL 118

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
            RQTDL+ A A+TG VINVKK QFLSP ++ NI++K+   G   V+ C+RGT+FGY+ LV
Sbjct: 119 ARQTDLVEAMARTGAVINVKKPQFLSPGQIGNIVEKIAECGNNKVILCDRGTNFGYDNLV 178

Query: 205 TDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
            DM    IM   S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FL
Sbjct: 179 VDMLGFNIMKKVSQGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGLFL 238

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           E+H +P+ A  DGP+ + +  L   ++Q+ AID ++K
Sbjct: 239 ESHPNPNQAKCDGPSALPLSKLEPFVAQMKAIDDLVK 275


>gi|251792738|ref|YP_003007464.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aggregatibacter
           aphrophilus NJ8700]
 gi|247534131|gb|ACS97377.1| 3-deoxy-8-phosphooctulonate synthase [Aggregatibacter aphrophilus
           NJ8700]
          Length = 284

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 180/277 (64%), Gaps = 6/277 (2%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           N  I LG     +  +N++ FVL  G   +ES D A  + E    + Q L +  V+K+SF
Sbjct: 3   NKLIQLGD----IQIANDKPFVLFGGMNVLESRDMAIRVCEAYVEVTQKLGVPYVFKASF 58

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANRSS+   RG G+++G +IF +LK+ +G  ++TDVH   QC+ +A+ VDI+Q+PA L
Sbjct: 59  DKANRSSIHSYRGPGMEQGLKIFAELKQTFGVKVITDVHEIYQCQPVAEVVDIIQLPAFL 118

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
            RQTDL+ A A+TG +INVKK QFLSP ++ NI++K+   G   V+ C+RGT+FGY+ LV
Sbjct: 119 ARQTDLVEAMARTGAIINVKKPQFLSPGQVGNIVEKIAECGNDKVILCDRGTNFGYDNLV 178

Query: 205 TDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
            DM    +M   S G PVIFD +HS+Q     G  SGG R  +  LA+A +A+G+AG+FL
Sbjct: 179 VDMLGFSVMKNVSKGCPVIFDVTHSLQCRDPFGAASGGRRAQVTELARAGMAVGLAGLFL 238

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           E H DP+NA  DGP+ + +  L  ++ Q+ AID ++K
Sbjct: 239 EAHPDPNNAKCDGPSALPLDKLEGVVRQMKAIDDLVK 275


>gi|53729233|ref|ZP_00133757.2| COG2877: 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate
           synthase [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|126209042|ref|YP_001054267.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae L20]
 gi|6647547|sp|O68662|KDSA_ACTPL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|2996207|gb|AAC26633.1| 3-deoxy-D-manno-2-octulosonic acid 8-phosphate synthetase
           [Actinobacillus pleuropneumoniae]
 gi|126097834|gb|ABN74662.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
          Length = 286

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 177/265 (66%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ F L  G   +ES D A  + E+   +   L +  V+K+SFDKANRSS+   R
Sbjct: 13  IEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKASFDKANRSSIHSYR 72

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A A+
Sbjct: 73  GPGMEEGLKIFQELKDTFGVSIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMAR 132

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G ++V+ C+RGT+FGY+ LV DM    IM   
Sbjct: 133 TGVVINVKKPQFLSPGQMGNIVEKIAECGNENVILCDRGTNFGYDNLVVDMLGFNIMKKV 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE H DP++A  D
Sbjct: 193 SKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGLFLEAHPDPNSAKCD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID ++K
Sbjct: 253 GPSALPLSKLEAFVSQMKAIDDLVK 277


>gi|164685926|ref|ZP_01946253.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165918295|ref|ZP_02218381.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii RSA
           334]
 gi|164601448|gb|EAX33162.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165917945|gb|EDR36549.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii RSA
           334]
          Length = 278

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 172/253 (67%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LIAGPC IES      +A +L +I Q L++  ++K+SFDKANRSS    RG G++KG  I
Sbjct: 16  LIAGPCVIESEALVMDVAGELKSITQQLDMPFIFKASFDKANRSSHLSYRGPGIEKGLTI 75

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
              +KK    PI+TDVH +   + +A  VD+LQ PA LCRQ++ + + A  G+ +N+KKG
Sbjct: 76  LEKVKKTLEVPIITDVHEDTPLQEVAAVVDVLQTPAFLCRQSNFIRSVAACGKPVNIKKG 135

Query: 167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASH 226
           QFL+PWEM  ++ K  A G K ++ CERG SFGYN L++DMR++ I+     PVIFDA+H
Sbjct: 136 QFLAPWEMKQVVAKAWATGNKKIMVCERGYSFGYNNLISDMRALAILRETACPVIFDATH 195

Query: 227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPK 286
           SVQ PG HG  SGG+R+++  LA+AA A GIAGIF+ETH DPD A SDGPN   +  +  
Sbjct: 196 SVQLPGGHGTSSGGQREFVPVLARAATAAGIAGIFMETHPDPDRALSDGPNSWPLAKMQP 255

Query: 287 LLSQLLAIDKIIK 299
           LL  L  +DK++K
Sbjct: 256 LLETLKELDKVVK 268


>gi|299135619|ref|ZP_07028803.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidobacterium sp.
           MP5ACTX8]
 gi|298601743|gb|EFI57897.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidobacterium sp.
           MP5ACTX8]
          Length = 276

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/268 (46%), Positives = 174/268 (64%), Gaps = 6/268 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            VT  + + F LIAGPC +ES  HA  +A+ +  I   L +  ++K+S+DKANR+S+   
Sbjct: 11  SVTAGSGELF-LIAGPCVLESESHARGLADAIQRIASDLGVPYIFKASYDKANRTSIHSF 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD----ILQIPALLCRQTDLL 151
           RG GL +G  I R + +    P+LTD+HT +QC A +D++     +LQIPA LCRQTDLL
Sbjct: 70  RGPGLAEGCRILRAIAESNKLPVLTDIHTPEQCVAASDALGPVEAMLQIPAFLCRQTDLL 129

Query: 152 TAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIP 211
            AAA TGR INVKKGQF++PW++ + ++K+   G + V   ERG SFGYN LV DMR +P
Sbjct: 130 IAAANTGRAINVKKGQFVAPWDIRHAVEKIRESGNQRVSLTERGASFGYNNLVVDMRGLP 189

Query: 212 IMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
           +M     PV+FD +HSVQ P      SGG+ ++I  LA+AAVA GI G+FLE H +P  A
Sbjct: 190 VMREF-APVVFDGTHSVQTPSGGKGVSGGQPEFIPVLARAAVAAGIDGVFLEVHDNPAEA 248

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            SDG N +++  L  +L  LLA+   ++
Sbjct: 249 KSDGANALHLNKLKGVLETLLAVHAAVR 276


>gi|87123161|ref|ZP_01079012.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase
           [Synechococcus sp. RS9917]
 gi|86168881|gb|EAQ70137.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase
           [Synechococcus sp. RS9917]
          Length = 283

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 179/267 (67%), Gaps = 2/267 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           ++F+N+  FVLI G   +ES D A  +A    A+C+ L+I LV+K+SFDKANRSS+   R
Sbjct: 11  LSFANDAPFVLIGGVNVLESRDFALEVAGHYKAVCERLDIPLVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL +G  + + +K ++G P++TDVHT +Q    A   DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLNEGLAMLQAVKARHGIPVITDVHTPEQAAPAAAVCDIIQLPAFLARQTDLVEAMAR 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFLSP +M N+++K    G + +L CERG++FGY+ LV DM    +M   
Sbjct: 131 TGAVINIKKPQFLSPSQMANVVEKFRECGNERLLICERGSNFGYDNLVVDMLGFGVMKRC 190

Query: 217 --GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
              +P+IFD +H++Q     G  SGG R  ++ LA+A +A+G+AG+FLE+H DPD A  D
Sbjct: 191 CNDLPLIFDVTHALQCRDPGGAASGGRRSQVLELARAGMAVGLAGLFLESHPDPDQARCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GP+ + ++ L   LSQL A+D ++K L
Sbjct: 251 GPSALPLEQLEPFLSQLKAVDHLVKNL 277


>gi|165977487|ref|YP_001653080.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|226761651|sp|B0BU69|KDSA_ACTPJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|165877588|gb|ABY70636.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 284

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 177/266 (66%), Gaps = 2/266 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +N++ F L  G   +ES D A  + E+   +   L +  V+K+SFDKANRSS+   
Sbjct: 10  NIEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKASFDKANRSSIHSY 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGMEEGLKIFQELKDTFGVNIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM-- 213
           +TG VINVKK QFLSP +M NI++K+   G ++V+ C+RGT+FGY+ LV DM    IM  
Sbjct: 130 RTGAVINVKKPQFLSPGQMGNIVEKIAECGNENVILCDRGTNFGYDNLVVDMLGFNIMKK 189

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
            S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE H DP++A  
Sbjct: 190 VSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGLFLEAHPDPNSAKC 249

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGP+ + +  L   +SQ+ AID ++K
Sbjct: 250 DGPSALPLSKLEAFVSQMKAIDDLVK 275


>gi|260914188|ref|ZP_05920661.1| 3-deoxy-8-phosphooctulonate synthase [Pasteurella dagmatis ATCC
           43325]
 gi|260631821|gb|EEX49999.1| 3-deoxy-8-phosphooctulonate synthase [Pasteurella dagmatis ATCC
           43325]
          Length = 284

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 178/278 (64%), Gaps = 6/278 (2%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
            N  I LG     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+S
Sbjct: 2   NNKVIRLGD----IEIANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G++KG +IF++LK  +G  I+TDVH   QC+ +A+  DI+Q+PA 
Sbjct: 58  FDKANRSSIHSYRGPGMEKGLKIFQELKDTFGVKIITDVHEIYQCQPVAEVADIIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG +INVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ L
Sbjct: 118 LARQTDLVEAMAKTGAIINVKKPQFLSPSQMGNIVEKIEECGNDKVILCDRGTNFGYDNL 177

Query: 204 VTDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           V DM    IM   S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+F
Sbjct: 178 VVDMLGFSIMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGLAIGLAGLF 237

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           LE H +P+ A  DGP+ + +  L   +SQ+ AID ++K
Sbjct: 238 LEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVK 275


>gi|330959217|gb|EGH59477.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 281

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/272 (43%), Positives = 173/272 (63%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I +GS    +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKA
Sbjct: 6   IRVGS----IEVANDKPMVLFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL+KG  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQ
Sbjct: 62  NRSSVTSYRGPGLEKGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM
Sbjct: 122 TDLVVAMAKTGAIINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDM 181

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
               IM     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H D
Sbjct: 182 LGFGIMKQFEYPILFDVTHALQMPGGRADSAGGRRAQVLDLAKAGISQNLAGLFLEAHPD 241

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNA  DGP  + +  L   L+QL ++D+++K
Sbjct: 242 PDNAKCDGPCALRLDKLEPFLAQLKSLDELVK 273


>gi|209363760|ref|YP_001423749.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii Dugway
           5J108-111]
 gi|238687228|sp|A9KDH6|KDSA_COXBN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|207081693|gb|ABS76718.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii Dugway
           5J108-111]
          Length = 280

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 172/253 (67%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LIAGPC IES      +A +L +I Q L++  ++K+SFDKANRSS    RG G++KG  I
Sbjct: 18  LIAGPCVIESEALVMDVAGELKSITQQLDMPFIFKASFDKANRSSHLSYRGPGIEKGLTI 77

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
              +KK    PI+TDVH +   + +A  VD+LQ PA LCRQ++ + + A  G+ +N+KKG
Sbjct: 78  LEKVKKTLEVPIITDVHEDTPLQEVAAVVDVLQTPAFLCRQSNFIRSVAACGKPVNIKKG 137

Query: 167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASH 226
           QFL+PWEM  ++ K  A G K ++ CERG SFGYN L++DMR++ I+     PVIFDA+H
Sbjct: 138 QFLAPWEMKQVVAKAWATGNKKIMVCERGYSFGYNNLISDMRALAILRETACPVIFDATH 197

Query: 227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPK 286
           SVQ PG HG  SGG+R+++  LA+AA A GIAGIF+ETH DPD A SDGPN   +  +  
Sbjct: 198 SVQLPGGHGTSSGGQRKFVPVLARAATAAGIAGIFMETHPDPDRALSDGPNSWPLAKMQP 257

Query: 287 LLSQLLAIDKIIK 299
           LL  L  +DK++K
Sbjct: 258 LLETLKELDKVVK 270


>gi|110834024|ref|YP_692883.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alcanivorax borkumensis
           SK2]
 gi|110647135|emb|CAL16611.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alcanivorax borkumensis
           SK2]
          Length = 282

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 174/280 (62%), Gaps = 4/280 (1%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           + +   IHL    N + F+N++   L  G   +ES D A  +AE        LN+  V+K
Sbjct: 1   MSSQKTIHL----NGLEFANDKPMALFGGMNVLESRDLAMQVAEAYAEATSKLNMPWVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSSL+  RG G+++G +IF ++KK +  P++TDVH   Q   +A+ VDI+Q+P
Sbjct: 57  ASFDKANRSSLSSYRGPGMEEGLKIFEEVKKTFNCPLITDVHEPGQAGPVAEVVDIIQLP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+ A A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN
Sbjct: 117 AFLARQTDLVVAMAKTGAIINIKKPQFLAPHEMSHILHKCEDAGNDQLILCERGSSFGYN 176

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
            LV DM    IM     PV FD +H++Q+PG   + + G R  +  L +A ++ GIAG+F
Sbjct: 177 NLVVDMLGFGIMKQFNYPVFFDVTHALQKPGGRADSADGRRAQVAELGRAGISQGIAGLF 236

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           LE H DPDNA  DGP  + +  L   L+Q+ A+D  +K L
Sbjct: 237 LEAHPDPDNAKCDGPCALRLDRLEPFLAQMQALDNTVKAL 276


>gi|332530631|ref|ZP_08406564.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hylemonella gracilis
           ATCC 19624]
 gi|332039914|gb|EGI76307.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hylemonella gracilis
           ATCC 19624]
          Length = 281

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 174/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           ++  N Q FVL  G   +ES D A    E+   +   L I  V+K+SFDKANRSS+   R
Sbjct: 9   LSVGNAQPFVLFGGINVLESRDLALRACEEYVRVTGKLGIPYVFKASFDKANRSSIHSYR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL +G  IF D+KK +G P++TDVH   Q +A+A+ VD+LQ+PA L RQTDL+ A A+
Sbjct: 69  GPGLDEGLRIFEDVKKSFGVPLITDVHEPHQAQAVAEVVDVLQLPAFLARQTDLVVALAK 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TGRVIN+KK QFLSP ++ NI++K    G   ++ C+RGT FGY+ LV DM    +M   
Sbjct: 129 TGRVINIKKPQFLSPSQVGNIVEKFKEAGNDQLILCDRGTCFGYDNLVVDMLGFGVMKQV 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S  +PVIFDA+H++QQ       SGG R+ +V LA+A +++G+AG+FLE H +PD A  D
Sbjct: 189 SGNLPVIFDATHALQQRAPGAAASGGRREQLVDLARAGMSVGLAGLFLEAHPNPDKALCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L+Q+ A+D ++K
Sbjct: 249 GPSALPLDKLEPFLAQIKALDDLVK 273


>gi|323496833|ref|ZP_08101870.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio sinaloensis DSM
           21326]
 gi|323318092|gb|EGA71066.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio sinaloensis DSM
           21326]
          Length = 283

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 180/274 (65%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKA
Sbjct: 6   VHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK  +G  I+TDVHTE+Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEEQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI+ K    G ++++ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVINVKKPQFMSPGQVGNIVDKFAECGNENIILCERGSCHGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H
Sbjct: 182 LGFGVMKKASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +PD A  DGP+ + +  L   L+Q+ A+D++IK
Sbjct: 242 PNPDQARCDGPSALPLDKLEPFLAQMKALDELIK 275


>gi|238028003|ref|YP_002912234.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia glumae
           BGR1]
 gi|237877197|gb|ACR29530.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia glumae
           BGR1]
          Length = 284

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/264 (47%), Positives = 177/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++   LIAG C +ES       A +L  IC  L +  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DRPLFLIAGTCVVESEQMTIDTAGRLKEICAKLKVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH  ++ +A+A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  QGLRILSEVKRQLGLPVLTDVHAIEEIDAVASVVDVLQTPAFLCRQTDFIQACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-----HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K       A  ++D  L CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFLACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SDG
Sbjct: 191 TGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  +  LL  L+ +D  +K
Sbjct: 251 PNAVPLNRMAALLETLVMLDAAVK 274


>gi|254251982|ref|ZP_04945300.1| Phospho-2-dehydro-3-deoxyheptonate aldolase [Burkholderia dolosa
           AUO158]
 gi|124894591|gb|EAY68471.1| Phospho-2-dehydro-3-deoxyheptonate aldolase [Burkholderia dolosa
           AUO158]
          Length = 284

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/264 (47%), Positives = 178/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L  IC  LN+  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILGEVKRQLGLPVLTDVHSVDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-----HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K       A  ++D  + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SDG
Sbjct: 191 TDAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  +  LL  L+ +D+ +K
Sbjct: 251 PNAVPLNRMSALLETLVTLDQAVK 274


>gi|134296289|ref|YP_001120024.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           vietnamiensis G4]
 gi|166199030|sp|A4JFY6|KDSA_BURVG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|134139446|gb|ABO55189.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           vietnamiensis G4]
          Length = 284

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 178/264 (67%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q F LIAG C +ES       A +L  IC  LN+  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DQPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A++G+ +
Sbjct: 71  EGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKL-----HAHGAKD-VLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K       A  ++D  + CERG SFGYN LV+DMRS+ IM  
Sbjct: 131 NIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMRE 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P  A SDG
Sbjct: 191 TNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPAEAKSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN + +  +  LL  L+ +D+ +K
Sbjct: 251 PNAVPLHRMGALLETLVTLDQAVK 274


>gi|317491756|ref|ZP_07950191.1| 3-deoxy-8-phosphooctulonate synthase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920190|gb|EFV41514.1| 3-deoxy-8-phosphooctulonate synthase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 284

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 171/265 (64%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G  IF+D+K+ +G  I+TDVHT +Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMRIFQDIKQAFGVKIITDVHTPEQAQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI+ K    G   ++ C+RG +FGY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVDKFEEGGNDKIILCDRGANFGYDNLVVDMLGFGVMKNA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+F+E H DP NA  D
Sbjct: 191 SKGSPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGMAIGLAGLFIEAHPDPANARCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L Q+ AID ++K
Sbjct: 251 GPSALPLDKLEPFLVQMKAIDDLVK 275


>gi|254491579|ref|ZP_05104758.1| 3-deoxy-8-phosphooctulonate synthase [Methylophaga thiooxidans
           DMS010]
 gi|224463057|gb|EEF79327.1| 3-deoxy-8-phosphooctulonate synthase [Methylophaga thiooxydans
           DMS010]
          Length = 281

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 171/258 (66%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q   LIAG C IES      +A +L  I   L I L+YKSSFDKANR+S    RG G++
Sbjct: 11  KQPLFLIAGTCVIESEQMTMDVAGQLKEITDKLGISLIYKSSFDKANRTSTKSYRGPGVE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G  I   +KK++  P+LTDVH +     +A  VD+LQ PA LCRQT+ +   A  G  +
Sbjct: 71  AGLAILEKVKKEFNLPVLTDVHEDTPLAEVASVVDVLQTPAFLCRQTNFIVNVASQGLPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M ++  K  + G + ++ CERGTSFGYNTL++DMR +P M  M  PV+
Sbjct: 131 NIKKGQFLAPWDMQHVADKAKSTGNQQIMLCERGTSFGYNTLISDMRGLPQMRHMDCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQQPG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P+ A SDGPN   +
Sbjct: 191 FDATHSVQQPGGQGGASGGQREFVPVLARAAVATGVAGVFMETHPEPEKALSDGPNSWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             +  LL  L AID  +K
Sbjct: 251 HKMSALLETLQAIDTTVK 268


>gi|194365227|ref|YP_002027837.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Stenotrophomonas
           maltophilia R551-3]
 gi|238693476|sp|B4SR83|KDSA_STRM5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|194348031|gb|ACF51154.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Stenotrophomonas
           maltophilia R551-3]
          Length = 276

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 170/258 (65%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q   LIAGPC IES       A KL  +   L +  ++KSSFDKANR+S    RG G++
Sbjct: 11  DQPLFLIAGPCVIESMQLQLDTAGKLKEVTDRLGVNFIFKSSFDKANRTSGTAFRGPGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G ++  ++KK+ G P+LTDVH     + +A  VD+LQ PA L RQTD +      G+ +
Sbjct: 71  EGLKVLAEVKKQIGVPVLTDVHEYTPMDEVASVVDVLQTPAFLVRQTDFIRKVCSAGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M  +++K  A G + ++ CERG SFGYN LV+DMRS+ +M   G PV+
Sbjct: 131 NIKKGQFLAPWDMKPVVEKAKATGNEQIMVCERGASFGYNNLVSDMRSLAVMRDTGCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP  A SDGPN   +
Sbjct: 191 FDATHSVQLPGGQGTSSGGQREHVPVLARAAVAVGISGLFAETHPDPSKALSDGPNAWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             +  LL  L+ +D + K
Sbjct: 251 DQMEALLETLMELDAVTK 268


>gi|269138760|ref|YP_003295461.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Edwardsiella tarda
           EIB202]
 gi|267984421|gb|ACY84250.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Edwardsiella tarda
           EIB202]
 gi|304558753|gb|ADM41417.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Edwardsiella tarda FL6-60]
          Length = 284

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 175/265 (66%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IQVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK+ +G  I+TDVHT +Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKQTFGVKIITDVHTPEQAQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI+ K    G + V+ C+RG++FGY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVDKFQEGGNEQVILCDRGSNFGYDNLVVDMLGFGVMKNV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+F+E H DP +A  D
Sbjct: 191 SHGAPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGMAIGLAGLFIEAHPDPAHAMCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L+Q+ AID ++K
Sbjct: 251 GPSALPLAKLEPFLAQMKAIDDLVK 275


>gi|145629731|ref|ZP_01785527.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           22.1-21]
 gi|145639099|ref|ZP_01794707.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittII]
 gi|144978068|gb|EDJ87847.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           22.1-21]
 gi|145272071|gb|EDK11980.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittII]
 gi|309751050|gb|ADO81034.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           R2866]
          Length = 284

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/265 (45%), Positives = 176/265 (66%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+SFDKANRSS+   R
Sbjct: 11  IDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVIEKLGVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK+ +G  I+TDVH   QC+ +AD VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKETFGVKIITDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ L+ DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVEKIEECGNDKIILCDRGTNFGYDNLIVDMLGFSVMKKA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R  +  LA++ +A+GIAG+FLE H +P+ A  D
Sbjct: 191 SKGSPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGLAVGIAGLFLEAHPNPNQAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID ++K
Sbjct: 251 GPSALPLSALEGFVSQMKAIDDLVK 275


>gi|116491322|ref|YP_810866.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oenococcus oeni PSU-1]
 gi|116092047|gb|ABJ57201.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Oenococcus oeni PSU-1]
          Length = 284

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/247 (48%), Positives = 163/247 (65%), Gaps = 1/247 (0%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           + +  L+AGPC IES++    +AEKL  I + L+I  V+KSSFDKANRSS    RG GL+
Sbjct: 16  DSQLTLLAGPCAIESYETCAQVAEKLKEITEKLHINYVFKSSFDKANRSSADSDRGSGLE 75

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG  I   +KK +  PI+TDVH   QC+ +++  D+LQIPA L RQTDLL AAA+TG+V+
Sbjct: 76  KGLAILERIKKNFDLPIVTDVHESYQCQPVSEVADVLQIPAFLSRQTDLLLAAAKTGKVV 135

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQF++P ++ +   K+    +K +L  ERGTSFGY+ LV DM  +  M   G P+I
Sbjct: 136 NIKKGQFMAPEDIKSATSKIDPITSK-ILITERGTSFGYHRLVVDMTGLIEMREAGFPII 194

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ P  HGN SGG R Y  PL +AA+  G+ GIF E H +P  A SD  N + +
Sbjct: 195 FDATHSVQVPSAHGNHSGGNRDYAFPLMRAALETGVDGIFAEVHPNPPEAISDADNQLYL 254

Query: 282 KDLPKLL 288
             +  +L
Sbjct: 255 SKIEPIL 261


>gi|315634083|ref|ZP_07889372.1| 3-deoxy-8-phosphooctulonate synthase [Aggregatibacter segnis ATCC
           33393]
 gi|315477333|gb|EFU68076.1| 3-deoxy-8-phosphooctulonate synthase [Aggregatibacter segnis ATCC
           33393]
          Length = 284

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 178/277 (64%), Gaps = 6/277 (2%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           N  I LG     +  +N++ FVL  G   +ES D A  + EK   + Q L +  V+K+SF
Sbjct: 3   NKCIQLGD----IQIANDKPFVLFGGMNVLESRDMAMQVCEKYVEVTQKLGVPYVFKASF 58

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANRSS+   RG G+++G +IF +LK+ +G  I+TDVH   QC+ +A+  DI+Q+PA L
Sbjct: 59  DKANRSSIHSYRGPGMEQGLKIFAELKQTFGVKIITDVHEIYQCQPVAEVADIIQLPAFL 118

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
            RQTDL+ A A+TG +INVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ L+
Sbjct: 119 ARQTDLVEAMARTGAIINVKKPQFLSPGQMGNIVEKIAECGNDKVILCDRGTNFGYDNLI 178

Query: 205 TDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
            DM    +M   S G PVIFD +HS+Q     G  SGG R  +  LA+A +AIG+AG+FL
Sbjct: 179 VDMLGFSVMKNVSKGCPVIFDVTHSLQCRDPFGAASGGRRAQVTELARAGLAIGLAGLFL 238

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           E H +P  A  DGP+ + +  L   ++Q+ A+D ++K
Sbjct: 239 EAHPEPSKAKCDGPSALPLDKLEAFVAQMKAVDDLVK 275


>gi|26988343|ref|NP_743768.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida
           KT2440]
 gi|148549372|ref|YP_001269474.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida F1]
 gi|32171423|sp|Q88MG0|KDSA1_PSEPK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase 1; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase 1; AltName: Full=KDO-8-phosphate synthase 1;
           Short=KDO 8-P synthase 1; Short=KDOPS 1; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase 1
 gi|24983093|gb|AAN67232.1|AE016350_5 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida
           KT2440]
 gi|148513430|gb|ABQ80290.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida F1]
 gi|313500221|gb|ADR61587.1| KdsA_2 [Pseudomonas putida BIRD-1]
          Length = 281

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 167/263 (63%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPFVLFGGMNVLESRDLAMKVCEEYVRVTEKLGIPYVFKASFDKANRSSVTSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF ++K+ +  P++TDVH   Q E +A   DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFEEIKRTFNVPVITDVHEPYQAEPVAKVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TGVVINIKKAQFLAPQEMKHILAKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV FD +H++Q PG   + +GG R  +  LAKA ++ G+AG+FLE H DPDNA  DGP
Sbjct: 191 EYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGMSQGLAGLFLEAHPDPDNAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L QL  +D ++K
Sbjct: 251 CALRLDKLEPFLVQLKQLDDLVK 273


>gi|238919473|ref|YP_002932988.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Edwardsiella ictaluri
           93-146]
 gi|259494403|sp|C5B817|KDSA_EDWI9 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238869042|gb|ACR68753.1| 3-deoxy-8-phosphooctulonate synthase, putative [Edwardsiella
           ictaluri 93-146]
          Length = 284

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 175/265 (66%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IQVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK+ +G  I+TDVHT +Q + +AD VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKRTFGVKIITDVHTPEQAQPVADVVDIIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VINVKK QFLSP +M NI+ K    G   V+ C+RG++FGY+ LV DM    +M S+
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVDKFREGGNDRVILCDRGSNFGYDNLVVDMLGFGVMKSV 190

Query: 217 --GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+F+E H DP +A  D
Sbjct: 191 SHGAPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGMAIGLAGLFIEAHPDPVHAMCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + ++ L   L Q+ AID ++K
Sbjct: 251 GPSALPLEKLEPFLVQMKAIDDLVK 275


>gi|254509169|ref|ZP_05121268.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus 16]
 gi|219547920|gb|EED24946.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus 16]
          Length = 283

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 128/274 (46%), Positives = 178/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKA
Sbjct: 6   VHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI+ K    G  +++ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVINVKKPQFMSPGQVGNIVDKFSECGNDNIILCERGSCHGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M  TS G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H
Sbjct: 182 LGFGVMKKTSNGSPIIFDVTHSLQMRDPSGAASGGCREQTVELAKAGLATGIAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +PD A  DGP+ + +  L   LSQ+ A+D +IK
Sbjct: 242 PNPDQARCDGPSALPLDKLEPFLSQMKALDDLIK 275


>gi|293607916|ref|ZP_06690219.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828489|gb|EFF86851.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325122441|gb|ADY81964.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 285

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 167/263 (63%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL   R
Sbjct: 15  IQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICKRLDIPYVFKASFDKANRSSLHSFR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG E   D+KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 75  GPGLEKGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAK 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM     M  M
Sbjct: 135 TQAIINIKKAQFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDTMKEM 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP++A  DGP
Sbjct: 195 NVPVFFDVTHALQTPGGRSDSAGGRRAQITTLARAGMATGLAGLFLEGHPDPEHAKCDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+Q+  +D ++K
Sbjct: 255 CALRMSQLEPFLAQIKELDTLVK 277


>gi|29654965|ref|NP_820657.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii RSA
           493]
 gi|212211989|ref|YP_002302925.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii
           CbuG_Q212]
 gi|37999535|sp|Q83B43|KDSA_COXBU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761656|sp|B6J3X3|KDSA_COXB2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|29542234|gb|AAO91171.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii RSA
           493]
 gi|212010399|gb|ACJ17780.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Coxiella burnetii
           CbuG_Q212]
          Length = 280

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 172/253 (67%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LIAGPC IES      +A +L +I Q L++  ++K+SFDKANRSS    RG G++KG  I
Sbjct: 18  LIAGPCVIESEALVMDVAGELKSITQQLDMPFIFKASFDKANRSSHLSYRGPGIEKGLTI 77

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
              +KK    PI+TDVH +   + +A  VD+LQ PA LCRQ++ + + A  G+ +N+KKG
Sbjct: 78  LEKVKKTLEVPIITDVHEDTPLQEVAAVVDVLQTPAFLCRQSNFIRSVAACGKPVNIKKG 137

Query: 167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASH 226
           QFL+PWEM  ++ K  A G K ++ CERG SFGYN L++DMR++ I+     PVIFDA+H
Sbjct: 138 QFLAPWEMKQVVAKAWATGNKKIMVCERGYSFGYNNLISDMRALAILRETACPVIFDATH 197

Query: 227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPK 286
           SVQ PG HG  SGG+R+++  LA+AA A GIAGIF+ETH DPD A SDGPN   +  +  
Sbjct: 198 SVQLPGGHGTNSGGQREFVPVLARAATAAGIAGIFMETHPDPDRALSDGPNSWPLAKMQP 257

Query: 287 LLSQLLAIDKIIK 299
           LL  L  +DK++K
Sbjct: 258 LLETLKELDKVVK 270


>gi|307249193|ref|ZP_07531190.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306858717|gb|EFM90776.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 284

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 176/266 (66%), Gaps = 2/266 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +N++ F L  G   +ES D A  + E+   +   L +  V+K+SFDKANRSS+   
Sbjct: 10  NIEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKASFDKANRSSIHSY 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGMEEGLKIFQELKDTFGVNIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM-- 213
           +TG VINVKK QFLSP +M NI++K+   G ++V+ C+RGT+FGY+ LV DM    IM  
Sbjct: 130 RTGAVINVKKPQFLSPGQMGNIVEKIAECGNENVILCDRGTNFGYDNLVVDMLGFNIMKK 189

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
            S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE H DP++A  
Sbjct: 190 VSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGLFLEAHPDPNSAKC 249

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGP+ + +  L    SQ+ AID ++K
Sbjct: 250 DGPSALPLSKLEAFTSQMKAIDDLVK 275


>gi|77360006|ref|YP_339581.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas
           haloplanktis TAC125]
 gi|123589189|sp|Q3IK90|KDSA_PSEHT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|76874917|emb|CAI86138.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 284

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/265 (45%), Positives = 172/265 (64%), Gaps = 1/265 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +  +N + FVL  G   +ES D A  +AE    +   LNI  V+K+SFDKANRSS+  
Sbjct: 9   NDIELANNKPFVLFGGINVLESRDLAMRVAEHYVEVTTKLNIPYVFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL +G +IF ++KK +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLDEGLKIFEEIKKTFNIPLITDVHEPHQAAPVAEVVDVIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +V  CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNNNVALCERGSSFGYNNLVVDMLGMDDMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M  PVIFDA+H++Q+PG   + + G R     LA++ +A+GIAG+F+E H +P+ A  D
Sbjct: 189 VMA-PVIFDATHALQRPGGRADSADGRRAQAAELARSGMALGIAGLFIEAHPNPNEAKCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP  + +  L   L+Q+ A+D +IK
Sbjct: 248 GPCALALSKLEGYLTQMKAVDDLIK 272


>gi|168002994|ref|XP_001754198.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162694752|gb|EDQ81099.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 294

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 171/266 (64%), Gaps = 5/266 (1%)

Query: 39  FSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGV 98
             + + F ++AGP  IES +H   +A ++  +   L + L++KSSFDKANR+S    RG 
Sbjct: 13  LQSSEPFFVMAGPNVIESAEHCLKMARQIKTVTDELGLKLIFKSSFDKANRTSAKSFRGP 72

Query: 99  GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTG 158
           G+++G ++ + +K+  G P+LTDVH   QCE +A   DI+QIPA LCRQTDLL AAA+TG
Sbjct: 73  GMEEGLKVLQLVKETCGVPVLTDVHDPSQCETVAKVADIIQIPAFLCRQTDLLVAAAKTG 132

Query: 159 RVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGV 218
           +VIN+KKGQF +   M N   K+   G  +V+ CERGT FGYN L+ D R++  M   G 
Sbjct: 133 KVINIKKGQFCASSVMRNSADKVRLAGNPNVMVCERGTMFGYNDLIVDPRNLEWMREAGA 192

Query: 219 PVIFDASHSVQQPGIH-----GNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
           PV+ D +HS+QQP        G  SGG R+ I  +A+A VA+G+ GIF+E H +P  AP 
Sbjct: 193 PVVADITHSLQQPAGQQLEGGGVASGGLRELIPCIARACVAVGVDGIFMEVHDNPRQAPC 252

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGP    +++L  LL +L+AI K+ K
Sbjct: 253 DGPTQWPLRNLKNLLEELIAIAKVTK 278


>gi|119472538|ref|ZP_01614586.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alteromonadales
           bacterium TW-7]
 gi|119444862|gb|EAW26162.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alteromonadales
           bacterium TW-7]
          Length = 284

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/265 (44%), Positives = 173/265 (65%), Gaps = 1/265 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +  +N + FVL  G   +ES D A  IAE    +   LNI  V+K+SFDKANRSS+  
Sbjct: 9   NDIELANNKPFVLFGGMNVLESRDLAMRIAEHYVEVTTKLNIPYVFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++K  +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKNTFNIPLITDVHEPHQAAPVAEVVDVIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  ++  CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNNNIALCERGSSFGYNNLVVDMLGMDDMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           +M  PVIFDA+H++Q+PG   + + G R     LA++ +A+GIAG+F+E H +P+ A  D
Sbjct: 189 AMA-PVIFDATHALQRPGGRADSADGRRAQAAELARSGMALGIAGLFIEAHPNPNEAKCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP  + +  L   LSQ+ A+D ++K
Sbjct: 248 GPCALALSKLEGYLSQMKAVDDLVK 272


>gi|320329627|gb|EFW85616.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330878146|gb|EGH12295.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 281

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/272 (43%), Positives = 172/272 (63%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I +GS    +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKA
Sbjct: 6   IRVGS----IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G  IF D+K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQ
Sbjct: 62  NRSSVNSYRGPGLEEGMRIFEDIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM
Sbjct: 122 TDLVVAMAKTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDM 181

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
               +M     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H D
Sbjct: 182 LGFGVMKQFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPD 241

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNA  DGP  + +  L   L+QL ++D+ +K
Sbjct: 242 PDNAKCDGPCALRLDKLEPFLAQLKSLDEFVK 273


>gi|190573695|ref|YP_001971540.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Stenotrophomonas
           maltophilia K279a]
 gi|229830631|sp|B2FK85|KDSA_STRMK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|190011617|emb|CAQ45236.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase
           [Stenotrophomonas maltophilia K279a]
          Length = 276

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 121/258 (46%), Positives = 170/258 (65%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q   LIAGPC IES       A KL  +   L +  ++KSSFDKANR+S    RG G++
Sbjct: 11  DQPLFLIAGPCVIESMQLQLDTAGKLKEVTDKLGVNFIFKSSFDKANRTSGTAFRGPGME 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G ++  +++K+ G P+LTDVH     + +A  VD+LQ PA L RQTD +      G+ +
Sbjct: 71  EGLKVLAEVRKQIGVPVLTDVHEYTPMDEVASVVDVLQTPAFLVRQTDFIRKVCSAGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M  +++K  A G + ++ CERG SFGYN LV+DMRS+ +M   G PV+
Sbjct: 131 NIKKGQFLAPWDMKPVVEKAKATGNEQIMVCERGASFGYNNLVSDMRSLAVMRDTGCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP  A SDGPN   +
Sbjct: 191 FDATHSVQLPGGQGTSSGGQREHVPVLARAAVAVGISGLFAETHPDPSKALSDGPNAWPL 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             +  LL  L+ +D + K
Sbjct: 251 DQMEALLETLMELDAVTK 268


>gi|149377458|ref|ZP_01895200.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinobacter algicola
           DG893]
 gi|149358225|gb|EDM46705.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinobacter algicola
           DG893]
          Length = 281

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 169/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N + FVL  G   +ES + A  +AE      + L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEVANHKPFVLFGGMNVLESPEMAMEVAEAYVEATRKLGIPYVFKASFDKANRSSVHSFR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG +I  D+K K+G PI++DVH  +Q    A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEKGLQILADIKSKFGVPIISDVHEPEQAAPAAEVCDIIQLPAFLSRQTDLVVAMAE 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VIN+KK QFL+P EM +I+ K    G   V+ CERGTSFGYN LV DM    IM S+
Sbjct: 131 TGAVINIKKAQFLAPQEMKHIIAKCGEAGNDKVILCERGTSFGYNNLVVDMLGFGIMKSL 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
            VPV+FD +H++Q PG   + +GG R  +  LA A ++ G+AG+FLE H DPD A  DGP
Sbjct: 191 DVPVMFDVTHALQMPGGRADSAGGRRAQVTDLALAGMSQGLAGLFLEAHPDPDQAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+++ A+D ++K
Sbjct: 251 CALRLSQLEPFLARVKAVDDLVK 273


>gi|149928509|ref|ZP_01916741.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Limnobacter sp. MED105]
 gi|149822769|gb|EDM82024.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Limnobacter sp. MED105]
          Length = 285

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 131/264 (49%), Positives = 180/264 (68%), Gaps = 6/264 (2%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAGPC IES   A   A +L  IC+SL +  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGPCVIESEQMAMDTAGQLKEICESLGVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           KG +I  ++KK     ILTDVH  ++  A+A  VD+LQ PA LCRQTD + A A  G+ +
Sbjct: 71  KGLDILANVKKTLNVNILTDVHAIEEIAAVASVVDVLQTPAFLCRQTDFIEAVATCGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHG------AKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           N+KKGQFL+P +M N++ K  A         K+++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 131 NIKKGQFLAPGDMVNVVDKARAAAIEAGGDGKNIMVCERGVSFGYNNLVSDMRSLAIMRN 190

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+G+AG+F+E+H DP  A SDG
Sbjct: 191 TGCPVVFDATHSVQLPGGQGTASGGQREFVPVLARAAVAVGVAGLFMESHPDPAKAMSDG 250

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN   +  +  LL+ L  +D+++K
Sbjct: 251 PNAWPLPRMKALLATLQELDRLVK 274


>gi|290475218|ref|YP_003468104.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Xenorhabdus
           bovienii SS-2004]
 gi|289174537|emb|CBJ81331.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Xenorhabdus
           bovienii SS-2004]
          Length = 284

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 173/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIRSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKQTFGVKIITDVHEPAQAQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VIN+KK QF+SP +M NI++K    G   V+ C+RG++FGY+ LV DM    +M   
Sbjct: 131 TGAVINIKKPQFVSPGQMGNIVEKFKEGGNDQVILCDRGSNFGYDNLVVDMLGFGVMQQA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+FLE H DP+NA  D
Sbjct: 191 THGAPVIFDVTHALQCRDPLGAASGGRRAQVAELARAGMAVGIAGLFLEAHPDPENAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L Q+ AID ++K
Sbjct: 251 GPSALPLAKLESFLMQIKAIDDVVK 275


>gi|332532483|ref|ZP_08408361.1| 2-keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038126|gb|EGI74573.1| 2-keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 284

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/265 (44%), Positives = 174/265 (65%), Gaps = 1/265 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N++  +N + FVL  G   +ES D A  +AE    +   LNI  V+K+SFDKANRSS+  
Sbjct: 9   NEIELANNKPFVLFGGINVLESRDLAMRVAEHYVEVTTKLNIPYVFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++K  +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKNTFKIPLITDVHEPHQAAPVAEVVDVIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +V  CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNNNVALCERGSSFGYNNLVVDMLGMDDMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           +M  PVIFDA+H++Q+PG   + + G R     LA++ +A+GIAG+F+E H +P+ A  D
Sbjct: 189 AMA-PVIFDATHALQRPGGRADSADGRRAQAAELARSGMALGIAGLFIEAHPNPNEAKCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP  + +  L   L+Q+ A+D +IK
Sbjct: 248 GPCALALSKLEGYLTQMKAVDDLIK 272


>gi|78485605|ref|YP_391530.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thiomicrospira crunogena
           XCL-2]
 gi|123769088|sp|Q31G67|KDSA_THICR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|78363891|gb|ABB41856.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Thiomicrospira crunogena XCL-2]
          Length = 277

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 172/258 (66%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           +Q   LIAGPC IES   A   A +L  +  +L I  +YKSS+DKANRSS    RG+G++
Sbjct: 11  DQPLFLIAGPCVIESEQLAIETAGQLKELTDALGIPFIYKSSYDKANRSSTKSFRGLGVE 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I + +K + G P+LTDVH +   + +A  VD++Q PA L RQT+ +    + G  +
Sbjct: 71  EGLRILQKVKDEIGVPVLTDVHEDTPLDEVASVVDVMQTPAFLVRQTNFIQNVCRQGLPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQF +PW+M  ++ K    G   ++ C+RGTSFGYNTL++DMR +  M   G PV+
Sbjct: 131 NIKKGQFQAPWDMDQVVAKAREVGNDQIMVCDRGTSFGYNTLISDMRGLASMRQTGCPVV 190

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQQPG  G  SGG+R+ +  LA+AA+A GI+G+F+ETH DP+NA SDGPNM  I
Sbjct: 191 FDATHSVQQPGGQGTTSGGQREMVPVLARAAIAAGISGVFMETHPDPENALSDGPNMWPI 250

Query: 282 KDLPKLLSQLLAIDKIIK 299
             L  LL  +  +D+++K
Sbjct: 251 SRLKPLLETMKELDEVVK 268


>gi|237800163|ref|ZP_04588624.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|330896080|gb|EGH28301.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330950659|gb|EGH50919.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae Cit
           7]
 gi|331023020|gb|EGI03077.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 281

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/272 (43%), Positives = 173/272 (63%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I +GS    +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKA
Sbjct: 6   IRVGS----IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQ
Sbjct: 62  NRSSVNSYRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM
Sbjct: 122 TDLVVAMAKTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDM 181

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
               IM     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H D
Sbjct: 182 LGFGIMKQFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPD 241

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNA  DGP  + +  L   L+QL ++D+++K
Sbjct: 242 PDNAKCDGPCALRLDKLEPFLAQLKSLDELVK 273


>gi|167720326|ref|ZP_02403562.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei DM98]
          Length = 284

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 176/265 (66%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L  IC +L +  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  EGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K     A+DV       + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-DAARDVGLSEDRFMACERGVSFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G+AG+F+ETH +P  A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAALATGVAGLFMETHPNPAEAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LL  L+ +D+ +K
Sbjct: 250 GPNAVPLGRMAALLETLVTLDRAVK 274


>gi|16760665|ref|NP_456282.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|16765113|ref|NP_460728.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29141576|ref|NP_804918.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|62180336|ref|YP_216753.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|161613732|ref|YP_001587697.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167553923|ref|ZP_02347666.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167993215|ref|ZP_02574310.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168233803|ref|ZP_02658861.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168237826|ref|ZP_02662884.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168241354|ref|ZP_02666286.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168260003|ref|ZP_02681976.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168462752|ref|ZP_02696683.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168820510|ref|ZP_02832510.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194446013|ref|YP_002041022.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194451824|ref|YP_002045815.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194472712|ref|ZP_03078696.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194737901|ref|YP_002114802.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197248417|ref|YP_002146257.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197262892|ref|ZP_03162966.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198243566|ref|YP_002215373.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200390905|ref|ZP_03217516.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204927714|ref|ZP_03218915.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205352560|ref|YP_002226361.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207856721|ref|YP_002243372.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|213028508|ref|ZP_03342955.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
 gi|213051782|ref|ZP_03344660.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213426499|ref|ZP_03359249.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213586793|ref|ZP_03368619.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213650658|ref|ZP_03380711.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213850176|ref|ZP_03381074.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|224583738|ref|YP_002637536.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|238913672|ref|ZP_04657509.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|289825250|ref|ZP_06544534.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|54037500|sp|P65216|KDSA_SALTI RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|54041401|sp|P65215|KDSA_SALTY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|75482998|sp|Q57NN9|KDSA_SALCH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|189028415|sp|A9MW08|KDSA_SALPB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761662|sp|B5F4I0|KDSA_SALA4 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761663|sp|B5FU23|KDSA_SALDC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761664|sp|B5R3K3|KDSA_SALEP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761665|sp|B5R6I4|KDSA_SALG2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238689755|sp|B4TXT8|KDSA_SALSV RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238690682|sp|B4TKA0|KDSA_SALHS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238693510|sp|B4SUF8|KDSA_SALNS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|254807750|sp|C0Q363|KDSA_SALPC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|25291178|pir||AF0719 2-dehydro-3-deoxyphosphooctonate aldolase [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16420302|gb|AAL20687.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16502961|emb|CAD02127.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29137203|gb|AAO68767.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|62127969|gb|AAX65672.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161363096|gb|ABX66864.1| hypothetical protein SPAB_01457 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404676|gb|ACF64898.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194410128|gb|ACF70347.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194459076|gb|EDX47915.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194713403|gb|ACF92624.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195634236|gb|EDX52588.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197212120|gb|ACH49517.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197241147|gb|EDY23767.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289259|gb|EDY28626.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197938082|gb|ACH75415.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199603350|gb|EDZ01896.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204323056|gb|EDZ08252.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205272341|emb|CAR37221.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205321746|gb|EDZ09585.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205328652|gb|EDZ15416.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205332139|gb|EDZ18903.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205339596|gb|EDZ26360.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205342596|gb|EDZ29360.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205350758|gb|EDZ37389.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708524|emb|CAR32845.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|224468265|gb|ACN46095.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|261246958|emb|CBG24775.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267993720|gb|ACY88605.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301158296|emb|CBW17795.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312912761|dbj|BAJ36735.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320085727|emb|CBY95505.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321224400|gb|EFX49463.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322616768|gb|EFY13676.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322620422|gb|EFY17288.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322625676|gb|EFY22495.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322626126|gb|EFY22936.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322633733|gb|EFY30473.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322638887|gb|EFY35580.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322640870|gb|EFY37519.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322644091|gb|EFY40636.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322649162|gb|EFY45600.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322655321|gb|EFY51629.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660921|gb|EFY57152.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322662782|gb|EFY58989.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322667966|gb|EFY64125.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674272|gb|EFY70366.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322678553|gb|EFY74611.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322683212|gb|EFY79228.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686906|gb|EFY82884.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|322714810|gb|EFZ06381.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323130042|gb|ADX17472.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323195204|gb|EFZ80384.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323200205|gb|EFZ85291.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323204533|gb|EFZ89537.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323207350|gb|EFZ92298.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323213945|gb|EFZ98714.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323217335|gb|EGA02054.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323221170|gb|EGA05598.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323228024|gb|EGA12169.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323231357|gb|EGA15470.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323235797|gb|EGA19876.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323240366|gb|EGA24409.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323245258|gb|EGA29258.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323249063|gb|EGA32983.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323252820|gb|EGA36656.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323254889|gb|EGA38683.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323260917|gb|EGA44516.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323266731|gb|EGA50217.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|326623119|gb|EGE29464.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|326627620|gb|EGE33963.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
 gi|332988659|gb|AEF07642.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 284

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 173/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QF+SP +M NI+ K H  G   V+ C+RG +FGY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFVSPGQMGNIVDKFHEGGNDKVILCDRGANFGYDNLVVDMLGFSVMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S   PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+FLE+H DP NA  D
Sbjct: 191 SGNSPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGLFLESHPDPANAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L + L+Q+ AID ++K
Sbjct: 251 GPSALPLAKLEQFLTQIKAIDDLVK 275


>gi|213419810|ref|ZP_03352876.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
          Length = 275

 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 173/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QF+SP +M NI+ K H  G   V+ C+RG +FGY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFVSPGQMGNIVDKFHEGGNDKVILCDRGANFGYDNLVVDMLGFSVMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S   PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+FLE+H DP NA  D
Sbjct: 191 SGNSPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGLFLESHPDPANAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L + L+Q+ AID ++K
Sbjct: 251 GPSALPLAKLEQFLTQIKAIDDLVK 275


>gi|260779381|ref|ZP_05888273.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260605545|gb|EEX31840.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 283

 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 177/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKA
Sbjct: 6   VHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI+ K    G  +++ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVINVKKPQFMSPGQVGNIVDKFSECGNDNIILCERGSCHGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H
Sbjct: 182 LGFGVMKKASKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +PD A  DGP+ + +  L   L+Q+ A+D +IK
Sbjct: 242 PNPDQAKCDGPSALPLDKLEPFLAQMKALDDLIK 275


>gi|94264341|ref|ZP_01288133.1| 2-dehydro-3-deoxyphosphooctonate aldolase [delta proteobacterium
           MLMS-1]
 gi|93455235|gb|EAT05448.1| 2-dehydro-3-deoxyphosphooctonate aldolase [delta proteobacterium
           MLMS-1]
          Length = 278

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 133/258 (51%), Positives = 173/258 (67%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           Q   L+AGPC +E       IA  L  I   L I LV+K+SFDKANR+SLA  RG GL  
Sbjct: 16  QPLCLLAGPCVLEEPGMLREIAATLQDITSRLGISLVFKASFDKANRTSLASYRGPGLAA 75

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G E+   + +++  P+++D+H   Q    A  +DILQIPA LCRQTDLL AAA +GRV+N
Sbjct: 76  GLELLAAIGREFDLPLVSDIHESAQVAEAAAVLDILQIPAFLCRQTDLLLAAAASGRVVN 135

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           +KKGQF++PW+M   + K+ +  A  +L  ERG+ FGYN LV DMRS+PIM  +G PVIF
Sbjct: 136 LKKGQFMAPWDMAPAVAKVASLAADKLLLTERGSCFGYNNLVVDMRSLPIMRDLGCPVIF 195

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGG+RQ++  LA+AAVA G+ G+FLE H DPD A  DGPN + + 
Sbjct: 196 DATHSVQLPGGQGEASGGQRQFVATLARAAVAAGVDGLFLEVHPDPDRALCDGPNSLPLG 255

Query: 283 DLPKLLSQLLAIDKIIKP 300
           ++  LL QLLAI +   P
Sbjct: 256 EVEGLLRQLLAIRQAACP 273


>gi|56413307|ref|YP_150382.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362232|ref|YP_002141869.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|59798121|sp|Q5PNK8|KDSA_SALPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238690760|sp|B5BI79|KDSA_SALPK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|56127564|gb|AAV77070.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093709|emb|CAR59181.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
          Length = 284

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 173/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKQTFGVKVITDVHEASQVQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QF+SP +M NI+ K H  G   V+ C+RG +FGY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFVSPGQMGNIVDKFHEGGNDKVILCDRGANFGYDNLVVDMLGFSVMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S   PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+FLE+H DP NA  D
Sbjct: 191 SGNSPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGLFLESHPDPANAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L + L+Q+ AID ++K
Sbjct: 251 GPSALPLAKLEQFLTQIKAIDDLVK 275


>gi|94268096|ref|ZP_01291087.1| 2-dehydro-3-deoxyphosphooctonate aldolase [delta proteobacterium
           MLMS-1]
 gi|93451736|gb|EAT02504.1| 2-dehydro-3-deoxyphosphooctonate aldolase [delta proteobacterium
           MLMS-1]
          Length = 278

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 133/258 (51%), Positives = 173/258 (67%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           Q   L+AGPC +E       IA  L  I   L I LV+K+SFDKANR+SLA  RG GL  
Sbjct: 16  QPLCLLAGPCVLEEPGMLREIAATLQDITSRLGISLVFKASFDKANRTSLASYRGPGLAA 75

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G E+   + +++  P+++D+H   Q    A  +DILQIPA LCRQTDLL AAA +GRV+N
Sbjct: 76  GLELLAAIGREFDLPLVSDIHESAQVAEAAAVLDILQIPAFLCRQTDLLLAAAASGRVVN 135

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           +KKGQF++PW+M   + K+ +  A  +L  ERG+ FGYN LV DMRS+PIM  +G PVIF
Sbjct: 136 LKKGQFMAPWDMAPAVAKVASLAADKLLLTERGSCFGYNNLVVDMRSLPIMRDLGCPVIF 195

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGG+RQ++  LA+AAVA G+ G+FLE H DPD A  DGPN + + 
Sbjct: 196 DATHSVQLPGGQGEASGGQRQFVATLARAAVAAGVDGLFLEVHPDPDRALCDGPNSLPLG 255

Query: 283 DLPKLLSQLLAIDKIIKP 300
           ++  LL QLLAI +   P
Sbjct: 256 EVEGLLRQLLAIRQAACP 273


>gi|260767749|ref|ZP_05876684.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           furnissii CIP 102972]
 gi|260617258|gb|EEX42442.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           furnissii CIP 102972]
          Length = 283

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 177/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+SFDKA
Sbjct: 6   VHVGD----IPVANDKPFTLFAGMNVLESRDMAMQICEHYVKVTDKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI++K    G + V+ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNEKVILCERGSCHGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H
Sbjct: 182 LGFGVMKKASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +PD A  DGP+ + +  L   L+Q+ A+D ++K
Sbjct: 242 PNPDQARCDGPSALPLDKLEPFLAQMKALDDLVK 275


>gi|161503116|ref|YP_001570228.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189028414|sp|A9MPA5|KDSA_SALAR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|160864463|gb|ABX21086.1| hypothetical protein SARI_01181 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 284

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 173/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QF+SP +M NI+ K H  G   V+ C+RG +FGY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFVSPGQMGNIVDKFHEGGNDKVILCDRGANFGYDNLVVDMLGFGVMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S   PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+FLE+H DP NA  D
Sbjct: 191 SGNCPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGLFLESHPDPANAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L + L+Q+ AID ++K
Sbjct: 251 GPSALPLAKLEQFLTQIKAIDDLVK 275


>gi|37525990|ref|NP_929334.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|44888083|sp|Q7N583|KDSA_PHOLL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|36785420|emb|CAE14366.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 284

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 176/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKA
Sbjct: 6   VHIGD----IKVANDLPFVLFGGMNVLESRDLAMSICEHYVTVTQKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +A+ VD++Q+PA L RQ
Sbjct: 62  NRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHESAQAQPVAEVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ LV DM
Sbjct: 122 TDLVEAMARTGAVINVKKPQFISPGQMGNIVDKFKEGGNDQVILCDRGSNFGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   + G PVIFD +HS+Q     G  SGG R  +  LA+A +A+GIAG+FLE H
Sbjct: 182 LGFNVMAQATGGHPVIFDVTHSLQCRDPFGAASGGRRAQVAELARAGMAVGIAGLFLEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            DP NA  DGP+ + +  L   LSQ+ AID ++K
Sbjct: 242 PDPANAMCDGPSALPLAKLEPFLSQMKAIDDVVK 275


>gi|225154905|ref|ZP_03723403.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase-like
           protein [Opitutaceae bacterium TAV2]
 gi|224804435|gb|EEG22660.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase-like
           protein [Opitutaceae bacterium TAV2]
          Length = 338

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 181/260 (69%), Gaps = 1/260 (0%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVG 99
           +  + ++IAGPC +E+      +A +L  I ++L  + +V+K SFDKANR+S+AG RG G
Sbjct: 78  DPTKLLVIAGPCSLENETVCRAVASRLTEIARALPELRIVFKGSFDKANRTSIAGPRGTG 137

Query: 100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGR 159
           + +G ++   +K+ YGFP+LTD+H   QC  +A+  D+LQIPA LCRQTD+L AAA TGR
Sbjct: 138 IDEGLKLLALVKRDYGFPVLTDIHDADQCARVAEVCDVLQIPAFLCRQTDILLAAAATGR 197

Query: 160 VINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
           V+NVKKGQFL+P +M ++  KL    A ++   ERGT+FGY  LV DMRS PIM   G P
Sbjct: 198 VVNVKKGQFLAPQDMVHVTGKLREGRAAEIWQTERGTTFGYQNLVVDMRSFPIMARNGYP 257

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           VI DA+HSVQ PG  G  S G+R+++ PLA AA+A G  G+FLETH DP NA SDGPNM+
Sbjct: 258 VILDATHSVQLPGGGGGKSSGQREFVPPLALAALAAGADGLFLETHPDPANALSDGPNMV 317

Query: 280 NIKDLPKLLSQLLAIDKIIK 299
            + +L  LL+Q  A+ + ++
Sbjct: 318 PLDELQALLTQCHAVWRCVR 337


>gi|323492373|ref|ZP_08097526.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio brasiliensis LMG
           20546]
 gi|323313420|gb|EGA66531.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio brasiliensis LMG
           20546]
          Length = 283

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 178/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKA
Sbjct: 6   VHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI+ K    G ++++ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVINVKKPQFMSPGQVGNIVDKFSECGNENIILCERGSCHGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H
Sbjct: 182 LGFGVMKKASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +PD A  DGP+ + +  L   L+Q+ A+D +IK
Sbjct: 242 PNPDQALCDGPSALPLDKLEPFLAQMKALDDLIK 275


>gi|203282532|pdb|3E9A|A Chain A, Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctonate
           Aldolase From Vibrio Cholerae O1 Biovar Eltor Str.
           N16961
          Length = 286

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 177/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+SFDKA
Sbjct: 9   VHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKA 64

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK+ +G  I+TDVHTE Q + +AD VD++Q+PA L RQ
Sbjct: 65  NRSSVHSYRGPGLEEGMKIFQELKETFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQ 124

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM
Sbjct: 125 TDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDM 184

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H
Sbjct: 185 LGFGVMKQASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAH 244

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +PD A  DGP+ + +  L   L+Q+ A+D +IK
Sbjct: 245 PNPDKARCDGPSALPLDKLEPFLAQMKALDDLIK 278


>gi|330975380|gb|EGH75446.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 281

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 119/272 (43%), Positives = 173/272 (63%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I +GS    +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKA
Sbjct: 6   IRVGS----IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQ
Sbjct: 62  NRSSVNSYRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAALVAEVCDIIQLPAFLSRQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM
Sbjct: 122 TDLVVAMAKTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDM 181

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
               IM     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H D
Sbjct: 182 LGFGIMKQFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPD 241

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNA  DGP  + +  L   L+QL ++D+++K
Sbjct: 242 PDNAKCDGPCALRLDKLEPFLAQLKSLDELVK 273


>gi|116071602|ref|ZP_01468870.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus sp. BL107]
 gi|116065225|gb|EAU70983.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus sp. BL107]
          Length = 282

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 175/265 (66%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +TF+N+Q FVL+ G   +E  D A   A     +C+ L I LV+K+S+DKANRSS+   R
Sbjct: 10  ITFANDQPFVLLGGVNVLEDLDFALNCAGHYKTVCERLGIPLVFKASYDKANRSSIHSFR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL+KG  I + +K  +G P++TDVHT ++  A A   DI+Q+PA L RQTDL+TA A 
Sbjct: 70  GPGLEKGLAILQAVKDTHGIPVITDVHTPEEAVAAAAVADIIQLPAFLARQTDLVTAMAN 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VIN+KK QFLSP +M NI++K    G   +L CERG++FGY+ LV DM    +M  T
Sbjct: 130 TGSVINIKKPQFLSPEQMANIVEKFKECGNDQLLLCERGSNFGYDNLVVDMLGFGVMKKT 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
              +P+IFD +H++Q     G  SGG R  +V LA+A +A+G+AG+FLE H DPD A  D
Sbjct: 190 CQDIPLIFDVTHALQCRDPGGAASGGRRSQVVDLARAGIAVGLAGLFLEAHPDPDKARCD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   LSQL A+D+++K
Sbjct: 250 GPSALPLDLLEPFLSQLKALDQLVK 274


>gi|71733430|ref|YP_275959.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257487062|ref|ZP_05641103.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289626015|ref|ZP_06458969.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|123761193|sp|Q48F78|KDSA_PSE14 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|71553983|gb|AAZ33194.1| 3-deoxy-8-phosphooctulonate synthase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320323101|gb|EFW79190.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|330868561|gb|EGH03270.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330894613|gb|EGH27274.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           mori str. 301020]
 gi|330985129|gb|EGH83232.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009301|gb|EGH89357.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 281

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 173/272 (63%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I +GS    +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKA
Sbjct: 6   IRVGS----IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQ
Sbjct: 62  NRSSVNSYRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM
Sbjct: 122 TDLVVAMAKTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDM 181

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
               +M     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H D
Sbjct: 182 LGFGVMKQFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPD 241

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNA  DGP  + +  L   L+QL ++D+++K
Sbjct: 242 PDNAKCDGPCALRLDKLEPFLAQLKSLDELVK 273


>gi|302187917|ref|ZP_07264590.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           syringae 642]
          Length = 281

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 173/272 (63%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I +GS    +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKA
Sbjct: 6   IRVGS----IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQ
Sbjct: 62  NRSSVNSYRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM
Sbjct: 122 TDLVVAMAKTGAIINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDM 181

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
               IM     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H D
Sbjct: 182 LGFGIMKQFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPD 241

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNA  DGP  + +  L   L+QL ++D+++K
Sbjct: 242 PDNAKCDGPCALRLDKLEPFLAQLKSLDELVK 273


>gi|116328337|ref|YP_798057.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116331063|ref|YP_800781.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
 gi|116121081|gb|ABJ79124.1| 3-deoxy-8-phosphooctulonate synthase [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116124752|gb|ABJ76023.1| 3-deoxy-8-phosphooctulonate synthase [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 287

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 168/265 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N      ++ F LIAGPC +E+ D    +  ++  IC  L I  V+KSSFDKANRSS+  
Sbjct: 13  NGSKIGGDEPFFLIAGPCVMENRDLLDRVCAEMIEICDELKISYVFKSSFDKANRSSVNS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL +G +    +K KY  P+LTD+H   Q   + D++DI QIPA LCRQTDL+  +
Sbjct: 73  YRGPGLTEGIQNLEYIKNKYNVPVLTDIHETHQIAPLKDAIDIYQIPAFLCRQTDLIAES 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TGR +NVKKGQFL+P +  +I  K+   G   +L  ERGTSFGY  L+ D R+IPI+ 
Sbjct: 133 AKTGRWVNVKKGQFLAPSDTRHIAVKMKESGNDKLLVTERGTSFGYGNLIFDGRAIPIIH 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
              +P+IFDA+HS Q PG   N +GG+R++I  + ++AV++GI G+F+E H DP  A SD
Sbjct: 193 GFDIPLIFDATHSAQLPGAAENSTGGQREFIPSILRSAVSLGIEGVFMEVHPDPQKALSD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
                 +  +  LL +++ +D+ +K
Sbjct: 253 ATTQYPLSRIKDLLKEMIGLDRYVK 277


>gi|307257655|ref|ZP_07539414.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306863830|gb|EFM95754.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|328684723|gb|AEB33791.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Actinobacillus pleuropneumoniae serovar 10]
          Length = 284

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 175/265 (66%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ F L  G   +ES D A  + E+   +   L +  V+K+SFDKANRSS+   R
Sbjct: 11  IEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK  +   I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKDTFSVSIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMAR 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+     ++V+ C+RGT+FGY+ LV DM    IM   
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVEKIAECSNENVILCDRGTNFGYDNLVVDMLGFNIMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE H DP+NA  D
Sbjct: 191 SKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGLFLEAHPDPNNAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID ++K
Sbjct: 251 GPSALPLSKLEAFVSQMKAIDDLVK 275


>gi|330828706|ref|YP_004391658.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aeromonas veronii B565]
 gi|328803842|gb|AEB49041.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aeromonas veronii B565]
          Length = 284

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 120/267 (44%), Positives = 176/267 (65%), Gaps = 2/267 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           NQ+  +N++ FVL  G   +ES D A  + EK   +   L I  V+K+S+DKANRSS+  
Sbjct: 9   NQIDVANDKPFVLFGGMNVLESRDMAMAVCEKYVEVTSKLGIPFVFKASWDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF++LK  +G P+++D+H   Q + +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMKIFQELKATFGMPVISDLHEPHQAKPVAEVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM- 213
           A+TG VIN+KK QFLSP +M NI  K    G   ++ CERG +FGY+ LV DM  + +M 
Sbjct: 129 ARTGNVINIKKPQFLSPSQMKNITDKFEECGNDQLILCERGANFGYDNLVVDMLGLGVMK 188

Query: 214 -TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
            ++ G PVIFD +HS+Q     G  SGG R+ +  LA+A +A+G+AG+F+E+H DP  A 
Sbjct: 189 KSTGGYPVIFDVTHSLQCRDPLGAASGGRREQVTELARAGMAVGLAGLFIESHPDPKIAR 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
            DGP+ + ++ L   L Q+ AID +IK
Sbjct: 249 CDGPSALPLEKLEGFLKQMKAIDDLIK 275


>gi|66044610|ref|YP_234451.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           syringae B728a]
 gi|75502986|sp|Q4ZWQ9|KDSA_PSEU2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|63255317|gb|AAY36413.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           syringae B728a]
          Length = 281

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 173/272 (63%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I +GS    +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKA
Sbjct: 6   IRVGS----IEVANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQ
Sbjct: 62  NRSSVNSYRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM
Sbjct: 122 TDLVVAMAKTGAIINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDM 181

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
               IM     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H D
Sbjct: 182 LGFGIMKQFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPD 241

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNA  DGP  + +  L   L+QL ++D+++K
Sbjct: 242 PDNAKCDGPCALRLDKLEPFLAQLKSLDELVK 273


>gi|332290279|ref|YP_004421131.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gallibacterium anatis
           UMN179]
 gi|330433175|gb|AEC18234.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gallibacterium anatis
           UMN179]
          Length = 284

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 174/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E+   +   L +  ++K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPFVLFGGMNVLESRDMAMQVCEQYVKVTDKLKVPYIFKASFDKANRSSIYSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF +LK+ +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFEELKQTFGVKIITDVHEIYQCQPVAEVVDIIQLPAFLARQTDLVEAMAR 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ LV DM    IM   
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVEKIKECGNDKVILCDRGTNFGYDNLVVDMLGFSIMKQV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R  +  LA+A +A+G+AG+FLE H +P  A  D
Sbjct: 191 SQGCPVIFDVTHSLQCRDPFGAASGGRRAQVTELARAGLAVGLAGLFLEAHPEPAKAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   ++Q+ A+D ++K
Sbjct: 251 GPSALPLDKLEPFVAQMKAVDDLVK 275


>gi|289651468|ref|ZP_06482811.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           aesculi str. 2250]
          Length = 281

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 173/272 (63%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I +GS    +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKA
Sbjct: 6   IRVGS----IEIANDKPMVLFGGMNLLESRDMAMQVCEEYVRVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQ
Sbjct: 62  NRSSVNSYRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM
Sbjct: 122 TDLVVAMAKTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDM 181

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
               +M     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H D
Sbjct: 182 LGFGVMKQFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPD 241

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNA  DGP  + +  L   L+QL ++D+++K
Sbjct: 242 PDNAKCDGPCALRLDKLEPFLAQLKSLDELVK 273


>gi|156973553|ref|YP_001444460.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio harveyi ATCC
           BAA-1116]
 gi|166220461|sp|A7MY69|KDSA_VIBHB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|156525147|gb|ABU70233.1| hypothetical protein VIBHAR_01254 [Vibrio harveyi ATCC BAA-1116]
          Length = 283

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 174/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ F L AG   +ES D A  I E    +   L I  V+K+SFDKANRSS+   R
Sbjct: 11  IQVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QF+SP ++ NI++K    G ++++ CERG+  GY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFMSPGQVGNIVEKFAECGNENIILCERGSCMGYDNLVVDMLGFGVMKNA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H +PD A  D
Sbjct: 191 SKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAHPNPDQARCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L+Q+ ++D +IK
Sbjct: 251 GPSALPLDKLEPFLAQMKSLDDLIK 275


>gi|237731776|ref|ZP_04562257.1| KDO-8-phosphate synthetase [Citrobacter sp. 30_2]
 gi|226907315|gb|EEH93233.1| KDO-8-phosphate synthetase [Citrobacter sp. 30_2]
          Length = 284

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 172/265 (64%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QF+SP +M NI+ K H  G   V+ C+RG +FGY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFVSPGQMGNIVDKFHEGGNDKVILCDRGANFGYDNLVVDMLGFSVMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S   PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+F+E H DP NA  D
Sbjct: 191 SGNSPVIFDVTHALQCRDPFGAASGGRRAQVTELARAGMAVGLAGLFIEAHPDPANAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L + L+Q+ AID ++K
Sbjct: 251 GPSALPLAKLEQFLTQIKAIDDLVK 275


>gi|258621069|ref|ZP_05716103.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio mimicus VM573]
 gi|258626142|ref|ZP_05720990.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio mimicus VM603]
 gi|262166262|ref|ZP_06033999.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           mimicus VM223]
 gi|262170846|ref|ZP_06038524.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           mimicus MB-451]
 gi|258581497|gb|EEW06398.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio mimicus VM603]
 gi|258586457|gb|EEW11172.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio mimicus VM573]
 gi|261891922|gb|EEY37908.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           mimicus MB-451]
 gi|262025978|gb|EEY44646.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           mimicus VM223]
          Length = 283

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 178/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKA
Sbjct: 6   VHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK+ +G  I+TDVHT +Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGLEEGMKIFQELKQTFGVKIITDVHTAEQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   S G P+IFD +HS+Q     G  SGG RQ  V LAKA +A GIAG+F+E H
Sbjct: 182 LGFGVMKQASNGSPIIFDVTHSLQMRDPSGAASGGRRQQTVELAKAGLATGIAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +P+ A  DGP+ + +  L   L+Q+ A+D +IK
Sbjct: 242 PNPEKAKCDGPSALPLDKLEPFLAQMKALDDLIK 275


>gi|229524171|ref|ZP_04413576.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae bv. albensis VL426]
 gi|229337752|gb|EEO02769.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae bv. albensis VL426]
          Length = 283

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 177/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+SFDKA
Sbjct: 6   VHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK+ +G  I+TDVHTE Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGLEEGMKIFQELKETFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H
Sbjct: 182 LGFGVMKQASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +PD A  DGP+ + +  L   L+Q+ A+D +IK
Sbjct: 242 PNPDKARCDGPSALPLDKLEPFLAQMKALDDLIK 275


>gi|315125562|ref|YP_004067565.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas sp.
           SM9913]
 gi|315014075|gb|ADT67413.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas sp.
           SM9913]
          Length = 284

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 121/267 (45%), Positives = 174/267 (65%), Gaps = 1/267 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           + +  SN   FVL  G   +ES D A  +AE    I   LNI  ++K+SFDKANRSS+  
Sbjct: 9   DNIELSNNAPFVLFGGVNVLESRDLAMRVAEHYVEITNKLNIPYIFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++KK +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKKTFNIPLITDVHEPYQAAPVAEIVDVIQLPAFLARQTDLVIAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  ++  CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNNNIALCERGSSFGYNNLVVDMLGMDDMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           SM  PVIFDA+H++Q+PG   + + G R     LA++ +A+GIAG+F+E H +P+ A  D
Sbjct: 189 SMA-PVIFDATHALQRPGGRIDSADGRRAQAAELARSGMALGIAGLFIEAHPNPNEAKCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GP  + +  L   L+Q+ A+D +IK L
Sbjct: 248 GPCALALDKLEGYLTQMKAVDDLIKNL 274


>gi|15602423|ref|NP_245495.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pasteurella multocida
           subsp. multocida str. Pm70]
 gi|13431620|sp|P57853|KDSA_PASMU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|12720824|gb|AAK02642.1| KdsA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 284

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 179/277 (64%), Gaps = 6/277 (2%)

Query: 25  NAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSF 84
           N  I LG    ++  SN++ FVL  G   +ES D A  + E    + + L +  V+K+SF
Sbjct: 3   NKVIRLG----EIEISNDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASF 58

Query: 85  DKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL 144
           DKANRSS+   RG G+++G +IF++LK  +G  ++TDVH   QC+ +A+ VDI+Q+PA L
Sbjct: 59  DKANRSSIHSYRGPGMEQGLKIFQELKDTFGVKLITDVHEIYQCQPVAEVVDIIQLPAFL 118

Query: 145 CRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLV 204
            RQTDL+ A A+TG +INVKK QFLSP +M NI++K+   G  +V+ C+RGT+FGY+ LV
Sbjct: 119 ARQTDLVAAMAKTGAIINVKKPQFLSPGQMGNIVEKIEECGNDNVILCDRGTNFGYDNLV 178

Query: 205 TDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
            DM    +M   S G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+FL
Sbjct: 179 VDMLGFSVMKKVSKGCPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGLFL 238

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           E H +P  A  DGP+ + +  L   + Q+ AID ++K
Sbjct: 239 EAHPNPSQAKCDGPSALPLSALEGFVHQMKAIDDLVK 275


>gi|145220498|ref|YP_001131207.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Prosthecochloris
           vibrioformis DSM 265]
 gi|145206662|gb|ABP37705.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Chlorobium
           phaeovibrioides DSM 265]
          Length = 291

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 118/265 (44%), Positives = 169/265 (63%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           + FS+ +  +LIAGPC IES + A  +AE+L  I  +  +  ++K S+ KANR+S +   
Sbjct: 24  IEFSSTKSPLLIAGPCLIESREMAIEVAEELRRITAATGVQFIFKGSYRKANRTSGSSFT 83

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G +   E+  ++ + YG P+LTDVH  +     +  VD+LQIPA L RQT+LL AA +
Sbjct: 84  GIGDETALEVLAEIGRTYGMPVLTDVHETKDVALASRYVDVLQIPAFLSRQTELLVAAGE 143

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           +G  +N+KKGQF++P +M     K+ A G + ++  ERGTSFGYN LV D R +  M   
Sbjct: 144 SGLAVNIKKGQFMAPQDMARAAGKVSATGNRRIMLTERGTSFGYNNLVVDFRGLVKMAES 203

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVI+DA+HS+Q PG     SGGER Y++PLA+AAVA G+ G+F E H DP+ A SD  
Sbjct: 204 GWPVIYDATHSLQLPGAGDGVSGGERGYVLPLARAAVATGVNGLFFEVHPDPEMAMSDAA 263

Query: 277 NMINIKDLPKLLSQLLAIDKIIKPL 301
             I + D   L+SQLLA+   ++ L
Sbjct: 264 TQIPLGDFAPLVSQLLALYGCVQSL 288


>gi|167570507|ref|ZP_02363381.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           oklahomensis C6786]
          Length = 284

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 175/265 (66%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L  IC  L +  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLGVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  +++++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  EGLRILAEVRRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K     A+D        L CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-DAARDAGLSEDRFLACERGVSFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P +A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPADARSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LL  L+ +D+ +K
Sbjct: 250 GPNAVPLGRMAALLETLVTLDRAVK 274


>gi|254786813|ref|YP_003074242.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Teredinibacter turnerae
           T7901]
 gi|237685653|gb|ACR12917.1| 3-deoxy-8-phosphooctulonate synthase [Teredinibacter turnerae
           T7901]
          Length = 283

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 126/276 (45%), Positives = 176/276 (63%), Gaps = 6/276 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I +GS    +  +N++ F L  G   +ES D A  IAEK   + Q L I  V+K+SFDKA
Sbjct: 6   IKVGS----IDVANDKPFTLFGGMNVLESQDLALKIAEKYVQVTQKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG G++KG  IF  +KK++G P++TDVH  QQ   +A+ VD++Q+PA L RQ
Sbjct: 62  NRSSIHSYRGPGMEKGLRIFEAVKKEFGIPVITDVHEPQQAAPVAEVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+T  VINVKK QFLSP +M NI++K    G ++V+ CERG   GY+ LV DM
Sbjct: 122 TDLVEAMAKTDAVINVKKPQFLSPGQMRNIVEKFAEGGNENVILCERGACMGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
                M   S G+PVIFD +H++Q     G  SGG RQ    LA+A +A+G+AG+F+E H
Sbjct: 182 LGFRTMKEVSNGLPVIFDVTHALQCRDPLGAASGGRRQQTAELARAGLAVGLAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
            +P+ A  DGP+ + +  L   L Q+ A+D ++K L
Sbjct: 242 PNPNEAKCDGPSALPLDKLEPFLGQMKAVDNLVKVL 277


>gi|167563334|ref|ZP_02356250.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           oklahomensis EO147]
          Length = 284

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 175/265 (66%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L  IC  L +  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLGVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  +++++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  EGLRILAEVRRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K     A+D        L CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-DAARDAGLSEDRFLACERGVSFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P +A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPADARSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LL  L+ +D+ +K
Sbjct: 250 GPNAVPLGRMAALLETLVTLDRAVK 274


>gi|88808107|ref|ZP_01123618.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus sp. WH
           7805]
 gi|88788146|gb|EAR19302.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus sp. WH
           7805]
          Length = 283

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 180/276 (65%), Gaps = 6/276 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           + LGS    +TF+N+  FVLI G   +ES   A   A K   +C+ L I LV+K+SFDKA
Sbjct: 6   VSLGS----ITFANDAPFVLIGGVNVLESQQFALDAAAKYADVCRRLAIPLVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G  + + +K  +G P++TDVHT +Q    A+  DI+Q+PA L RQ
Sbjct: 62  NRSSVHSFRGPGLEEGLAMLQAVKDTHGMPVITDVHTPEQAAPAAEVCDIIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A AQTG VIN+KK QFLSP +M N+++K    G + +L CERG++FGY+ LV DM
Sbjct: 122 TDLVEAMAQTGAVINIKKPQFLSPSQMANVVEKFRECGNERLLICERGSNFGYDNLVVDM 181

Query: 208 RSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M      +P+IFD +H++Q     G  SGG R  ++ LA+A +AIG+AG+FLE+H
Sbjct: 182 LGFGVMKRCCDDLPLIFDVTHALQCRDPGGAASGGRRSQVLDLARAGMAIGLAGLFLESH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
            DP  A  DGP+ + ++ L   LSQL A+D ++K L
Sbjct: 242 PDPSQARCDGPSALPLEQLEPFLSQLKAVDDLVKSL 277


>gi|15642174|ref|NP_231806.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121586782|ref|ZP_01676564.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae 2740-80]
 gi|121727215|ref|ZP_01680382.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae V52]
 gi|147674359|ref|YP_001217691.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae O395]
 gi|153213284|ref|ZP_01948696.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae 1587]
 gi|153801646|ref|ZP_01956232.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MZO-3]
 gi|153818804|ref|ZP_01971471.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae NCTC
           8457]
 gi|153823570|ref|ZP_01976237.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae B33]
 gi|153825577|ref|ZP_01978244.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MZO-2]
 gi|153828651|ref|ZP_01981318.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae 623-39]
 gi|227082300|ref|YP_002810851.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae M66-2]
 gi|229507747|ref|ZP_04397252.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae BX 330286]
 gi|229512017|ref|ZP_04401496.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae B33]
 gi|229519153|ref|ZP_04408596.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae RC9]
 gi|229522126|ref|ZP_04411543.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae TM 11079-80]
 gi|229528818|ref|ZP_04418208.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae 12129(1)]
 gi|229607292|ref|YP_002877940.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MJ-1236]
 gi|254291406|ref|ZP_04962199.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae
           AM-19226]
 gi|254849254|ref|ZP_05238604.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MO10]
 gi|255745096|ref|ZP_05419045.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholera CIRS 101]
 gi|262167524|ref|ZP_06035230.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae RC27]
 gi|298497810|ref|ZP_07007617.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio cholerae MAK 757]
 gi|20532143|sp|Q9KQ29|KDSA_VIBCH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|172047627|sp|A5F692|KDSA_VIBC3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|254807754|sp|C3LPI0|KDSA_VIBCM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|9656729|gb|AAF95320.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121548949|gb|EAX58988.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae 2740-80]
 gi|121630460|gb|EAX62853.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae V52]
 gi|124116084|gb|EAY34904.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae 1587]
 gi|124122823|gb|EAY41566.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MZO-3]
 gi|126510647|gb|EAZ73241.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae NCTC
           8457]
 gi|126518905|gb|EAZ76128.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae B33]
 gi|146316242|gb|ABQ20781.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae O395]
 gi|148875922|gb|EDL74057.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae 623-39]
 gi|149740728|gb|EDM54827.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MZO-2]
 gi|150422736|gb|EDN14690.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae
           AM-19226]
 gi|227010188|gb|ACP06400.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae M66-2]
 gi|227014071|gb|ACP10281.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae O395]
 gi|229332592|gb|EEN98078.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae 12129(1)]
 gi|229341051|gb|EEO06056.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae TM 11079-80]
 gi|229343842|gb|EEO08817.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae RC9]
 gi|229351982|gb|EEO16923.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae B33]
 gi|229355252|gb|EEO20173.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae BX 330286]
 gi|229369947|gb|ACQ60370.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae MJ-1236]
 gi|254844959|gb|EET23373.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MO10]
 gi|255736926|gb|EET92322.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholera CIRS 101]
 gi|262024096|gb|EEY42791.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae RC27]
 gi|297542143|gb|EFH78193.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio cholerae MAK 757]
 gi|327484697|gb|AEA79104.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae LMA3894-4]
          Length = 283

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 177/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+SFDKA
Sbjct: 6   VHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK+ +G  I+TDVHTE Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGLEEGMKIFQELKETFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H
Sbjct: 182 LGFGVMKQASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +PD A  DGP+ + +  L   L+Q+ A+D +IK
Sbjct: 242 PNPDKARCDGPSALPLDKLEPFLAQMKALDDLIK 275


>gi|315179420|gb|ADT86334.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) (KDOPS) [Vibrio furnissii NCTC 11218]
          Length = 283

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 125/274 (45%), Positives = 177/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+SFDKA
Sbjct: 6   VHVGD----IPVANDKPFTLFAGMNVLESRDMAMQICEHYVKVTDKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG V+NVKK QF+SP ++ NI++K    G + V+ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVVNVKKPQFMSPGQVGNIVEKFAECGNEKVILCERGSCHGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H
Sbjct: 182 LGFGVMKKASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +PD A  DGP+ + +  L   L+Q+ A+D ++K
Sbjct: 242 PNPDQARCDGPSALPLDKLEPFLAQMKALDDLVK 275


>gi|289675288|ref|ZP_06496178.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           syringae FF5]
          Length = 281

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 173/272 (63%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I +GS    +  +N++  VL  G   +ES D A  + E+   + + L +  V+K+SFDKA
Sbjct: 6   IRVGS----IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGMPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQ
Sbjct: 62  NRSSVNSYRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM
Sbjct: 122 TDLVVAMAKTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDM 181

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
               IM     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H D
Sbjct: 182 LGFGIMKQFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPD 241

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNA  DGP  + +  L   L+QL ++D+++K
Sbjct: 242 PDNAKCDGPCALRLDKLEPFLAQLKSLDELVK 273


>gi|218708759|ref|YP_002416380.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio splendidus LGP32]
 gi|254807755|sp|B7VKH7|KDSA_VIBSL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|218321778|emb|CAV17734.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio splendidus LGP32]
          Length = 284

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 179/274 (65%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G+    +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKA
Sbjct: 7   VHIGN----MPIANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKA 62

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG G+++G +IF++LK  +G  I+TD+HTE Q + +AD VD++Q+PA L RQ
Sbjct: 63  NRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDIHTEAQAQPVADVVDVIQLPAFLARQ 122

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI+ K    G ++++ CERG+  GY+ LV DM
Sbjct: 123 TDLVEAMAKTGAVINVKKPQFMSPDQVGNIVDKFAECGNENIILCERGSCMGYDNLVVDM 182

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M  +S G P+IFD +H++Q     G  SGG R+  V LAKA +A GIAG+FLE H
Sbjct: 183 LGFGVMKKSSNGSPIIFDVTHALQMRDPSGAASGGRREQTVELAKAGIATGIAGLFLEAH 242

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +PD A  DGP+ + +  L   L Q+ A+D +IK
Sbjct: 243 PNPDQARCDGPSALPLDKLEPFLKQMKALDDLIK 276


>gi|330968940|gb|EGH69006.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 281

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 173/272 (63%), Gaps = 4/272 (1%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           I +GS    +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKA
Sbjct: 6   IRVGS----IEVANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  D++Q+PA L RQ
Sbjct: 62  NRSSVNSYRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDVIQLPAFLSRQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM
Sbjct: 122 TDLVVAMAKTGAIINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDM 181

Query: 208 RSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQD 267
               IM     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H D
Sbjct: 182 LGFGIMKQFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPD 241

Query: 268 PDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           PDNA  DGP  + +  L   L+QL ++D+++K
Sbjct: 242 PDNAKCDGPCALRLDKLEPFLAQLKSLDELVK 273


>gi|319776408|ref|YP_004138896.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Haemophilus
           influenzae F3047]
 gi|317450999|emb|CBY87229.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Haemophilus
           influenzae F3047]
          Length = 284

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 174/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+SFDKANRSS+   R
Sbjct: 11  IDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ L+ DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDNLIVDMLGFSVMKKA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+FLE H +P+ A  D
Sbjct: 191 SKGSPVIFDVTHSLQCRDSFGAASSGRRAQVTELARSGLAVGIAGLFLEAHPNPNQAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID ++K
Sbjct: 251 GPSALPLSALEGFVSQMKAIDDLVK 275


>gi|251770942|gb|EES51527.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospirillum
           ferrodiazotrophum]
          Length = 298

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 171/249 (68%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
           + I GPC IES  HA  +A ++  I  +L I +V+K+S+DKANR+S    RG+G  KG E
Sbjct: 29  LFILGPCVIESRSHALEVAHRIAEIRNALRISVVFKASYDKANRTSRKSFRGIGRSKGLE 88

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
           +  +++ ++  P+L+D+HT  +    A  +DILQIPA L RQTDLL AA ++GR +++KK
Sbjct: 89  VLAEVRSRHDLPVLSDIHTPDEVPDAASVLDILQIPAFLSRQTDLLEAAGRSGRPVHLKK 148

Query: 166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDAS 225
           GQF++P +M    QK+   G   +L CERGT+FGY+ LV D RS+ +M  +  PVIFD +
Sbjct: 149 GQFMAPEDMGPAAQKISDTGNTRILLCERGTTFGYHNLVVDFRSLAVMARLSHPVIFDGT 208

Query: 226 HSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLP 285
           HSVQ PG  G+ SGG+R+Y+  L +AA+A G  G+FLETH DPD APSDGPNMI + +LP
Sbjct: 209 HSVQSPGGGGDRSGGDRRYVPLLVRAAMAAGCDGLFLETHPDPDRAPSDGPNMIPLSELP 268

Query: 286 KLLSQLLAI 294
            LL Q L +
Sbjct: 269 ALLGQALEL 277


>gi|237812997|ref|YP_002897448.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           MSHR346]
 gi|237506610|gb|ACQ98928.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           MSHR346]
          Length = 284

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 124/265 (46%), Positives = 175/265 (66%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L  IC +L +  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  EGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K     A+D        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMENVIDKAR-DAARDAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G+AG+F+ETH +P  A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAALATGVAGLFMETHPNPAEAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LL  L+ +D+ +K
Sbjct: 250 GPNAVPLGRMAALLETLVTLDRAVK 274


>gi|301162022|emb|CBW21566.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase [Bacteroides
           fragilis 638R]
          Length = 267

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 124/254 (48%), Positives = 160/254 (62%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F L+AGPC IE  + A  IAEK+  I   L I  V+K S+ KANRS L    G+G +K  
Sbjct: 13  FFLLAGPCVIEGEEMAMRIAEKIVNITDKLGIPYVFKGSYRKANRSRLDSFMGIGDEKAL 72

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           ++   +   +G P +TD+H   +    AD VDILQIPA LCRQTDLL AAAQTG+ IN+K
Sbjct: 73  KVLEKVHNTFGVPTVTDIHAADEAGMAADYVDILQIPAFLCRQTDLLVAAAQTGKTINIK 132

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQFLSP  M     K+   G K+V+  ERGT+FGY  LV D R IP M S G PVI D 
Sbjct: 133 KGQFLSPLAMQFAADKVIEAGNKNVMLTERGTTFGYQDLVIDYRGIPEMQSFGYPVILDV 192

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HS+QQP      +GG  Q I  +AKA +A+G  G+F+ETH++P  A SDG NM+ +  L
Sbjct: 193 THSLQQPNQTNGVTGGMPQLIETVAKAGIAVGADGLFIETHENPAVAKSDGANMLKLDRL 252

Query: 285 PKLLSQLLAIDKII 298
             LL++L+ I + I
Sbjct: 253 EGLLTKLVKIREAI 266


>gi|28868759|ref|NP_791378.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213969137|ref|ZP_03397276.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato T1]
 gi|301383968|ref|ZP_07232386.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato Max13]
 gi|302064146|ref|ZP_07255687.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato K40]
 gi|302134073|ref|ZP_07260063.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|32171413|sp|Q886M4|KDSA_PSESM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|28851998|gb|AAO55073.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213926135|gb|EEB59691.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato T1]
 gi|330872708|gb|EGH06857.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330964162|gb|EGH64422.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331016385|gb|EGH96441.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 281

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 115/263 (43%), Positives = 169/263 (64%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++  V+  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+   R
Sbjct: 11  IEIANDKPMVVFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKASFDKANRSSVNSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQTDLVVAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM   
Sbjct: 131 TGAIINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQF 190

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PV+FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  DGP
Sbjct: 191 EYPVLFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPDPDNAKCDGP 250

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
             + +  L   L+QL ++D+++K
Sbjct: 251 CALRLDKLEPFLAQLKSLDELVK 273


>gi|308050531|ref|YP_003914097.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ferrimonas balearica DSM
           9799]
 gi|307632721|gb|ADN77023.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ferrimonas balearica DSM
           9799]
          Length = 283

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 128/275 (46%), Positives = 176/275 (64%), Gaps = 6/275 (2%)

Query: 27  AIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDK 86
           AI +G    Q   +N++ FVL  G   +ES D A  IAE    + + L I  V+K+SFDK
Sbjct: 5   AIRVG----QCDVANDKPFVLFGGMNVLESRDLAMRIAEHYVQVTEKLGIPYVFKASFDK 60

Query: 87  ANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCR 146
           ANRSS+   RG G+++G +IF ++K  +  P++TDVH   Q   +A+ VD++Q+PA L R
Sbjct: 61  ANRSSIHSYRGPGMEEGLKIFEEIKSTFNVPLITDVHETHQAAPVAEVVDVIQLPAFLAR 120

Query: 147 QTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTD 206
           QTDL+ A A T  V+NVKK QFLSP +M NI++K    G ++V+ CERG +FGY+ LV D
Sbjct: 121 QTDLVAAMAATDAVVNVKKPQFLSPGQMKNIVEKFRECGKEEVILCERGANFGYDNLVVD 180

Query: 207 MRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET 264
           M     M   S G+PVIFD +H++Q     G  SGG R+  V LAKA +A G+AG+FLE 
Sbjct: 181 MLGFRTMKEASGGLPVIFDVTHALQCRDPLGAASGGRRRQTVELAKAGMATGLAGLFLEA 240

Query: 265 HQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           H DPDNA  DGP+ + +  L   L+QL A+D +IK
Sbjct: 241 HPDPDNALCDGPSALPLAMLEPFLAQLKALDDLIK 275


>gi|253990001|ref|YP_003041357.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253781451|emb|CAQ84614.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Photorhabdus
           asymbiotica]
          Length = 292

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 173/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 19  IKVANDLPFVLFGGMNVLESRDLAMSICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYR 78

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LKK++G  I+TDVH   Q + +A+ VD++Q+PA L RQTDL+ A A+
Sbjct: 79  GPGLEEGMKIFQELKKQFGVKIITDVHEPAQAQPVAEVVDVIQLPAFLARQTDLVEAMAR 138

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QF+SP +M NI++K    G   V+ C+RG++FGY+ LV DM    +M   
Sbjct: 139 TGAVINVKKPQFISPGQMGNIVEKFKEGGNDQVILCDRGSNFGYDNLVVDMLGFNVMAQA 198

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PVIFD +HS+Q     G  SGG R  +  LA+A +A+GIAG+FLE H DP NA  D
Sbjct: 199 TGGHPVIFDVTHSLQCRDPFGAASGGRRAQVAELARAGMAVGIAGLFLEAHPDPANARCD 258

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L Q+ AID ++K
Sbjct: 259 GPSALPLAKLEPFLIQMKAIDDVVK 283


>gi|323143929|ref|ZP_08078587.1| 3-deoxy-8-phosphooctulonate synthase [Succinatimonas hippei YIT
           12066]
 gi|322416293|gb|EFY06969.1| 3-deoxy-8-phosphooctulonate synthase [Succinatimonas hippei YIT
           12066]
          Length = 283

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 171/267 (64%), Gaps = 2/267 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T +N+    +I G   +ES D A  + EK   +   L++  ++K+SFDKANRSSL  
Sbjct: 9   NDITIANDLPLTVIGGINVLESRDLAMRVCEKFMEVTGKLHLPYIFKASFDKANRSSLRS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+ G +IF DLK+++   I+TDVH   QC  +A+ VD+LQ+PA L RQ+DL+ A 
Sbjct: 69  YRGPGLEAGMKIFDDLKREFNVSIITDVHETYQCALVAEHVDLLQLPAFLARQSDLVFAL 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM- 213
            +TG+ +NVKK QF+SP ++ NI++K H  G  +V+ CERGT FGY+ LV DM    +M 
Sbjct: 129 GKTGKPVNVKKPQFMSPAQVVNIVEKFHETGNDNVILCERGTQFGYDNLVVDMLGFGVMK 188

Query: 214 -TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
             S   PVIFD +HS+Q    +   SGG R  +  LAKA VAIG+AGIF+ETH DPD A 
Sbjct: 189 KVSGNAPVIFDVTHSLQCREANSQASGGRRAQVFDLAKAGVAIGLAGIFVETHPDPDKAL 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
            DGP+ + +  L   LS L  +D ++K
Sbjct: 249 CDGPSALPLDKLEPFLSDLKELDTLVK 275


>gi|238797833|ref|ZP_04641326.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia mollaretii ATCC
           43969]
 gi|238718361|gb|EEQ10184.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia mollaretii ATCC
           43969]
          Length = 284

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 121/265 (45%), Positives = 176/265 (66%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G  IF+DLK+++G  ++TDVH   QC+ +A+ VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMRIFQDLKQQFGVKVITDVHEISQCQPVAEVVDVIQLPAFLARQTDLVEAMAR 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT-- 214
           TG VINVKK QF+SP +M NI++K    G   V+ C+RG++FGY+ LV DM  I +M   
Sbjct: 131 TGAVINVKKPQFVSPGQMGNIVEKFKEAGNDQVILCDRGSNFGYDNLVVDMLGINVMVQA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PVIFD +H++Q     G+ SGG R  +  LA+A +A+G+AG+F+E H +P++A  D
Sbjct: 191 TGGHPVIFDVTHALQCRDPFGSASGGRRAQVAELARAGMAVGLAGLFIEAHPEPNSAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L Q+ AID ++K
Sbjct: 251 GPSALPLAKLEPFLVQMKAIDDLVK 275


>gi|328953769|ref|YP_004371103.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454093|gb|AEB09922.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfobacca acetoxidans
           DSM 11109]
          Length = 275

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 126/258 (48%), Positives = 169/258 (65%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           E R   IAGPC IES      +A  L A    L + L++K+SFDKANR+S+   RG GL 
Sbjct: 13  EGRLAFIAGPCVIESKTLTLEVAHALKAYAVELQVPLIFKASFDKANRTSVTSFRGPGLN 72

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G EI   +K++ G P+L+D+H   Q    A  +D+LQIPA LCRQTDL+ AAA TG+ +
Sbjct: 73  QGLEILALVKEEVGLPVLSDIHETAQAIPAAQVLDVLQIPAFLCRQTDLIEAAAHTGKPL 132

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KKGQFL+PW+M     K    G   +L  ERG  FGYN LV D RS+P+M  +G PV+
Sbjct: 133 NIKKGQFLAPWDMAQAAAKAAKAGNTSLLLTERGVLFGYNNLVVDFRSLPLMRRLGFPVV 192

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
            D +HSVQ PG  G+CSGG+RQ+I  LA+AAVA+G+  +F+E H +PD A  DGPN + +
Sbjct: 193 MDVTHSVQLPGGQGSCSGGDRQFIPHLARAAVAVGVDAVFMEVHPNPDKALCDGPNSLPL 252

Query: 282 KDLPKLLSQLLAIDKIIK 299
            ++P+L  QLL I  + K
Sbjct: 253 HEVPRLWRQLLDIQALRK 270


>gi|229513821|ref|ZP_04403283.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae TMA 21]
 gi|297582068|ref|ZP_06943987.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae RC385]
 gi|229349002|gb|EEO13959.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae TMA 21]
 gi|297533763|gb|EFH72605.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae RC385]
          Length = 283

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 176/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N + F L AG   +ES D A  I E    +   L I  V+K+SFDKA
Sbjct: 6   VHVGD----IPVANNKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK+ +G  I+TDVHTE Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGLEEGMKIFQELKETFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H
Sbjct: 182 LGFGVMKQASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +PD A  DGP+ + +  L   L+Q+ A+D +IK
Sbjct: 242 PNPDKARCDGPSALPLDKLEPFLAQMKALDDLIK 275


>gi|241895149|ref|ZP_04782445.1| 3-deoxy-8-phosphooctulonate synthase [Weissella paramesenteroides
           ATCC 33313]
 gi|241871645|gb|EER75396.1| 3-deoxy-8-phosphooctulonate synthase [Weissella paramesenteroides
           ATCC 33313]
          Length = 283

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 158/233 (67%), Gaps = 1/233 (0%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           + R  L+AGPC IES++    + E+L  I   L I  V+KSSFDKANRSS++  RG G++
Sbjct: 15  DDRLTLLAGPCAIESYETCAEVVEELKKITDELGINYVFKSSFDKANRSSISSDRGAGME 74

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G E+ R +K+ Y  PI+TDVH   QC  +A+  D+LQIPA L RQTDLL AAA+TGRV+
Sbjct: 75  AGLEVLRKIKENYNVPIVTDVHESYQCAPVAEVADVLQIPAFLSRQTDLLLAAAKTGRVV 134

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           N+KK QF++P ++ + + K+ A   K +L  ERGT FGY+ LV DM S+  M     P+I
Sbjct: 135 NIKKAQFMAPEDIQSAVDKV-ASQNKHILVTERGTMFGYHQLVVDMTSLIQMRQTEYPII 193

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           FDA+HSVQ P  +GN SGG R Y+ PL +AA++IGI GIF E H +P  A SD
Sbjct: 194 FDATHSVQIPSGYGNHSGGNRDYVFPLMRAALSIGIDGIFAEVHPNPPKAISD 246


>gi|126438977|ref|YP_001059604.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 668]
 gi|126218470|gb|ABN81976.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           668]
          Length = 284

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 124/265 (46%), Positives = 175/265 (66%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L  IC +L +  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGRLQEICATLGVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  EGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K     A+D        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-DAARDAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G+AG+F+ETH +P  A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAALATGVAGLFMETHPNPAEAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LL  L+ +D+ +K
Sbjct: 250 GPNAVPLGRMAALLETLVTLDRAVK 274


>gi|269961573|ref|ZP_06175935.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio harveyi 1DA3]
 gi|269833614|gb|EEZ87711.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio harveyi 1DA3]
          Length = 283

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 174/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ F L AG   +ES D A  I E    +   L I  V+K+SFDKANRSS+   R
Sbjct: 11  IQVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QF+SP ++ NI++K    G ++++ CERG+  GY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFMSPGQVGNIVEKFAECGNENIILCERGSCHGYDNLVVDMLGFGVMKNA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H +PD A  D
Sbjct: 191 SKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAHPNPDQARCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L+Q+ ++D +IK
Sbjct: 251 GPSALPLDKLEPFLAQMKSLDDLIK 275


>gi|242239293|ref|YP_002987474.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dickeya dadantii Ech703]
 gi|242131350|gb|ACS85652.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dickeya dadantii Ech703]
          Length = 284

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 181/278 (65%), Gaps = 6/278 (2%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
            N  +++G     +  +N   FVL  G   +ES D A  I E    + Q L I  V+K+S
Sbjct: 2   NNKVVNVGD----IPVANHLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA 
Sbjct: 58  FDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKVITDVHEAYQAQPVADVVDVIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G ++V+ C+RGT+FGY+ L
Sbjct: 118 LARQTDLVEAMAKTGAVINVKKPQFISPGQMGNIVDKFREGGNENVILCDRGTNFGYDNL 177

Query: 204 VTDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           V DM    +M   S G+PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+F
Sbjct: 178 VVDMLGFNVMKQASHGLPVIFDVTHALQCRDPFGAASGGRRAQVTELARAGMAVGLAGLF 237

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +E H +P++A  DGP+ + +  L   L+Q+ AID+++K
Sbjct: 238 IEAHPEPNSARCDGPSALPLNKLEPFLAQMKAIDELVK 275


>gi|53719881|ref|YP_108867.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei K96243]
 gi|53723785|ref|YP_103310.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia mallei ATCC
           23344]
 gi|67642982|ref|ZP_00441732.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei GB8 horse
           4]
 gi|76808886|ref|YP_334098.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 1710b]
 gi|121600604|ref|YP_993506.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia mallei
           SAVP1]
 gi|124384399|ref|YP_001029065.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia mallei NCTC
           10229]
 gi|126450864|ref|YP_001081014.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia mallei NCTC
           10247]
 gi|126453670|ref|YP_001066885.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 1106a]
 gi|167001758|ref|ZP_02267550.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei PRL-20]
 gi|167816536|ref|ZP_02448216.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 91]
 gi|167824932|ref|ZP_02456403.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 9]
 gi|167846448|ref|ZP_02471956.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei B7210]
 gi|167895026|ref|ZP_02482428.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 7894]
 gi|167903410|ref|ZP_02490615.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei NCTC 13177]
 gi|167911663|ref|ZP_02498754.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 112]
 gi|167919662|ref|ZP_02506753.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei BCC215]
 gi|217420970|ref|ZP_03452475.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           576]
 gi|226198911|ref|ZP_03794474.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           Pakistan 9]
 gi|242315483|ref|ZP_04814499.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1106b]
 gi|254178580|ref|ZP_04885235.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei ATCC
           10399]
 gi|254184385|ref|ZP_04890975.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1655]
 gi|254191418|ref|ZP_04897922.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254195748|ref|ZP_04902174.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           S13]
 gi|254200265|ref|ZP_04906631.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei FMH]
 gi|254209343|ref|ZP_04915689.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei JHU]
 gi|254260587|ref|ZP_04951641.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1710a]
 gi|254297050|ref|ZP_04964503.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           406e]
 gi|254357987|ref|ZP_04974260.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei
           2002721280]
 gi|59798164|sp|Q62J09|KDSA_BURMA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|59798455|sp|Q63SP9|KDSA1_BURPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase 1; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase 1; AltName: Full=KDO-8-phosphate synthase 1;
           Short=KDO 8-P synthase 1; Short=KDOPS 1; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase 1
 gi|166199027|sp|A3ML78|KDSA_BURM7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166199028|sp|A2SAU6|KDSA_BURM9 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166199029|sp|A1V5K3|KDSA_BURMS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|52210295|emb|CAH36274.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei K96243]
 gi|52427208|gb|AAU47801.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei ATCC
           23344]
 gi|76578339|gb|ABA47814.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1710b]
 gi|121229414|gb|ABM51932.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei SAVP1]
 gi|124292419|gb|ABN01688.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei NCTC
           10229]
 gi|126227312|gb|ABN90852.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1106a]
 gi|126243734|gb|ABO06827.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei NCTC
           10247]
 gi|147749861|gb|EDK56935.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei FMH]
 gi|147750116|gb|EDK57187.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei JHU]
 gi|148027114|gb|EDK85135.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei
           2002721280]
 gi|157807474|gb|EDO84644.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           406e]
 gi|157939090|gb|EDO94760.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160699619|gb|EDP89589.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei ATCC
           10399]
 gi|169652493|gb|EDS85186.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           S13]
 gi|184214916|gb|EDU11959.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1655]
 gi|217396382|gb|EEC36399.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           576]
 gi|225929011|gb|EEH25035.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           Pakistan 9]
 gi|238524214|gb|EEP87648.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei GB8 horse
           4]
 gi|242138722|gb|EES25124.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1106b]
 gi|243062452|gb|EES44638.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei PRL-20]
 gi|254219276|gb|EET08660.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1710a]
          Length = 284

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 124/265 (46%), Positives = 175/265 (66%), Gaps = 8/265 (3%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAG C +ES       A +L  IC +L +  +YKSS+DKANRSS    RG+G+ 
Sbjct: 11  DKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSSGKSFRGLGMD 70

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I  ++K++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A AQ+G+ +
Sbjct: 71  EGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPV 130

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDV-------LFCERGTSFGYNTLVTDMRSIPIMT 214
           N+KKGQFL+P +M N++ K     A+D        + CERG SFGYN LV+DMRS+ IM 
Sbjct: 131 NIKKGQFLAPHDMKNVIDKAR-DAARDAGLSEDRFMACERGVSFGYNNLVSDMRSLAIMR 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G+AG+F+ETH +P  A SD
Sbjct: 190 ETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAALATGVAGLFMETHPNPAEAKSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + +  +  LL  L+ +D+ +K
Sbjct: 250 GPNAVPLGRMAALLETLVTLDRAVK 274


>gi|325578171|ref|ZP_08148306.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159907|gb|EGC72036.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 284

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/265 (44%), Positives = 175/265 (66%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+SFDKANRSS+   R
Sbjct: 11  IDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF+++K+ +G  ++TDVH   QC+ +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQEIKETFGVKVITDVHEIYQCQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI+ K    G   ++ C+RG++FGY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVDKFEECGNDKIILCDRGSNFGYDNLVVDMLGFGVMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  SGG R+ +  LA++ +AIGIAG+FLE H +P+ A  D
Sbjct: 191 SKGSPVIFDVTHSLQCRDPFGAASGGRREQVTELARSGLAIGIAGLFLEAHPNPNQAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID ++K
Sbjct: 251 GPSALPLSALEGFVSQMKAIDDLVK 275


>gi|260583300|ref|ZP_05851075.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus influenzae NT127]
 gi|260093660|gb|EEW77573.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus influenzae NT127]
          Length = 284

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 174/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+SFDKANRSS+   R
Sbjct: 11  IDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ L+ DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDNLIVDMLGFSVMKKA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+FLE H +P+ A  D
Sbjct: 191 SKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGLFLEAHPNPNQAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID ++K
Sbjct: 251 GPSALPLSALEGFVSQMKAIDDLVK 275


>gi|86148708|ref|ZP_01066985.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio sp. MED222]
 gi|85833501|gb|EAQ51682.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio sp. MED222]
          Length = 283

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 178/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G+    +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKA
Sbjct: 6   VHIGN----MPIANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG G+++G +IF++LK  +G  I+TD+HTE Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDIHTEAQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI+ K    G  +++ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVINVKKPQFMSPDQVGNIVDKFAECGNDNIILCERGSCMGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M  +S G P+IFD +H++Q     G  SGG R+  V LAKA +A GIAG+FLE H
Sbjct: 182 LGFGVMKKSSNGSPIIFDVTHALQMRDPSGAASGGRREQTVELAKAGIATGIAGLFLEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +PD A  DGP+ + +  L   L Q+ A+D +IK
Sbjct: 242 PNPDQARCDGPSALPLDKLEPFLKQMKALDDLIK 275


>gi|329896367|ref|ZP_08271466.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [gamma
           proteobacterium IMCC3088]
 gi|328921787|gb|EGG29158.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [gamma
           proteobacterium IMCC3088]
          Length = 283

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 175/275 (63%), Gaps = 6/275 (2%)

Query: 27  AIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDK 86
           A+ LG     + FSNE  FVL+ G   IE  D    +A +   +CQ+LNI LV+K+SFDK
Sbjct: 5   AVELGD----IRFSNEAPFVLLGGINVIEDLDFTLSVAAEYVRVCQTLNIPLVFKASFDK 60

Query: 87  ANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCR 146
           ANRSS+   RG G+ +G  I   +K ++G P++TD+H  +Q   +A+  DILQ+PA L R
Sbjct: 61  ANRSSIHSFRGPGMDEGLRILAAVKAEFGVPVITDIHAPEQAAPVAEVADILQLPAFLAR 120

Query: 147 QTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTD 206
           QTDL+ A A+TGRVIN+KK QF+SP +M NI++K    G   +L CERG+ FGY+ LV D
Sbjct: 121 QTDLVQAMAETGRVINIKKPQFVSPSQMRNIVEKFVECGNGQLLLCERGSQFGYDNLVVD 180

Query: 207 MRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLET 264
           M    +M       P+IFD +H++Q     G  SGG R  +  L +A +A+G+AG+FLE+
Sbjct: 181 MLGFGVMKRECNNAPLIFDVTHALQCRDPGGAASGGRRHQVAELGRAGMALGLAGLFLES 240

Query: 265 HQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           H DP  A  DGP+ + ++ L   L+Q+ A+D ++K
Sbjct: 241 HPDPSKAKCDGPSALPLELLAPFLAQMKAVDDVVK 275


>gi|68249928|ref|YP_249040.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           86-028NP]
 gi|145631799|ref|ZP_01787559.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           R3021]
 gi|81335648|sp|Q4QKR7|KDSA_HAEI8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|68058127|gb|AAX88380.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           86-028NP]
 gi|144982589|gb|EDJ90139.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           R3021]
          Length = 284

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 174/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+SFDKANRSS+   R
Sbjct: 11  IDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ L+ DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPGQMGNIVEKIEECGNDKIILCDRGTNFGYDNLIVDMLGFSVMKKA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+FLE H +P+ A  D
Sbjct: 191 SKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGLFLEAHPNPNQAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID ++K
Sbjct: 251 GPSALPLSALEGFVSQMKAIDDLVK 275


>gi|301170294|emb|CBW29900.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Haemophilus
           influenzae 10810]
          Length = 284

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 174/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+SFDKANRSS+   R
Sbjct: 11  IDVANDKPFVLFGGMNVLESRDMAMQVCETYVKVTEKLGVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ L+ DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDNLIVDMLGFSVMKKA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+FLE H +P+ A  D
Sbjct: 191 SKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGLFLEAHPNPNQAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID ++K
Sbjct: 251 GPSALPLSALEGFVSQMKAIDDLVK 275


>gi|261821673|ref|YP_003259779.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pectobacterium wasabiae
           WPP163]
 gi|261605686|gb|ACX88172.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pectobacterium wasabiae
           WPP163]
          Length = 284

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 176/278 (63%), Gaps = 6/278 (2%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN  + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+S
Sbjct: 2   TNKVVKIGD----IPVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA 
Sbjct: 58  FDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEAHQAQPVADVVDVIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ L
Sbjct: 118 LARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDQVILCDRGSNFGYDNL 177

Query: 204 VTDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           V DM    +M   S G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+F
Sbjct: 178 VVDMLGFNVMKQASNGAPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGLF 237

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +E H DP NA  DGP+ + +  L   L Q+ AID ++K
Sbjct: 238 IEAHPDPANAKCDGPSALPLDKLEPFLQQIKAIDDLVK 275


>gi|227111334|ref|ZP_03824990.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
 gi|227328869|ref|ZP_03832893.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 284

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 176/278 (63%), Gaps = 6/278 (2%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN  + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+S
Sbjct: 2   TNKVVKIGD----IPVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKAS 57

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA 
Sbjct: 58  FDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHESHQAQPVADVVDVIQLPAF 117

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ L
Sbjct: 118 LARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDQVILCDRGSNFGYDNL 177

Query: 204 VTDMRSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           V DM    +M   S G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+F
Sbjct: 178 VVDMLGFNVMKHASNGAPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGLF 237

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +E H DP NA  DGP+ + +  L   L Q+ AID ++K
Sbjct: 238 IEAHPDPANAKCDGPSALPLDKLEPFLQQIKAIDDLVK 275


>gi|16273457|ref|NP_439706.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           Rd KW20]
 gi|260580338|ref|ZP_05848167.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus influenzae RdAW]
 gi|1170637|sp|P45251|KDSA_HAEIN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|1574401|gb|AAC23206.1| 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA) [Haemophilus
           influenzae Rd KW20]
 gi|260093015|gb|EEW76949.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus influenzae RdAW]
          Length = 284

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 174/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+SFDKANRSS+   R
Sbjct: 11  IDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ L+ DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDNLIVDMLGFSVMKKA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+FLE H +P+ A  D
Sbjct: 191 SKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGLFLEAHPNPNQAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID ++K
Sbjct: 251 GPSALPLSALEGFVSQMKAIDDLVK 275


>gi|261253594|ref|ZP_05946167.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           orientalis CIP 102891]
 gi|260936985|gb|EEX92974.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           orientalis CIP 102891]
          Length = 283

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 176/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKA
Sbjct: 6   VHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI+ K    G  +++ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVINVKKPQFMSPGQVGNIVDKFAECGNDNIILCERGSCHGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H
Sbjct: 182 LGFGVMKKASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
             PD A  DGP+ + +  L   L+Q+ A+D +IK
Sbjct: 242 PTPDQARCDGPSALPLDKLEPFLAQMKALDDLIK 275


>gi|149197220|ref|ZP_01874272.1| Fructose-bisphosphate aldolase, class II [Lentisphaera araneosa
           HTCC2155]
 gi|149139766|gb|EDM28167.1| Fructose-bisphosphate aldolase, class II [Lentisphaera araneosa
           HTCC2155]
          Length = 283

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/268 (44%), Positives = 178/268 (66%), Gaps = 3/268 (1%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N ++ +N++ FVL  G   +E+      + EK  ++C+ L+I  V+K+SFDKANRSS+  
Sbjct: 8   NNISLANDKPFVLFGGLNVLENEADTLKVCEKYLSVCEELSIPYVFKASFDKANRSSVHS 67

Query: 95  KRGVGLKKGREIFRDLKKKYG-FPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
            RGVGL+KG EIF+ LK+++   PI+TDVH  +QC+ +AD VD++Q+PA L RQTDL+ A
Sbjct: 68  FRGVGLEKGMEIFKALKREFNNVPIITDVHEVEQCQPVADVVDVIQLPAFLARQTDLVVA 127

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            A+T  VIN+KK QFLSP +M NI++K    G +  + CERG+  GY+ LV DM     M
Sbjct: 128 MAKTNAVINIKKPQFLSPGQMKNIVEKFAEAGNEKTILCERGSCMGYDNLVVDMLGFRTM 187

Query: 214 --TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
             ++ G PVIFD +HS+Q     G  SGG R+ ++ LA++ +A  +AG+FLE+H +P+ A
Sbjct: 188 KQSTGGAPVIFDVTHSLQCRDPLGAASGGRREQVLELARSGMATRLAGLFLESHPNPEEA 247

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIK 299
             DGP+ + +  L   L Q+ AID ++K
Sbjct: 248 KCDGPSALPLDLLKPFLQQVKAIDDLVK 275


>gi|57242525|ref|ZP_00370463.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Campylobacter
           upsaliensis RM3195]
 gi|57016810|gb|EAL53593.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Campylobacter
           upsaliensis RM3195]
          Length = 267

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/267 (47%), Positives = 171/267 (64%), Gaps = 12/267 (4%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           ++ +LIAGPC IES +  F +AE L  + ++  I   +KSSFDKANR+S+   RG GL++
Sbjct: 2   KKMILIAGPCVIESEELVFSVAEVLQELNENDKIDFYFKSSFDKANRTSINSFRGPGLER 61

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G EI + +K K+   ILTD+H   Q +  ++  D+LQIPA LCRQTDLL A A+T   IN
Sbjct: 62  GLEILQKVKDKFKMQILTDIHESHQAKRASEVADVLQIPAFLCRQTDLLVATAKTPAKIN 121

Query: 163 VKKGQFLSPWEMHNILQK-LHAHGAKD----------VLFCERGTSFGYNTLVTDMRSIP 211
           +KKGQFL+P ++   ++K L   G K+          V   ERG+SFGY  LV DMRS+ 
Sbjct: 122 IKKGQFLTPSDIQYSIKKVLETRGIKEQGYEIAEKNGVFVAERGSSFGYGNLVVDMRSLV 181

Query: 212 IMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
           IM     PVIFDA+HSVQ PG     SGG+ +++ PLA+AA A+G+ G F ETH +P  A
Sbjct: 182 IMREFA-PVIFDATHSVQMPGAAEGSSGGKSEFVEPLARAAAAVGVDGFFFETHINPCEA 240

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKII 298
             DG NM+NIK L   +S LL I +II
Sbjct: 241 LCDGANMLNIKRLKDCVSTLLKIQEII 267


>gi|288940141|ref|YP_003442381.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Allochromatium vinosum
           DSM 180]
 gi|288895513|gb|ADC61349.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Allochromatium vinosum
           DSM 180]
          Length = 277

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 133/253 (52%), Positives = 176/253 (69%)

Query: 47  LIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREI 106
           LIAGPC IES   A   A  L  + ++L I  +YKSSFDKANRSS A  RG GL++G  I
Sbjct: 17  LIAGPCVIESETLAQETAGALKELTEALGISFIYKSSFDKANRSSGASFRGPGLEEGLRI 76

Query: 107 FRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKG 166
              ++   G P+LTDVH +     +A  VD+LQ PA LCRQT+ + A AQ GR +N+KKG
Sbjct: 77  LESVRATIGVPVLTDVHEDTPLAEVAAVVDVLQTPAFLCRQTNFIQAVAQQGRPVNIKKG 136

Query: 167 QFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASH 226
           QFL+PW+M ++++K  A G   V+ CERG SFGYN LV+DMRS+ +M   G PV+FDA+H
Sbjct: 137 QFLAPWDMKHVVEKARATGNDRVMVCERGVSFGYNNLVSDMRSLAVMRETGCPVVFDATH 196

Query: 227 SVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPK 286
           SVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH DPD A SDGPN   ++ +  
Sbjct: 197 SVQLPGGQGTSSGGQREFVPVLARAAVAAGVAGLFMETHPDPDRALSDGPNAWPLRRMRD 256

Query: 287 LLSQLLAIDKIIK 299
           LLS L+ ID+++K
Sbjct: 257 LLSTLVEIDRLVK 269


>gi|262394968|ref|YP_003286822.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           sp. Ex25]
 gi|269965451|ref|ZP_06179570.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio alginolyticus
           40B]
 gi|262338562|gb|ACY52357.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           sp. Ex25]
 gi|269829930|gb|EEZ84160.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio alginolyticus
           40B]
          Length = 283

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 173/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKANRSS+   R
Sbjct: 11  IQVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKANRSSVHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QF+SP ++ NI++K    G   ++ CERG+  GY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFMSPGQVGNIVEKFAECGNDKIILCERGSCHGYDNLVVDMLGFGVMKNA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H +PD A  D
Sbjct: 191 SKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAHPNPDQARCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L+Q+ ++D +IK
Sbjct: 251 GPSALPLDKLEPFLAQMKSLDDLIK 275


>gi|262404520|ref|ZP_06081075.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           sp. RC586]
 gi|262349552|gb|EEY98690.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           sp. RC586]
          Length = 283

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 177/274 (64%), Gaps = 6/274 (2%)

Query: 28  IHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKA 87
           +H+G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+SFDKA
Sbjct: 6   VHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKA 61

Query: 88  NRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQ 147
           NRSS+   RG GL++G +IF++LK+ +G  I+TDVHT +Q + +AD VD++Q+PA L RQ
Sbjct: 62  NRSSVHSYRGPGLEEGMKIFQELKQTFGVKIITDVHTAEQAQPVADVVDVIQLPAFLARQ 121

Query: 148 TDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDM 207
           TDL+ A A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM
Sbjct: 122 TDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDM 181

Query: 208 RSIPIM--TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
               +M   S G P+IFD +HS+Q     G  SGG RQ  V LAKA +A GIAG+F+E H
Sbjct: 182 LGFGVMKQASNGSPIIFDVTHSLQMRDPSGAASGGRRQQTVELAKAGLATGIAGLFIEAH 241

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            +P+ A  DGP+ + +  L   L+Q+ A+D +IK
Sbjct: 242 PNPEKAKCDGPSALPLDKLEPFLAQMKALDDLIK 275


>gi|291276398|ref|YP_003516170.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Helicobacter mustelae
           12198]
 gi|290963592|emb|CBG39424.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Helicobacter mustelae
           12198]
          Length = 269

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 176/268 (65%), Gaps = 12/268 (4%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           Q+F+L++G C IES++    +AE+L  +     I   +KSSFDKANR+SL   RG GL+ 
Sbjct: 3   QKFLLLSGCCVIESYESLARVAEELKPLANHPKIDFYFKSSFDKANRTSLDSFRGPGLEA 62

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G E+   +KK++G+ ILTD+H   Q +AIA   DI+QIPA LCRQTDL+ A A+T  +IN
Sbjct: 63  GLEMLGQIKKEFGYKILTDIHESHQAQAIAKVADIVQIPAFLCRQTDLIVAVAKTDCIIN 122

Query: 163 VKKGQFLSPWEM-HNILQKLHAHGAK----------DVLFCERGTSFGYNTLVTDMRSIP 211
           +KKGQF++P +M +++L+ +   G             V   ERG+SFGY  LV DMRS+ 
Sbjct: 123 IKKGQFMNPKDMQYSVLKAIKTRGGSVATYEESTKHRVWLTERGSSFGYGNLVVDMRSLV 182

Query: 212 IMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
           IM +   PVIFDA+HSVQ PG  G  S G+  ++  LA+AA ++GI GIF ETH DP +A
Sbjct: 183 IMRNFA-PVIFDATHSVQMPGGAGGKSTGDVSFVPYLARAATSVGIDGIFAETHFDPSSA 241

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            SDGPNMI    +P L+ +LL I ++++
Sbjct: 242 LSDGPNMIPTAKMPALIEELLKIKELVQ 269


>gi|156933680|ref|YP_001437596.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cronobacter sakazakii
           ATCC BAA-894]
 gi|166199033|sp|A7MKA7|KDSA_ENTS8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|156531934|gb|ABU76760.1| hypothetical protein ESA_01502 [Cronobacter sakazakii ATCC BAA-894]
          Length = 284

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 173/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+SFDKANRSS+   R
Sbjct: 11  INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK+ +G  I+TDVHT +Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGMKIFQELKQTFGVKIITDVHTAEQAQPVADVVDVIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QF+SP ++ NI+ K    G + V+ C+RGT+FGY+ LV DM    +M   
Sbjct: 131 TGAVINVKKPQFISPGQIGNIVDKFKEGGNEQVILCDRGTNFGYDNLVVDMLGFGVMKKV 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S   PVIFD +H++Q     G  S G R  +  LA+A +A G+AG+F+E H DP+NA  D
Sbjct: 191 SGNAPVIFDVTHALQCRDPFGAASSGRRAQVTELARAGMATGLAGLFIEAHPDPENAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L+Q+ AID ++K
Sbjct: 251 GPSALPLAKLEAFLTQIKAIDDLVK 275


>gi|148826787|ref|YP_001291540.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittGG]
 gi|166199035|sp|A5UEF6|KDSA_HAEIG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|148718029|gb|ABQ99156.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittGG]
          Length = 284

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 174/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+SFDKANRSS+   R
Sbjct: 11  IDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA L RQTDL+ A A+
Sbjct: 71  GPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAMAK 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ L+ DM    +M   
Sbjct: 131 TGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDNLIVDMLGFSVMKKA 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+FLE H +P+ A  D
Sbjct: 191 SKGNPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGLFLEAHPNPNQAKCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   +SQ+ AID ++K
Sbjct: 251 GPSALPLSALEGFVSQMKAIDDLVK 275


>gi|254230553|ref|ZP_04923921.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio sp. Ex25]
 gi|151936925|gb|EDN55815.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio sp. Ex25]
          Length = 298

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 173/265 (65%), Gaps = 2/265 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKANRSS+   R
Sbjct: 26  IQVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKANRSSVHSYR 85

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA L RQTDL+ A A+
Sbjct: 86  GPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQTDLVEAMAK 145

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM--T 214
           TG VINVKK QF+SP ++ NI++K    G   ++ CERG+  GY+ LV DM    +M   
Sbjct: 146 TGAVINVKKPQFMSPGQVGNIVEKFAECGNDKIILCERGSCHGYDNLVVDMLGFGVMKNA 205

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H +PD A  D
Sbjct: 206 SKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAHPNPDQARCD 265

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP+ + +  L   L+Q+ ++D +IK
Sbjct: 266 GPSALPLDKLEPFLAQMKSLDDLIK 290


>gi|119945327|ref|YP_943007.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychromonas ingrahamii
           37]
 gi|166220453|sp|A1SV93|KDSA_PSYIN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|119863931|gb|ABM03408.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychromonas ingrahamii
           37]
          Length = 281

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 166/263 (63%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A  + E       +LNI  V+K+SFDKANRSS+   R
Sbjct: 11  IDVANDRPFVLFGGMNVLESRDMAMRVVETYVEATTALNIPYVFKASFDKANRSSIHSYR 70

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G  IF ++K  +  PI+TDVH   Q   +A+ VD++Q+PA L RQTDL+ A A+
Sbjct: 71  GPGLEEGLRIFEEIKNTFNVPIITDVHEPSQAAPVAEVVDVIQLPAFLSRQTDLVKAMAE 130

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T  VINVKK Q