PSIBLAST alignment of GI: 254780669 and protein with PDB id: 1n8f

>gi|30749573|pdb|1N8F|A Chain A, Crystal Structure Of E24q Mutant Of Phenylalanine-Regulated 3-Deoxy-D-Arabino-Heptulosonate-7-Phosphate Synthase (Dahp Synthase) From Escherichia Coli In Complex With Mn2+ And Pep Length = 350
>gi|30749574|pdb|1N8F|B Chain B, Crystal Structure Of E24q Mutant Of Phenylalanine-Regulated 3-Deoxy-D-Arabino-Heptulosonate-7-Phosphate Synthase (Dahp Synthase) From Escherichia Coli In Complex With Mn2+ And Pep Length = 350
 Score = 53.5 bits (127), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 38/281 (13%), Positives = 77/281 (27%), Gaps = 48/281 (17%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQ--SLNIGLVYKSSFDKANRSSL 92
           +++   N+ R +++ GPC I     A   A +L A+ +     + +V +  F+K   +  
Sbjct: 44  HKILKGNDDRLLVVIGPCSIHDPVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVG 103

Query: 93  -----------AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
                         +     +            G P   +       + +AD +    I 
Sbjct: 104 WKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIG 163

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQ------------------KLHA 183
           A           A+     +  K G   +     + +                    ++ 
Sbjct: 164 ARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNT 223

Query: 184 HGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG--VPVIFDASHSVQQPGIHGNCSGGE 241
            G  D     RG      +          +   G    V+ D SH+              
Sbjct: 224 SGNGDCHIILRGGKEPNYSAKHVAEVKEGLNKAGLPAQVMIDFSHA-NSSKQFKKQMDVC 282

Query: 242 RQYIVPLA---KAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
                 +A   KA +     G+ +E+H        +G   +
Sbjct: 283 ADVCQQIAGGEKAII-----GVMVESH------LVEGNQSL 312