PSIBLAST alignment of GI: 254780669 and protein with PDB id: 2nxg

>gi|146386977|pdb|2NXG|A Chain A, Structural And Mechanistic Changes Along An Engineered Path From Metallo To Non-Metallo Kdo8p Synthase. Length = 263
>gi|146386978|pdb|2NXG|B Chain B, Structural And Mechanistic Changes Along An Engineered Path From Metallo To Non-Metallo Kdo8p Synthase. Length = 263
 Score =  268 bits (685), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 124/257 (48%), Positives = 176/257 (68%), Gaps = 2/257 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGP  IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 1   EKFLVIAGPNAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 60

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LCRQTDLL AAA+TGR +
Sbjct: 61  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAV 120

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 121 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQW-AKVI 179

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD P  + +
Sbjct: 180 YDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDAPTALPL 239

Query: 282 KDLPKLLSQLLAIDKII 298
             L  ++  +L I ++ 
Sbjct: 240 SQLEGIIEAILEIREVA 256