PSIBLAST alignment of GI: 254780669 and protein with PDB id: 3fs2

>gi|221046939|pdb|3FS2|A Chain A, Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctonate Aldolase From Bruciella Melitensis At 1.85a Resolution Length = 298
>gi|221046940|pdb|3FS2|B Chain B, Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctonate Aldolase From Bruciella Melitensis At 1.85a Resolution Length = 298
 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 173/284 (60%), Positives = 219/284 (77%), Gaps = 4/284 (1%)

Query: 18  KNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIG 77
              M+  N+ + +G     VTFSN     LIAGPCQ+E+ DHAF +A +L  +   L IG
Sbjct: 19  PGSMVTANSTVKVG----NVTFSNSAPLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIG 74

Query: 78  LVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDI 137
           LVYKSSFDKANR+SL   RG+GL+K  E+F DLKK+YGFP+LTD+HTE+QC A+A  VD+
Sbjct: 75  LVYKSSFDKANRTSLKAARGIGLEKALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDV 134

Query: 138 LQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTS 197
           LQIPA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG S
Sbjct: 135 LQIPAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLAKITESGNPNVLATERGVS 194

Query: 198 FGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGI 257
           FGYNTLV+DMR++PIM  +G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+
Sbjct: 195 FGYNTLVSDMRALPIMAGLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGV 254

Query: 258 AGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           AG F+ETH+DPDNAPSDGPNM+ I  +P LL +L+A D+I K L
Sbjct: 255 AGFFIETHEDPDNAPSDGPNMVPIDKMPALLEKLMAFDRIAKAL 298