PSIBLAST alignment of GI: 254780669 and protein with PDB id: 3nvt

>gi|301598824|pdb|3NVT|A Chain A, 1.95 Angstrom Crystal Structure Of A Bifunctional 3-Deoxy-7- Phosphoheptulonate SynthaseCHORISMATE MUTASE (AROA) FROM LISTERIA Monocytogenes Egd-E Length = 385
>gi|301598825|pdb|3NVT|B Chain B, 1.95 Angstrom Crystal Structure Of A Bifunctional 3-Deoxy-7- Phosphoheptulonate SynthaseCHORISMATE MUTASE (AROA) FROM LISTERIA Monocytogenes Egd-E Length = 385
 Score =  199 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 70/288 (24%), Positives = 129/288 (44%), Gaps = 33/288 (11%)

Query: 9   LEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLY 68
           L  ++ + +   +               +   N +   +  GPC +ES++    +AE + 
Sbjct: 119 LVSRKNKKEDTIVTVK-----------GLPIGNGEPVFVF-GPCSVESYEQVAAVAESIK 166

Query: 69  AICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQC 128
           A    L  G  +K       R+S    +G+GL+ G +I + +  +YG  +++++ T    
Sbjct: 167 AKGLKLIRGGAFKP------RTSPYDFQGLGLE-GLKILKRVSDEYGLGVISEIVTPADI 219

Query: 129 EAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKD 188
           E   D VD++QI A   +  +LL AA +  + I +K+G   +  E     + + + G   
Sbjct: 220 EVALDYVDVIQIGARNMQNFELLKAAGRVDKPILLKRGLSATIEEFIGAAEYIMSQGNGK 279

Query: 189 VLFCERGTSFGYN--TLVTDMRSIPIMT-SMGVPVIFDASHSVQQPGIHGNCSGGERQYI 245
           ++ CERG            D+ ++PI+     +PV+ D +HS            G +  +
Sbjct: 280 IILCERGIRTYEKATRNTLDISAVPILKKETHLPVMVDVTHST-----------GRKDLL 328

Query: 246 VPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLA 293
           +P AKAA+AI   G+  E H DP  A SD    ++I +  +  + +LA
Sbjct: 329 LPCAKAALAIEADGVMAEVHPDPAVALSDSAQQMDIPEFEEFWNAILA 376