PSIBLAST alignment of GI: 254780669 and protein with PDB id: 3qq0

>gi|328877344|pdb|3QQ0|A Chain A, Crystal Structure Of A Deletion Mutant (N59) Of 3-Deoxy-D-Manno- Octulosonate 8-Phosphate Synthase (Kdo8ps) From Neisseria Meningitidis Length = 279
>gi|328877345|pdb|3QQ0|B Chain B, Crystal Structure Of A Deletion Mutant (N59) Of 3-Deoxy-D-Manno- Octulosonate 8-Phosphate Synthase (Kdo8ps) From Neisseria Meningitidis Length = 279
 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 115/268 (42%), Positives = 164/268 (61%), Gaps = 3/268 (1%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T  N   FVL  G   +ES D           + + L I  ++K+SFDKA RSS+  
Sbjct: 6   NDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKA-RSSIHS 64

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVGL++G +IF  +K ++G P++TDVH   QC+ +A+  D++Q+PA L RQTDL+ A 
Sbjct: 65  YRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAM 124

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG V+N+KK QFLSP +M NI++K H  G   ++ CERG+SFGY+ LV DM    +M 
Sbjct: 125 AKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMK 184

Query: 215 SMG--VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
                +PVIFD +HS+Q        SGG R   + LA A +A  +AG+FLE+H DP  A 
Sbjct: 185 QTCGNLPVIFDVTHSLQTRDAGSAASGGRRAQALDLALAGMATRLAGLFLESHPDPKLAK 244

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L ++ A+D +IK 
Sbjct: 245 CDGPSALPLHLLEDFLIRIKALDDLIKS 272