BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780669|ref|YP_003065082.1|
2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter
asiaticus str. psy62]
         (301 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780669|ref|YP_003065082.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040346|gb|ACT57142.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 301

 Score =  325 bits (834), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 301/301 (100%), Positives = 301/301 (100%)

Query: 1   MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHA 60
           MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHA
Sbjct: 1   MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHA 60

Query: 61  FMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT 120
           FMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT
Sbjct: 61  FMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILT 120

Query: 121 DVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQK 180
           DVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQK
Sbjct: 121 DVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQK 180

Query: 181 LHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGG 240
           LHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGG
Sbjct: 181 LHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGG 240

Query: 241 ERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           ERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP
Sbjct: 241 ERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300

Query: 301 L 301
           L
Sbjct: 301 L 301


>gi|257468654|ref|ZP_05632748.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium ulcerans
           ATCC 49185]
 gi|317062911|ref|ZP_07927396.1| KDO-8-phosphate synthetase [Fusobacterium ulcerans ATCC 49185]
 gi|313688587|gb|EFS25422.1| KDO-8-phosphate synthetase [Fusobacterium ulcerans ATCC 49185]
          Length = 279

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 129/280 (46%), Positives = 185/280 (66%), Gaps = 3/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           ++     + +G     +      RF LIAGPC IES +    +A K+  IC  L I  ++
Sbjct: 2   LVSEVKKVKIG---KNIEIGGNNRFTLIAGPCVIESEELVMEVAGKVKEICDRLGINYIF 58

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG G+++G  I + +K  YG P++TDVH   QC+  A+ VD++QI
Sbjct: 59  KASFDKANRSSIHSYRGPGIEEGLRILKKVKDTYGLPVVTDVHEVWQCKKAAEVVDLIQI 118

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG  +NVKKGQFL+PW+M N++ K+   G  +V+ CERG++FGY
Sbjct: 119 PAFLCRQTDLLIAAAETGLPVNVKKGQFLAPWDMKNVVTKMEESGNPNVMLCERGSTFGY 178

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMR+   M   G PV+FD +H+VQ+PG  G  + G+R+Y+ PL +A +AIG+  I
Sbjct: 179 NNMVVDMRAFMEMRKFGYPVVFDVTHAVQKPGGLGTATSGDREYVYPLMRAGLAIGVDAI 238

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F E H +P+ A SDGPNM+ + DL ++L   + ID ++K 
Sbjct: 239 FAEVHPNPEKAMSDGPNMLYLSDLEEILKMAVKIDDLVKG 278


>gi|253582904|ref|ZP_04860122.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium varium ATCC
           27725]
 gi|251835110|gb|EES63653.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium varium ATCC
           27725]
          Length = 279

 Score =  311 bits (796), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 130/280 (46%), Positives = 185/280 (66%), Gaps = 3/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           ++     + +G     +      RF LIAGPC IES +    +A K+  IC  L I  ++
Sbjct: 2   LVSEVKKVKVG---KNIEIGGNNRFTLIAGPCVIESEELVMEVAGKVKEICDRLGINYIF 58

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG G+++G  I + +K  YG P++TDVH   QC+  A+ VD++QI
Sbjct: 59  KASFDKANRSSIHSYRGPGIEEGLRILKKVKDTYGLPVVTDVHEVWQCKKAAEVVDLIQI 118

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG  +NVKKGQFL+PW+M N++ K+   G  +V+ CERG++FGY
Sbjct: 119 PAFLCRQTDLLIAAAETGLPVNVKKGQFLAPWDMKNVVTKMEESGNPNVMLCERGSTFGY 178

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS   M   G PV+FD +H+VQ+PG  G  + G+R+Y+ PL +A +AIG+  I
Sbjct: 179 NNMVVDMRSFMEMRKFGYPVVFDVTHAVQKPGGLGTATSGDREYVYPLMRAGLAIGVDAI 238

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F E H +P+ A SDGPNM+ + DL ++L   + ID ++K 
Sbjct: 239 FAEVHPNPEKAMSDGPNMLYLSDLEEILKMAVKIDDLVKG 278


>gi|315122220|ref|YP_004062709.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495622|gb|ADR52221.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 281

 Score =  308 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 248/279 (88%), Positives = 261/279 (93%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
           HTN  I LG GK QVTFSN++R VLIAGPCQIES +HAFM+AEKLYAICQSLNIGLVYKS
Sbjct: 3   HTNLEIQLGHGKKQVTFSNQKRLVLIAGPCQIESREHAFMMAEKLYAICQSLNIGLVYKS 62

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSSLAGKRG+GL+KGREIF DLKKKYGFPILTDVHTEQQC+AIADSVDILQIPA
Sbjct: 63  SFDKANRSSLAGKRGIGLEKGREIFLDLKKKYGFPILTDVHTEQQCKAIADSVDILQIPA 122

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            LCRQTDLL AAAQTGRVINVKKGQFLSPWEMHN+LQKLHA+GA DVLFCERGTSFGYN 
Sbjct: 123 FLCRQTDLLIAAAQTGRVINVKKGQFLSPWEMHNVLQKLHANGAMDVLFCERGTSFGYNN 182

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LVTDMRS PIM SMGVPVIFDASHSVQQPGI GNCSGGER++I PLAKAAVAIGIAGIFL
Sbjct: 183 LVTDMRSFPIMASMGVPVIFDASHSVQQPGIRGNCSGGEREFIAPLAKAAVAIGIAGIFL 242

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           ETHQDPDNAPSDGPNMINI DLPKLLSQLL+IDK+IK L
Sbjct: 243 ETHQDPDNAPSDGPNMINIDDLPKLLSQLLSIDKVIKSL 281


>gi|237736450|ref|ZP_04566931.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium mortiferum
           ATCC 9817]
 gi|229421492|gb|EEO36539.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium mortiferum
           ATCC 9817]
          Length = 278

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 134/280 (47%), Positives = 189/280 (67%), Gaps = 3/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M+     + +G    ++     +RF LIAGPC IES +    +A K+  IC  L I  ++
Sbjct: 1   MVDKVRVVKVGD---KIEIGGNKRFALIAGPCVIESEELVMEVAGKIKDICDRLGIQYIF 57

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL+KG EI + +K+KY  P++TDVH   QC+  A+ VDILQI
Sbjct: 58  KASFDKANRSSIHSFRGPGLEKGLEILKKVKEKYNVPVITDVHETWQCKKAAEVVDILQI 117

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG  +N+KKGQFL+PW+M N++ K+     +++L CERG++FGY
Sbjct: 118 PAFLCRQTDLLLAAAETGLPVNIKKGQFLAPWDMKNVVTKMEESNNQNILLCERGSTFGY 177

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS   M   G PV+FD +H+VQ+PG  G  + G+R+Y+ PL +A +AIG+  I
Sbjct: 178 NNMVVDMRSFMEMRKFGYPVVFDVTHAVQRPGGLGTATSGDREYVFPLMRAGLAIGVDAI 237

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F E H +P+ A SDGPNM+ + DL ++L   + ID ++K 
Sbjct: 238 FAEVHPNPNEAKSDGPNMLFLDDLEEILKVAIKIDDLVKG 277


>gi|218462323|ref|ZP_03502414.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium etli Kim 5]
          Length = 281

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 183/277 (66%), Positives = 230/277 (83%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G+ QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYKSS
Sbjct: 5   TNSEVKIGEGEGQVTFSNTGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLGIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+GL+KG ++F DLK+++GFP+LTDVHT +QC  +A+ +D+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGLEKGMQVFADLKREFGFPVLTDVHTAEQCAEVAEVIDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM +MG PVIFDA+HSV QPG  G  SGG+R+++  LA+AAVA GIAG+FLE
Sbjct: 185 VSDMRSLPIMAAMGAPVIFDATHSVAQPGGQGESSGGQREFVETLARAAVATGIAGVFLE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D + K 
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAVAKA 281


>gi|218660788|ref|ZP_03516718.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium etli IE4771]
          Length = 281

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 184/277 (66%), Positives = 230/277 (83%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G+ QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYKSS
Sbjct: 5   TNSEVKIGEGEGQVTFSNTGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLGIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+GL+KG ++F DLK+++GFP+LTDVHT +QC  +A+ +D+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGLEKGMQVFADLKREFGFPVLTDVHTAEQCAEVAEVIDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM +MG PVIFDA+HSV QPG  G  SGG+R+++  LA+AAVA GIAG+FLE
Sbjct: 185 VSDMRSLPIMAAMGAPVIFDATHSVAQPGGQGESSGGQREFVETLARAAVATGIAGVFLE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D I K 
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAIAKA 281


>gi|327189238|gb|EGE56417.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium etli CNPAF512]
          Length = 281

 Score =  302 bits (773), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 184/277 (66%), Positives = 229/277 (82%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G  QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L+IGLVYKSS
Sbjct: 5   TNSEVKIGEGNGQVTFSNTGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLDIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+GL+KG E+F DLKK++GFP+LTDVHT +QC  +A+ +D+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGLEKGMEVFADLKKEFGFPVLTDVHTAEQCAEVAEVIDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM +MG PVIFDA+HSV QPG  G  SGG+R+++  LA+AAVA GIAG+FLE
Sbjct: 185 VSDMRSLPIMAAMGAPVIFDATHSVAQPGGQGESSGGQREFVETLARAAVATGIAGVFLE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           THQDPDNAPSDGPNM+ + D+P+LL +LLA D + K 
Sbjct: 245 THQDPDNAPSDGPNMVYLNDMPRLLEKLLAFDAVAKA 281


>gi|190891624|ref|YP_001978166.1| 3-deoxy-8-phosphooctulonate synthase [Rhizobium etli CIAT 652]
 gi|190696903|gb|ACE90988.1| 3-deoxy-8-phosphooctulonate synthase protein [Rhizobium etli CIAT
           652]
          Length = 281

 Score =  301 bits (772), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 185/277 (66%), Positives = 230/277 (83%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G+ QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYKSS
Sbjct: 5   TNSEVKIGEGEGQVTFSNTGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLGIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+GL+KG E+F DLKK++GFP+LTDVHT +QC  +A+ +D+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGLEKGMEVFADLKKEFGFPVLTDVHTAEQCAEVAEVIDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLKKLNASGNANVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM +MG PVIFDA+HSV QPG  G  SGG+R+++  LA+AAVA GIAG+FLE
Sbjct: 185 VSDMRSLPIMAAMGAPVIFDATHSVAQPGGQGESSGGQREFVETLARAAVATGIAGVFLE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D + K 
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAVAKA 281


>gi|209549199|ref|YP_002281116.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209534955|gb|ACI54890.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 281

 Score =  301 bits (771), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 183/277 (66%), Positives = 228/277 (82%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G  QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYKSS
Sbjct: 5   TNSEVRIGEGAGQVTFSNTGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLGIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+GL+KG ++F DLKK++GFP+LTDVHT +QC  +A  VD+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGLEKGMQVFADLKKEFGFPVLTDVHTAEQCAEVAKVVDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGR +NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAAETGRAVNVKKGQFLAPWDMRNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM SMG PV+FDA+HSV QPG  G+ SGG+R+++  LA+AAVA GIAG+F+E
Sbjct: 185 VSDMRSLPIMASMGAPVVFDATHSVAQPGGQGDSSGGQREFVETLARAAVATGIAGVFVE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D + K 
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAVAKG 281


>gi|86357551|ref|YP_469443.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium etli CFN 42]
 gi|86281653|gb|ABC90716.1| 2-dehydro-3-deoxyphosphooctonate aldolase protein [Rhizobium etli
           CFN 42]
          Length = 281

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 185/277 (66%), Positives = 231/277 (83%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G+ QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L +GLVYKSS
Sbjct: 5   TNSEVKIGEGEGQVTFSNAGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLGVGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+GL+KG E+F DLKK++GFP+LTDVHT +QC  +A+ +D+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGLEKGMEVFADLKKEFGFPVLTDVHTAEQCAEVAEVIDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIMT+MG PVIFDA+HSV QPG  G  SGG+R+++  LA+AAVA GIAG+FLE
Sbjct: 185 VSDMRSLPIMTAMGAPVIFDATHSVAQPGGQGESSGGQREFVETLARAAVATGIAGVFLE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D + K 
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAVAKA 281


>gi|307947117|ref|ZP_07662452.1| 3-deoxy-8-phosphooctulonate synthase [Roseibium sp. TrichSKD4]
 gi|307770781|gb|EFO30007.1| 3-deoxy-8-phosphooctulonate synthase [Roseibium sp. TrichSKD4]
          Length = 280

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 162/278 (58%), Positives = 210/278 (75%), Gaps = 4/278 (1%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N+ +++G     V+FSN   F LIAGPCQ+ES +HA   A  +  I  +L I +V+KS
Sbjct: 3   KPNSVVNVG----NVSFSNTAAFSLIAGPCQMESREHALECAAAVKEIAGNLGIPVVFKS 58

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANR+SL+GKRGVGL     +F D+K++YG P+LTDVH  +QC  +++ VDILQIPA
Sbjct: 59  SFDKANRTSLSGKRGVGLSDALPVFGDIKERYGMPVLTDVHAAEQCAPVSEVVDILQIPA 118

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            LCRQTDLL AAAQTG V+NVKKGQFL+PW+M N+++K+      +VL  ERG SFGYNT
Sbjct: 119 FLCRQTDLLVAAAQTGAVVNVKKGQFLAPWDMKNVMEKVTESSNPNVLLTERGASFGYNT 178

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV+DMR++PIM   G PVIFDA+HSVQQPG  G  SGG+R  +  L++AAVA+G+AG+F+
Sbjct: 179 LVSDMRALPIMAQTGAPVIFDATHSVQQPGGQGTSSGGDRTMVPVLSRAAVAVGVAGLFI 238

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           ETH DPD+APSDGPNM+ +KDL  LLSQL A+D ++K 
Sbjct: 239 ETHPDPDSAPSDGPNMVPLKDLGALLSQLKALDSVVKA 276


>gi|311031991|ref|ZP_07710081.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bacillus sp. m3-13]
          Length = 275

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 132/266 (49%), Positives = 189/266 (71%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
             ++TF     FVLIAGPC IES +     AE+L  I   LNI  ++K+S+DKANRSS+ 
Sbjct: 8   NEEITFGGTNPFVLIAGPCVIESEEVIMETAERLKEITTKLNIPFIFKASYDKANRSSIH 67

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RG GL+ G EI + +K+K+  P+ +D+H   Q E  A+ +DILQIPA LCRQTDLL A
Sbjct: 68  SYRGPGLEDGLEILKKVKEKFNVPVTSDIHDPSQAEKAAEVLDILQIPAFLCRQTDLLVA 127

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
           AA+TG+++NVKKGQFL+PW+M N++ KL     +++L  ERG++FGYN LV DMRS+  M
Sbjct: 128 AAKTGKIVNVKKGQFLAPWDMKNVVTKLKESNNENILLTERGSTFGYNNLVVDMRSLVTM 187

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
             +G PV+FDA+HSVQ PG +G  +GG+R+++  L++AA A+G+  IF+E H +P+ A S
Sbjct: 188 RELGAPVVFDATHSVQIPGGNGTTTGGKREFVPYLSRAAAAVGVDAIFMEVHPNPNEAKS 247

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGPNM+ + +L ++L  ++ ID+ IK
Sbjct: 248 DGPNMVKLDELEEVLKPIIEIDRAIK 273


>gi|317059834|ref|ZP_07924319.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           3_1_5R]
 gi|313685510|gb|EFS22345.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           3_1_5R]
          Length = 288

 Score =  298 bits (763), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 130/279 (46%), Positives = 193/279 (69%), Gaps = 3/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           ++     + +G     V+   ++RF LIAGPC +ES +    +A ++  IC+ L I  ++
Sbjct: 11  IVQDTKVVKVGE---NVSIGGKKRFTLIAGPCVMESQELMLEVAGEINKICKKLGIEYIF 67

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL++G ++ + +K  YG P++TD+H   QCE +A+  D+LQI
Sbjct: 68  KASFDKANRSSIHSYRGPGLEEGLKMLQKVKDTYGIPVVTDIHEPWQCEKVAEVADLLQI 127

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA TG+ +N+KKGQFL+PW+M N++ K+   G + +L CERG++FGY
Sbjct: 128 PAFLCRQTDLLIAAAATGKPVNIKKGQFLAPWDMKNVVVKMEESGNEGILLCERGSTFGY 187

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS+  M   G PV+FD +H+VQ+PG  GN + G+R+Y+ PL +A +AIG+  I
Sbjct: 188 NNMVVDMRSLLEMRKFGYPVVFDVTHAVQKPGGLGNATSGDREYVYPLMRAGLAIGVDAI 247

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F E H +P+ A SDGPNM+ +KDL ++L   + ID ++K
Sbjct: 248 FAEVHPNPEVAKSDGPNMLYLKDLEEILKVAIQIDDLVK 286


>gi|257453302|ref|ZP_05618601.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           3_1_5R]
 gi|257467035|ref|ZP_05631346.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|315918172|ref|ZP_07914412.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|313692047|gb|EFS28882.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 279

 Score =  298 bits (763), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 130/279 (46%), Positives = 193/279 (69%), Gaps = 3/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           ++     + +G     V+   ++RF LIAGPC +ES +    +A ++  IC+ L I  ++
Sbjct: 2   IVQDTKVVKVGE---NVSIGGKKRFTLIAGPCVMESQELMLEVAGEINKICKKLGIEYIF 58

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL++G ++ + +K  YG P++TD+H   QCE +A+  D+LQI
Sbjct: 59  KASFDKANRSSIHSYRGPGLEEGLKMLQKVKDTYGIPVVTDIHEPWQCEKVAEVADLLQI 118

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA TG+ +N+KKGQFL+PW+M N++ K+   G + +L CERG++FGY
Sbjct: 119 PAFLCRQTDLLIAAAATGKPVNIKKGQFLAPWDMKNVVVKMEESGNEGILLCERGSTFGY 178

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS+  M   G PV+FD +H+VQ+PG  GN + G+R+Y+ PL +A +AIG+  I
Sbjct: 179 NNMVVDMRSLLEMRKFGYPVVFDVTHAVQKPGGLGNATSGDREYVYPLMRAGLAIGVDAI 238

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F E H +P+ A SDGPNM+ +KDL ++L   + ID ++K
Sbjct: 239 FAEVHPNPEVAKSDGPNMLYLKDLEEILKVAIQIDDLVK 277


>gi|294785202|ref|ZP_06750490.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 3_1_27]
 gi|294486916|gb|EFG34278.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 3_1_27]
          Length = 286

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 137/292 (46%), Positives = 199/292 (68%), Gaps = 8/292 (2%)

Query: 9   LEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLY 68
           LEE+  ++    +I+    + +G     + F  ++RFVLIAGPC +ES +    +A  + 
Sbjct: 2   LEERWWKM----LINDVNKVKVG----NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIK 53

Query: 69  AICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQC 128
            IC  L I  ++K+SFDKANRSS+   RG GL++G ++    K+K+  P++TDVH   QC
Sbjct: 54  KICDKLGIEYIFKASFDKANRSSIYSYRGPGLEEGMKMLAKTKEKFNVPVITDVHEAWQC 113

Query: 129 EAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKD 188
           + ++   DILQIPA LCRQTDLL AAA+TG+ +N+KKGQFL+PW+M NI+ K+   G K+
Sbjct: 114 KEVSKVADILQIPAFLCRQTDLLIAAAETGKAVNIKKGQFLAPWDMKNIVVKMEEAGNKN 173

Query: 189 VLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPL 248
           ++ CERG++FGYN +V DMRS+  M     PV+FD +HSVQ+PG  G  + G+R+Y+ PL
Sbjct: 174 IMLCERGSTFGYNNMVVDMRSLLEMRKFNYPVVFDVTHSVQKPGGLGTATSGDREYVYPL 233

Query: 249 AKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            +A +AIG+  IF E H +P+ A SDGPNM+ +KDL K+L  ++ IDKI+K 
Sbjct: 234 LRAGLAIGVDAIFAEVHPNPEEAKSDGPNMLYLKDLEKILKTVVEIDKIVKG 285


>gi|257125306|ref|YP_003163420.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptotrichia buccalis
           C-1013-b]
 gi|257049245|gb|ACV38429.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptotrichia buccalis
           C-1013-b]
          Length = 278

 Score =  297 bits (760), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 137/281 (48%), Positives = 190/281 (67%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +I+    + +    +++T  N++   LIAGPC IES D    +A K+  I   L I  ++
Sbjct: 2   LINKVKKVKI---TDKITIGNDK-IFLIAGPCVIESEDLVTEVAGKMKEITDKLGIQYIF 57

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS++  RG GL+KG EI   +K+KYG  + TD+H   QC+  A  +D+LQI
Sbjct: 58  KASFDKANRSSISSFRGPGLEKGLEILSRVKEKYGVALATDIHEPWQCKEAAKVIDLLQI 117

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA L RQTDLL AAA+TG+ +N+KKGQFL+PW+M N+++K    G ++++ CERG SFGY
Sbjct: 118 PAFLSRQTDLLVAAAETGKAVNIKKGQFLAPWDMKNVVKKFEEVGNENIMLCERGASFGY 177

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LV DMR +  M   G PV+FDA+HSVQ PG  G  SGG R Y+ PLA+AAV++G+ G+
Sbjct: 178 NNLVVDMRGLLEMRKFGYPVVFDATHSVQIPGGQGETSGGNRAYVYPLARAAVSVGVDGV 237

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F E H +PD   SDGPNM+ + D+  +L +LL  DK+ K L
Sbjct: 238 FAEVHPEPDKGLSDGPNMLKLDDVENILEKLLQYDKLTKEL 278


>gi|260494181|ref|ZP_05814312.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 3_1_33]
 gi|260198327|gb|EEW95843.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 3_1_33]
          Length = 286

 Score =  297 bits (760), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 138/293 (47%), Positives = 199/293 (67%), Gaps = 8/293 (2%)

Query: 9   LEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLY 68
           LEE+  ++    +I+    + +G     + F  ++RFVLIAGPC +ES +    +A ++ 
Sbjct: 2   LEERWWKM----LINDVNKVKVG----NIVFGGKKRFVLIAGPCVMESQELMDEVAGEIK 53

Query: 69  AICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQC 128
            IC  L I  ++K+SFDKANRSS+   RG GL++G ++    K+K+  P++TDVH   QC
Sbjct: 54  EICDRLGIEYIFKASFDKANRSSIYSYRGPGLEEGMKMLAKTKEKFNIPVITDVHEAWQC 113

Query: 129 EAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKD 188
           + +A   DILQIPA LCRQTDLL AAA+TG+ +N+KKGQFL+PW+M NI+ K+   G K+
Sbjct: 114 KEVAKVADILQIPAFLCRQTDLLIAAAETGKAVNIKKGQFLAPWDMKNIVVKMEESGNKN 173

Query: 189 VLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPL 248
           ++ CERG++FGYN +V DMRS+  M     PVIFD +HSVQ+PG  G  + G+R+Y+ PL
Sbjct: 174 IMLCERGSTFGYNNMVVDMRSLLEMRKFNYPVIFDVTHSVQKPGGLGTATSGDREYVYPL 233

Query: 249 AKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
            +A +AIG+  IF E H +P  A SDGPNM+ +KDL ++L   + IDKI+K +
Sbjct: 234 LRAGLAIGVDAIFAEVHPNPTEAKSDGPNMLYLKDLEEILKTAIEIDKIVKGI 286


>gi|256027899|ref|ZP_05441733.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. D11]
 gi|289765848|ref|ZP_06525226.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. D11]
 gi|289717403|gb|EFD81415.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. D11]
          Length = 278

 Score =  297 bits (760), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 137/281 (48%), Positives = 192/281 (68%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +I     + +G     + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++
Sbjct: 2   LISDVNKVKVG----NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIF 57

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL+KG ++    K+K+  P++TDVH   QCE +A   DILQI
Sbjct: 58  KASFDKANRSSIYSYRGPGLEKGMKMLAKTKEKFNVPVITDVHEAWQCEEVAKVADILQI 117

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG+ IN+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGY
Sbjct: 118 PAFLCRQTDLLIAAAETGKAINIKKGQFLAPWDMKNIVVKMEESGNKNIMLCERGSTFGY 177

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS+  M     PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  I
Sbjct: 178 NNMVVDMRSLLEMRKFNYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAI 237

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F E H +P+ A SDGPNM+ +KDL ++L   + IDKI+K +
Sbjct: 238 FAEVHPNPEEAKSDGPNMLYLKDLEEILKTAIEIDKIVKGI 278


>gi|269119023|ref|YP_003307200.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sebaldella termitidis
           ATCC 33386]
 gi|268612901|gb|ACZ07269.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sebaldella termitidis
           ATCC 33386]
          Length = 281

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 141/278 (50%), Positives = 189/278 (67%), Gaps = 4/278 (1%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +     + +    +++T  N  R  L+AGPC IES D    +A KL  I   L I  V+K
Sbjct: 4   LQKVKEVKI---SDKITIGNS-RITLLAGPCVIESEDLVMEVAAKLKEITDKLGINFVFK 59

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SSFDKANR+S+ G RG G++KG EI   +K+KYG P++TD+H   QCEA A  +DI+QIP
Sbjct: 60  SSFDKANRTSIHGFRGPGIEKGLEILNKVKEKYGVPLVTDIHEPWQCEAAAKVIDIIQIP 119

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDLL AAAQTG+ +NVKKGQFL+PW+M N++ K    G  +++ CERG SFGYN
Sbjct: 120 AFLSRQTDLLVAAAQTGKAVNVKKGQFLAPWDMKNVVSKFEEAGNTNIMLCERGASFGYN 179

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
            LV DMRS+  M   G PV+FDA+HSVQ PG  G+ + G R+Y+ PL KAAV+IG+  +F
Sbjct: 180 NLVVDMRSLLEMRKFGYPVVFDATHSVQIPGGKGSATDGNREYVYPLMKAAVSIGVDAVF 239

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            E H DPD   SDGPNM+ + D+ ++L+ +L ID ++K
Sbjct: 240 AEVHPDPDKGMSDGPNMLRLDDMEEILTNILKIDDLVK 277


>gi|237744235|ref|ZP_04574716.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. 7_1]
 gi|229431464|gb|EEO41676.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. 7_1]
          Length = 286

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 139/293 (47%), Positives = 197/293 (67%), Gaps = 8/293 (2%)

Query: 9   LEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLY 68
           LEE+  ++    +I     + +G     + F  ++RFVLIAGPC +ES +    +A  + 
Sbjct: 2   LEERWWKM----LISDVNKVKVG----NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIK 53

Query: 69  AICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQC 128
            IC  L I  ++K+SFDKANRSS+   RG GL+KG ++    K+K+  P++TDVH   QC
Sbjct: 54  EICDRLGIEYIFKASFDKANRSSIYSYRGPGLEKGMKMLAKTKEKFNVPVITDVHEAWQC 113

Query: 129 EAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKD 188
           + +A   DILQIPA LCRQTDLL AAA+TG+ IN+KKGQFL+PW+M NI+ K+   G K+
Sbjct: 114 KEVAKVADILQIPAFLCRQTDLLIAAAETGKAINIKKGQFLAPWDMKNIVVKMEESGNKN 173

Query: 189 VLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPL 248
           ++ CERG++FGYN +V DMRS+  M     PV+FD +HSVQ+PG  G  + G+R+Y+ PL
Sbjct: 174 IMLCERGSTFGYNNMVVDMRSLLEMRKFNYPVVFDVTHSVQKPGGLGTATSGDREYVYPL 233

Query: 249 AKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
            +A +AIG+  IF E H +P  A SDGPNM+ +KDL ++L   + IDKI+K +
Sbjct: 234 LRAGLAIGVDAIFAEVHPNPAEAKSDGPNMLYLKDLEEILKTAIEIDKIVKGI 286


>gi|256845497|ref|ZP_05550955.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 3_1_36A2]
 gi|256719056|gb|EEU32611.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 3_1_36A2]
          Length = 286

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 134/292 (45%), Positives = 197/292 (67%), Gaps = 8/292 (2%)

Query: 9   LEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLY 68
           LEE+  ++    +I+    + +      + F  ++RFVLIAGPC +ES +    +A  + 
Sbjct: 2   LEERWWKM----LINDVNKVKV----ENIVFGGKKRFVLIAGPCVMESQELMDEVAGGIK 53

Query: 69  AICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQC 128
            IC  L I  ++K+SFDKANRSS+   RG GL++G ++    K+K+  P++TDVH   QC
Sbjct: 54  EICDKLGIEYIFKASFDKANRSSIYSYRGPGLEEGMKMLAKTKEKFNVPVITDVHEAWQC 113

Query: 129 EAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKD 188
           + ++   DILQIPA LCRQTDLL AAA+TG+ +N+KKGQFL+PW+M NI+ K+   G K+
Sbjct: 114 KEVSKVADILQIPAFLCRQTDLLIAAAETGKAVNIKKGQFLAPWDMKNIVVKMEESGNKN 173

Query: 189 VLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPL 248
           ++ CERG++FGYN +V DMRS+  M     PV+FD +HSVQ+PG  G  + G+R+Y+ PL
Sbjct: 174 IMLCERGSTFGYNNMVVDMRSLLEMRKFNYPVVFDVTHSVQKPGGLGTATSGDREYVYPL 233

Query: 249 AKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            +A +A+G+  IF E H +P+ A SDGPNM+ +KDL ++L   + IDKI+K 
Sbjct: 234 LRAGLAVGVDAIFAEVHPNPEEAKSDGPNMLYLKDLEEILKTAIEIDKIVKG 285


>gi|34762974|ref|ZP_00143952.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
 gi|27887362|gb|EAA24454.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
          Length = 278

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 133/280 (47%), Positives = 191/280 (68%), Gaps = 4/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +I+    + +G     + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++
Sbjct: 2   LINDVNKVKVG----NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDKLGIEYIF 57

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL++G ++    K+K+  P++TDVH   QC+ ++   DILQI
Sbjct: 58  KASFDKANRSSIYSYRGPGLEEGMKMLAKTKEKFNVPVITDVHEAWQCKEVSKVADILQI 117

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG+ +N+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGY
Sbjct: 118 PAFLCRQTDLLIAAAETGKAVNIKKGQFLAPWDMKNIVVKMEESGNKNIMLCERGSTFGY 177

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS+  M     PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  I
Sbjct: 178 NNMVVDMRSLLEMRKFNYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAI 237

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F E H +P  A SDGPNM+ +KDL ++L   + IDKI+K 
Sbjct: 238 FAEVHPNPAEAKSDGPNMLYLKDLEEILKTAIEIDKIVKG 277


>gi|302392915|ref|YP_003828735.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acetohalobium arabaticum
           DSM 5501]
 gi|302204992|gb|ADL13670.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acetohalobium arabaticum
           DSM 5501]
          Length = 275

 Score =  295 bits (755), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 133/267 (49%), Positives = 187/267 (70%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
             ++ F N++ FVL+AGPC IES + +  +AE +  I   L I  V+KSS+DKANRSS+ 
Sbjct: 8   NEEIKFGNQRPFVLLAGPCAIESEERSLKVAEGIKEITDRLGIPYVFKSSYDKANRSSID 67

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RG GL++G +I   +K+++  P+L+DVHT ++ E  AD +DI+QIPA L RQTDL+TA
Sbjct: 68  SYRGPGLEEGLKILEKVKREFDLPVLSDVHTAEEAEYAADVLDIMQIPAFLSRQTDLVTA 127

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
              TGRV+NVKKGQFL+PW++  +++K+ +   + +L  ERG SFGYN LV DMRS+P M
Sbjct: 128 VGATGRVVNVKKGQFLAPWDIEQVVEKIESTNNQRILLTERGASFGYNNLVVDMRSLPRM 187

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
              G PV+FDA+HSVQ PG  G+ SGGER+Y+  LA+AA   GI  +F+E H  P+ A  
Sbjct: 188 RETGYPVVFDATHSVQLPGGAGDRSGGEREYVPHLARAAAGAGIDALFMEVHDRPEEALC 247

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGPNM+ + DL  +L ++ AID+I+K 
Sbjct: 248 DGPNMVRLDDLEDILRKIQAIDEIVKE 274


>gi|310779337|ref|YP_003967670.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ilyobacter polytropus
           DSM 2926]
 gi|309748660|gb|ADO83322.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ilyobacter polytropus
           DSM 2926]
          Length = 280

 Score =  295 bits (755), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 138/281 (49%), Positives = 192/281 (68%), Gaps = 3/281 (1%)

Query: 20  HMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLV 79
            +++  + I +G    +     + RF LIAGPC IES + +  +A+K+  IC+SL I  +
Sbjct: 2   SIVNEVSKIKIGE---KFDIGGKNRFTLIAGPCAIESEEMSLRVAKKIKDICESLEIDYI 58

Query: 80  YKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQ 139
           +KSS+DKANRSS+   RG+G++KG  I + ++++ G P++TD+H   Q    A  VD+LQ
Sbjct: 59  FKSSYDKANRSSVFSARGIGMEKGLNILKKVREEVGVPVITDIHEPWQAAEAAKFVDMLQ 118

Query: 140 IPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFG 199
           IPA LCRQTDL+ AAA+TG  +NVKKGQFL+PW+  NI+ K    G   +L CERGT+FG
Sbjct: 119 IPAFLCRQTDLIVAAAKTGLPVNVKKGQFLAPWDAKNIVTKFEEVGNNKLLLCERGTTFG 178

Query: 200 YNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
           YN  V DMRS   M   G PV+FDA+HSVQ PG  G C+GG R+Y+ PL +AA+A+G+  
Sbjct: 179 YNNFVVDMRSFLEMRKFGYPVVFDATHSVQIPGGQGTCTGGNREYVFPLMRAALAVGVDA 238

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           IF E H+DPDNAP DGPNM+ ++DL ++L   + ID I+K 
Sbjct: 239 IFAEVHEDPDNAPCDGPNMLKLEDLEEILKAAIEIDDIVKK 279


>gi|294782938|ref|ZP_06748264.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 1_1_41FAA]
 gi|294481579|gb|EFG29354.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium sp. 1_1_41FAA]
          Length = 278

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 134/280 (47%), Positives = 192/280 (68%), Gaps = 4/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +I+    + +G     + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++
Sbjct: 2   LINDVNKVKVG----NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIF 57

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL++G ++    K+K+  P++TDVH   QC+ +A  VDILQI
Sbjct: 58  KASFDKANRSSIHSYRGPGLEEGMKMLAKTKEKFNVPVITDVHEAWQCKEVAKVVDILQI 117

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG+ +N+KKGQFL+PW+M NI+ K+   G ++++ CERG++FGY
Sbjct: 118 PAFLCRQTDLLIAAAETGKAVNIKKGQFLAPWDMKNIVVKMEESGNQNIMLCERGSTFGY 177

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS+  M     PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  I
Sbjct: 178 NNMVVDMRSLLEMRKFNYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAI 237

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F E H +P  A SDGPNM+ +KDL ++L   + IDKI+K 
Sbjct: 238 FAEVHPNPTEAKSDGPNMLYLKDLEEILKTAIEIDKIVKG 277


>gi|260889985|ref|ZP_05901248.1| 3-deoxy-8-phosphooctulonate synthase [Leptotrichia hofstadii F0254]
 gi|260860591|gb|EEX75091.1| 3-deoxy-8-phosphooctulonate synthase [Leptotrichia hofstadii F0254]
          Length = 278

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 136/281 (48%), Positives = 189/281 (67%), Gaps = 4/281 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +I     + +    + +T  N++   LIAGPC IES D    +A K+  I   L I  V+
Sbjct: 2   LIDKVKKVKI---TDNITIGNDK-IFLIAGPCVIESEDLVMEVAAKMKYITDKLGIQYVF 57

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS++  RG GL+KG EI   +K+KYG  + TD+H   QC+  +  +D+LQI
Sbjct: 58  KASFDKANRSSISSFRGPGLEKGLEILARVKEKYGVALATDIHEPWQCKEASKVIDLLQI 117

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA L RQTDLL AAA+TG+ +N+KKGQFL+PW+M N+++K    G ++++ CERG SFGY
Sbjct: 118 PAFLSRQTDLLVAAAETGKAVNIKKGQFLAPWDMKNVVRKFEEVGNENIMLCERGASFGY 177

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LV DMR +  M   G PV+FDA+HSVQ PG  G  SGG R Y+ PLA+AAV++GI G+
Sbjct: 178 NNLVVDMRGLLEMRKFGYPVVFDATHSVQIPGGQGETSGGNRAYVYPLARAAVSVGIDGV 237

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           F E H +P+   SDGPNM+ + ++  +L++LL  DK+ K L
Sbjct: 238 FAEVHPEPEKGLSDGPNMLKLDNVEDILTKLLQYDKLTKEL 278


>gi|262067015|ref|ZP_06026627.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium periodonticum
           ATCC 33693]
 gi|291379275|gb|EFE86793.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium periodonticum
           ATCC 33693]
          Length = 278

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 133/280 (47%), Positives = 191/280 (68%), Gaps = 4/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +I+    + +G     + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++
Sbjct: 2   LINDVNKVKVG----NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIF 57

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL++G ++    K+K+  P++TDVH   QC+ +A   DILQI
Sbjct: 58  KASFDKANRSSIHSYRGPGLEEGMKMLAKTKEKFNLPVITDVHEAWQCKEVAKVADILQI 117

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG+ +N+KKGQFL+PW+M NI+ K+   G ++++ CERG++FGY
Sbjct: 118 PAFLCRQTDLLIAAAETGKAVNIKKGQFLAPWDMKNIVVKMEESGNQNIMLCERGSTFGY 177

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS+  M     PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  I
Sbjct: 178 NNMVVDMRSLLEMRKFNYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAI 237

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F E H +P  A SDGPNM+ +KDL ++L   + IDKI+K 
Sbjct: 238 FAEVHPNPTEAKSDGPNMLYLKDLEEILKTAIEIDKIVKG 277


>gi|262277256|ref|ZP_06055049.1| 3-deoxy-8-phosphooctulonate synthase [alpha proteobacterium
           HIMB114]
 gi|262224359|gb|EEY74818.1| 3-deoxy-8-phosphooctulonate synthase [alpha proteobacterium
           HIMB114]
          Length = 276

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 146/265 (55%), Positives = 199/265 (75%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N+   SN+  F LI+GPCQ+E+ DHA  +AE++  I   L I LVYK+SFDKANR+SL  
Sbjct: 8   NKFNVSNDLPFFLISGPCQLENRDHAMFMAEEIKKITDKLKINLVYKTSFDKANRTSLKS 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           +RG+GL K  ++F ++K+ +  PILTDVH+ +QC  + + VDI+QIPA LCRQTDLL +A
Sbjct: 68  ERGIGLDKSIKVFEEIKRNFNLPILTDVHSPEQCNQVKNVVDIIQIPAFLCRQTDLLVSA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  ++N+KKGQFL+PW+M N+++K+      ++L  ERG SFGYNTLV+DMRSI I+ 
Sbjct: 128 AKTNLIVNIKKGQFLAPWDMKNVIKKISDSNNDNILVTERGVSFGYNTLVSDMRSISILK 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PVIFDA+HSVQQPG  G+ SGGER++I  L+KAA+A+G+AG+FLE H DPDNAPSD
Sbjct: 188 KEQYPVIFDATHSVQQPGGKGDSSGGEREFIYDLSKAAIAVGVAGLFLEVHDDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ + DL   L+ +  ID ++K
Sbjct: 248 GPNMLKLSDLENFLNNIKKIDDLVK 272


>gi|254302925|ref|ZP_04970283.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
 gi|148323117|gb|EDK88367.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
          Length = 295

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 138/292 (47%), Positives = 197/292 (67%), Gaps = 8/292 (2%)

Query: 9   LEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLY 68
           LEE+  ++    +I+    + +G     + F  ++RFVLIAGPC +ES +    +A  + 
Sbjct: 11  LEERWWKM----LINDVNKVKVG----NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIK 62

Query: 69  AICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQC 128
            IC  L I  ++K+SFDKANRSS+   RG GL++G ++    K+K+  P++TDVH   QC
Sbjct: 63  EICDRLGIEYIFKASFDKANRSSIHSYRGPGLEEGMKMLAKTKEKFNVPVITDVHEAWQC 122

Query: 129 EAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKD 188
           + +A   DILQIPA LCRQTDLL AAA+TG+ IN+KKGQFL+PW+M NI+ K+   G K+
Sbjct: 123 KEVAKVADILQIPAFLCRQTDLLIAAAETGKAINIKKGQFLAPWDMKNIVVKMEESGNKN 182

Query: 189 VLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPL 248
           ++ CERG++FGYN +V DMRS+  M     PV+FD +HSVQ+PG  G  + G+R+Y+ PL
Sbjct: 183 IMLCERGSTFGYNNMVVDMRSLLEMRKFNYPVVFDVTHSVQKPGGLGTATSGDREYVYPL 242

Query: 249 AKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            +A +AIG+  IF E H +P  A SDGPNM+ +KDL ++L   + IDKI+K 
Sbjct: 243 LRAGLAIGVDAIFAEVHPNPTEAKSDGPNMLYLKDLEEILKTAIEIDKIVKG 294


>gi|237739967|ref|ZP_04570448.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           2_1_31]
 gi|229421984|gb|EEO37031.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           2_1_31]
          Length = 278

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 133/280 (47%), Positives = 190/280 (67%), Gaps = 4/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +I+    + +G     + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++
Sbjct: 2   LINDVNKVKVG----NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIF 57

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL++G ++    K+K+   ++TDVH   QC+ +A   DILQI
Sbjct: 58  KASFDKANRSSIHSYRGPGLEEGMKMLAKTKEKFNVSVITDVHEAWQCKEVAKVADILQI 117

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG+ +N+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGY
Sbjct: 118 PAFLCRQTDLLIAAAETGKAVNIKKGQFLAPWDMKNIVVKMEESGNKNIMLCERGSTFGY 177

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS+  M     PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  I
Sbjct: 178 NNMVVDMRSLLEMRKFNYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAI 237

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F E H +P  A SDGPNM+ +KDL ++L   + IDKI+K 
Sbjct: 238 FAEVHPNPTEAKSDGPNMLYLKDLEEILKTAIEIDKIVKG 277


>gi|257463927|ref|ZP_05628312.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. D12]
 gi|317061453|ref|ZP_07925938.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. D12]
 gi|313687129|gb|EFS23964.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp. D12]
          Length = 278

 Score =  293 bits (749), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 129/279 (46%), Positives = 190/279 (68%), Gaps = 3/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           MI     + +G     +T   ++RF LIAGPC +ES +    +A ++ A+C+ L I  ++
Sbjct: 1   MIQDTKVVKVGE---NITIGGKKRFTLIAGPCVMESQELMLEVAGEISALCKKLGIDYIF 57

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL++G ++ + +K  Y  P++TD+H   QCE +A   D+LQI
Sbjct: 58  KASFDKANRSSIHSYRGPGLEEGLKMLQKVKDTYRVPVVTDIHEPWQCEKVAQVADLLQI 117

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA TG+ +N+KKGQFL+PW+M N++ K+   G + +L CERG++FGY
Sbjct: 118 PAFLCRQTDLLIAAAATGKPVNIKKGQFLAPWDMKNVVVKMEESGNEGILLCERGSTFGY 177

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS+  M   G PV+FD +H+VQ+PG  G  + G+R+Y+ PL +A +A+G+  I
Sbjct: 178 NNMVVDMRSLLEMRKFGYPVVFDVTHAVQKPGGLGTATSGDREYVYPLMRAGLAVGVDAI 237

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F E H +P+ A SDGPNM+ +KDL  +L   + ID ++K
Sbjct: 238 FAEVHPNPEVAKSDGPNMLYLKDLEDILKVAIQIDDLVK 276


>gi|19704559|ref|NP_604121.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
 gi|19714847|gb|AAL95420.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
          Length = 286

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 134/280 (47%), Positives = 191/280 (68%), Gaps = 4/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +I+    + +G     + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++
Sbjct: 10  LINDVNKVKVG----NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIF 65

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL++G ++   +K+K+  P++TDVH   QC+ +A   DILQI
Sbjct: 66  KASFDKANRSSIYSYRGPGLEEGMKMLTKIKEKFNVPVITDVHEAWQCKEVAKVADILQI 125

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG+ +N+KKGQFL+PW+M NI+ K+     K+++ CERG++FGY
Sbjct: 126 PAFLCRQTDLLIAAAETGKAVNIKKGQFLAPWDMKNIVVKMEESRNKNIMLCERGSTFGY 185

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS+  M     PVIFD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  I
Sbjct: 186 NNMVVDMRSLLEMRKFNYPVIFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAI 245

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F E H +P  A SDGPNM+ +KDL ++L   + IDKI+K 
Sbjct: 246 FAEVHPNPAEAKSDGPNMLYLKDLEEILKIAIEIDKIVKG 285


>gi|37999953|sp|Q8RE91|KDSA_FUSNN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
          Length = 278

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 134/280 (47%), Positives = 191/280 (68%), Gaps = 4/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +I+    + +G     + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++
Sbjct: 2   LINDVNKVKVG----NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIF 57

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL++G ++   +K+K+  P++TDVH   QC+ +A   DILQI
Sbjct: 58  KASFDKANRSSIYSYRGPGLEEGMKMLTKIKEKFNVPVITDVHEAWQCKEVAKVADILQI 117

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG+ +N+KKGQFL+PW+M NI+ K+     K+++ CERG++FGY
Sbjct: 118 PAFLCRQTDLLIAAAETGKAVNIKKGQFLAPWDMKNIVVKMEESRNKNIMLCERGSTFGY 177

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N +V DMRS+  M     PVIFD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  I
Sbjct: 178 NNMVVDMRSLLEMRKFNYPVIFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAI 237

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F E H +P  A SDGPNM+ +KDL ++L   + IDKI+K 
Sbjct: 238 FAEVHPNPAEAKSDGPNMLYLKDLEEILKIAIEIDKIVKG 277


>gi|160871707|ref|ZP_02061839.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsiella grylli]
 gi|159120506|gb|EDP45844.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsiella grylli]
          Length = 277

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 132/265 (49%), Positives = 172/265 (64%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q   LIAGPC +ES   A   A  L  I  SLNI  +YKSSFDKANRSS+   
Sbjct: 5   NFEVGLDQPLFLIAGPCVVESEQLAMDTAGSLKEITDSLNIPFIYKSSFDKANRSSVRSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+GL +G  I  ++KK+ G  ILTDVH +     ++  VD+LQ PA LCRQT+ +   A
Sbjct: 65  RGLGLTEGLRILDNVKKQLGVAILTDVHEDTPLNEVSHVVDVLQTPAFLCRQTNFIQKVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G  +N+KKGQFLSPWEMH +++K        ++ CERG +FGYN L++DMRS+ IM  
Sbjct: 125 EQGLPVNIKKGQFLSPWEMHYVVEKARQVSDALIMVCERGVTFGYNNLISDMRSLAIMRK 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PVIFDA+HSVQ PG H   SGG+R++I  LA+AAVA GI+G+F+ETH  P+ A SDG
Sbjct: 185 THCPVIFDATHSVQLPGSHAGVSGGQREFIPVLARAAVAAGISGLFMETHPKPEKALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + KLL  L A+DK +K 
Sbjct: 245 PNSWPLNKMAKLLETLQALDKAVKK 269


>gi|296327806|ref|ZP_06870344.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium nucleatum
           subsp. nucleatum ATCC 23726]
 gi|296155062|gb|EFG95841.1| 3-deoxy-8-phosphooctulonate synthase [Fusobacterium nucleatum
           subsp. nucleatum ATCC 23726]
          Length = 295

 Score =  292 bits (747), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 134/292 (45%), Positives = 194/292 (66%), Gaps = 8/292 (2%)

Query: 13  QRRIDKNHM----IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLY 68
           + ++ +       I+    + +G     + F  ++RFVLIAGPC +ES +    +A  + 
Sbjct: 7   EEKLSEERWWKMLINDINKVKVG----NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIK 62

Query: 69  AICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQC 128
            IC  L I  ++K+SFDKANRSS+   RG GL++G ++   +K+K+  P++TDVH   QC
Sbjct: 63  EICDRLGIEYIFKASFDKANRSSIYSYRGPGLEEGMKMLTKIKEKFNVPVITDVHEAWQC 122

Query: 129 EAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKD 188
           + +A   DILQIPA LCRQTDLL AAA+TG+ +N+KKGQFL+PW+M NI+ K+     K+
Sbjct: 123 KEVAKVADILQIPAFLCRQTDLLIAAAETGKAVNIKKGQFLAPWDMKNIVVKMEESRNKN 182

Query: 189 VLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPL 248
           ++ CERG++FGYN +V DMRS+  M     PVIFD +HSVQ+PG  G  + G+R+Y+ PL
Sbjct: 183 IMLCERGSTFGYNNMVVDMRSLLEMRKFNYPVIFDVTHSVQKPGGLGTATSGDREYVYPL 242

Query: 249 AKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            +A +AIG+  IF E H +P  A SDGPNM+ +KDL ++L   + IDKI+K 
Sbjct: 243 LRAGLAIGVDAIFAEVHPNPAEAKSDGPNMLYLKDLEEILKIAIEIDKIVKG 294


>gi|239832022|ref|ZP_04680351.1| 3-deoxy-8-phosphooctulonate synthase [Ochrobactrum intermedium LMG
           3301]
 gi|239824289|gb|EEQ95857.1| 3-deoxy-8-phosphooctulonate synthase [Ochrobactrum intermedium LMG
           3301]
          Length = 277

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 170/278 (61%), Positives = 220/278 (79%), Gaps = 4/278 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
            N+++ +G     VTFSN   F LIAGPCQ+E+ +HAF +A +L  +   L IGLVYKSS
Sbjct: 4   ANSSVKIG----NVTFSNSAPFALIAGPCQMETREHAFEMAGRLKEMTDKLGIGLVYKSS 59

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL  +RG+GL+K  E+F DLKK++GFP+LTD+HTE QC  +A  VD+LQIPA 
Sbjct: 60  FDKANRTSLKAERGIGLEKALEVFADLKKEFGFPVLTDIHTEGQCAEVAPVVDVLQIPAF 119

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGYNTL
Sbjct: 120 LCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLSKITESGNPNVLATERGVSFGYNTL 179

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM ++G PV+FDA+HSVQQPG  G  SGG+R+++  L++AAVA+G+AG+F+E
Sbjct: 180 VSDMRSLPIMAALGSPVVFDATHSVQQPGGQGGSSGGQREFVETLSRAAVAVGVAGLFIE 239

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           THQDPDNAPSDGPNM+ +  +P LL +L+A D+I K L
Sbjct: 240 THQDPDNAPSDGPNMVPVDKMPTLLEKLMAFDRIAKGL 277


>gi|237742226|ref|ZP_04572707.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           4_1_13]
 gi|229429874|gb|EEO40086.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Fusobacterium sp.
           4_1_13]
          Length = 278

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 133/264 (50%), Positives = 185/264 (70%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            + F  ++RFVLIAGPC +ES +    +A  +  IC  L I  ++K+SFDKANRSS+   
Sbjct: 13  NIVFGGKKRFVLIAGPCVMESQELMDEVAGGIKEICDKLGIEYIFKASFDKANRSSIYSY 72

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++    K+KY  P++TDVH   QC+ +A   DILQIPA LCRQTDLL AAA
Sbjct: 73  RGPGLEEGMKMLAKTKEKYNVPVITDVHEAWQCKEVAKVADILQIPAFLCRQTDLLIAAA 132

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +N+KKGQFL+PW+M NI+ K+   G K+++ CERG++FGYN +V DMRS+  M  
Sbjct: 133 ETGKAVNIKKGQFLAPWDMKNIVVKMEESGNKNIMLCERGSTFGYNNMVVDMRSLLEMRK 192

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FD +HSVQ+PG  G  + G+R+Y+ PL +A +AIG+  IF E H +P  A SDG
Sbjct: 193 FNYPVVFDVTHSVQKPGGLGTATSGDREYVYPLLRAGLAIGVDAIFAEVHPNPAEAKSDG 252

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +KDL ++L   + IDKI+K
Sbjct: 253 PNMLYLKDLEEILKTAIEIDKIVK 276


>gi|254497574|ref|ZP_05110362.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella drancourtii
           LLAP12]
 gi|254353190|gb|EET11937.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella drancourtii
           LLAP12]
          Length = 274

 Score =  291 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 130/265 (49%), Positives = 174/265 (65%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++   LIAGPC IES + A   A  L  +C  LNI  +YKSSFDKANRSSL+  
Sbjct: 5   GFEVGLDKPLFLIAGPCVIESEELALETAGYLKELCGQLNIPFIYKSSFDKANRSSLSSY 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G +KG  I   +K + G P+LTDVH +     ++  VD+LQ PA LCRQT+ +   A
Sbjct: 65  RGPGFEKGLAILEKVKAQIGVPVLTDVHEDTPLVEVSSVVDVLQTPAFLCRQTNFIQKVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
              + +N+KKGQFL+PWEM +++ K  A G + ++ CERG SFGYN LV+DMRS+ IM  
Sbjct: 125 AMNKPVNIKKGQFLAPWEMKHVITKAKASGNEQIMACERGVSFGYNNLVSDMRSLAIMRE 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              P+++DA+HSVQ PG +   SGG+R++I  LA+AAVA GI+GIF+ETH DPD A SDG
Sbjct: 185 TECPIVYDATHSVQLPGGNNGVSGGQREFIPVLARAAVAAGISGIFMETHPDPDKALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + +LL  L+AID + K 
Sbjct: 245 PNSWPLDKMKQLLESLIAIDAVYKK 269


>gi|270157221|ref|ZP_06185878.1| 3-deoxy-8-phosphooctulonate synthase [Legionella longbeachae
           D-4968]
 gi|289164381|ref|YP_003454519.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) [Legionella longbeachae NSW150]
 gi|269989246|gb|EEZ95500.1| 3-deoxy-8-phosphooctulonate synthase [Legionella longbeachae
           D-4968]
 gi|288857554|emb|CBJ11392.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) [Legionella longbeachae NSW150]
          Length = 277

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 128/265 (48%), Positives = 170/265 (64%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  +   LIAGPC IES + A   A  L  IC  L I  +YKSSFDKANRSS++  
Sbjct: 5   GFEVGLSKPLFLIAGPCVIESEELALETAGYLKEICSELQIPFIYKSSFDKANRSSISSY 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G +KG  I   +KK+   P+LTDVH +     ++  VD+LQ PA LCRQT+ +   A
Sbjct: 65  RGPGFEKGLSILEKVKKQVDVPVLTDVHEDTPLLEVSSVVDVLQTPAFLCRQTNFIQKVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
              + +N+KKGQFL+PWEM +++ K  A G   ++ CERG SFGYN LV+DMRS+ IM  
Sbjct: 125 AMNKPVNIKKGQFLAPWEMKHVIAKAKATGNDQIMACERGVSFGYNNLVSDMRSLAIMRE 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV++DA+HSVQ PG +   SGG+R+++  LA+AAVA GI+G+F+ETH DPD A SDG
Sbjct: 185 TGCPVVYDATHSVQLPGGNNGASGGQREFVPILARAAVAAGISGLFMETHPDPDKALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  +  LL  L A+D + K 
Sbjct: 245 PNSWPLAQMKPLLESLKALDSVYKK 269


>gi|258542322|ref|YP_003187755.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633400|dbj|BAH99375.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636459|dbj|BAI02428.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639512|dbj|BAI05474.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642568|dbj|BAI08523.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645623|dbj|BAI11571.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648676|dbj|BAI14617.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651729|dbj|BAI17663.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654720|dbj|BAI20647.1| 3-deoxy-8-phosphooctulonate synthase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 277

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 150/266 (56%), Positives = 195/266 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +   N+Q FVLIAGPCQIES  HA   A  L  ICQ   IGL+YKSSFDKANR+S++ 
Sbjct: 12  GSLYIGNDQPFVLIAGPCQIESAAHAMETATALKEICQKAGIGLIYKSSFDKANRTSISS 71

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G+ +G +I  +++     P+LTDVH  +QC  +A++VD+LQIPA LCRQTDLL AA
Sbjct: 72  ARGIGMAEGLDILANVRNTLDIPVLTDVHAPEQCAPVAEAVDVLQIPAFLCRQTDLLLAA 131

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG  +NVKKGQFL+PW+M ++  K+ + G   ++ CERGTSFGYNTLV DMR +PIM 
Sbjct: 132 GKTGAAVNVKKGQFLAPWDMKHVAAKIASTGNNRIMLCERGTSFGYNTLVNDMRGLPIMA 191

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G  SGG+R++   L++AA+AIG+A +F+ETH++PD APSD
Sbjct: 192 QTGYPVVFDATHSVQQPGGLGGASGGQREFAPVLSRAALAIGVASLFIETHENPDQAPSD 251

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNM+ IK LP LL Q   ID +IK 
Sbjct: 252 GPNMLPIKTLPALLEQFKQIDALIKG 277


>gi|54294127|ref|YP_126542.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella pneumophila
           str. Lens]
 gi|59798136|sp|Q5WXA7|KDSA_LEGPL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|53753959|emb|CAH15430.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) [Legionella pneumophila str. Lens]
          Length = 274

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 130/265 (49%), Positives = 176/265 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++   LIAGPC IES + A   A  L  +C  LNI  +YKSSFDKANRSS++  
Sbjct: 5   GFEAGLDKPLFLIAGPCVIESEELALETAGYLKEMCSQLNIPFIYKSSFDKANRSSISSY 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G +KG  I   +K + G P+LTDVH +     ++  VD+LQ PA LCRQT+ +   A
Sbjct: 65  RGPGFEKGLSILEKVKSQIGVPVLTDVHEDTPLFEVSSVVDVLQTPAFLCRQTNFIQKVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
              + +N+KKGQFL+PWEM +++ K  A G + ++ CERG SFGYN LV+DMRS+ IM  
Sbjct: 125 AMNKPVNIKKGQFLAPWEMKHVIAKAKAQGNEQIMACERGVSFGYNNLVSDMRSLVIMRE 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV++DA+HSVQ PG +   SGG+R++I  LA+AAVA+GI+G+F+ETH DPDNA SDG
Sbjct: 185 TGCPVVYDATHSVQLPGGNNGVSGGQREFIPALARAAVAVGISGLFMETHPDPDNALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + +LL  L A D++ K 
Sbjct: 245 PNSWPLDKMKQLLESLKAADEVYKK 269


>gi|254443166|ref|ZP_05056642.1| 3-deoxy-8-phosphooctulonate synthase [Verrucomicrobiae bacterium
           DG1235]
 gi|198257474|gb|EDY81782.1| 3-deoxy-8-phosphooctulonate synthase [Verrucomicrobiae bacterium
           DG1235]
          Length = 280

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 126/277 (45%), Positives = 176/277 (63%), Gaps = 4/277 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
            +  I +G     +   NE  F L+AG   +ES D A  IA +   +   L I  ++K+S
Sbjct: 1   MSKVIEIG----NIKCGNELPFTLLAGMNVLESRDLALEIASEYKRVTDKLGIPYIFKAS 56

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G++KG EI  ++K+ +G P++TDVH   Q  A+A+  DI+Q+PA 
Sbjct: 57  FDKANRSSVTSFRGPGMEKGLEIMAEIKETFGVPLITDVHEPYQAAAVAEVCDIIQLPAF 116

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG ++NVKK QFL+P EM +I++KL+  G   ++ CERG+SFGYN L
Sbjct: 117 LSRQTDLVVAMAKTGAIVNVKKAQFLAPREMGHIIKKLNEAGNDKIMLCERGSSFGYNNL 176

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM  I  M   G PVIFD +HS+Q PG     +GG R+ +  LAKA +A+G+AG+FLE
Sbjct: 177 VVDMLGIATMKEFGYPVIFDVTHSLQIPGGTATAAGGRRRQVCDLAKAGMAVGLAGLFLE 236

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            H DP+NA  DGP  + +  L   L Q+  ID ++K 
Sbjct: 237 AHPDPENAKCDGPCALPLNRLEGFLEQMKQIDDLVKS 273


>gi|91792285|ref|YP_561936.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella denitrificans
           OS217]
 gi|122968926|sp|Q12QR3|KDSA_SHEDO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|91714287|gb|ABE54213.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella denitrificans
           OS217]
          Length = 286

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 125/278 (44%), Positives = 179/278 (64%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                I+L +    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+
Sbjct: 1   MDQKMINLATEAGAIEIANDKPFVLFGGMNVLESRDLAMSIAEHYVEVTQKLGIPYVFKA 60

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF ++K+ +  P++TDVH   QC  +A+ VDI+Q+PA
Sbjct: 61  SFDKANRSSVNSYRGPGMEEGLKIFEEIKRTFNVPLITDVHEVHQCAPVAEVVDIIQLPA 120

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G   ++ CERG+SFGYN 
Sbjct: 121 FLARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIVTKFNEAGNDKIILCERGSSFGYNN 180

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+GIAG+F+
Sbjct: 181 LVVDMLGMDDMKKTGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGIAGLFI 240

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           E H DPDNA  DGP  + +  L   L Q+ A+D ++K 
Sbjct: 241 EAHPDPDNAKCDGPCALPLHQLENYLKQMKAVDDLVKS 278


>gi|269797606|ref|YP_003311506.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Veillonella parvula DSM
           2008]
 gi|269094235|gb|ACZ24226.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Veillonella parvula DSM
           2008]
          Length = 272

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 128/265 (48%), Positives = 181/265 (68%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T    +   ++AGPC IE +D    I ++   IC+ L +  ++K+SFDKANRSS +  
Sbjct: 8   DITVGGGKGLFVLAGPCVIEDYDRTLAIGKRAKEICERLGVPYIFKASFDKANRSSFSSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++   +KK+   P+++D+H+ +Q E  A+ +DILQIPA LCRQTDL+  AA
Sbjct: 68  RGPGLEEGLKMLASIKKELNVPVVSDIHSIEQIEPAAEVLDILQIPAFLCRQTDLVYGAA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S
Sbjct: 128 KTGKCVNVKKGQFMAPKDMENVLNKMKETGNENLMLTERGFSFGYNNLVVDMRSFPIMRS 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PVIFDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDG
Sbjct: 188 FDYPVIFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNM+ +     LL  L+AIDKI+K 
Sbjct: 248 PNMLYLDQFEDLLRDLVAIDKIVKG 272


>gi|52841416|ref|YP_095215.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|54297140|ref|YP_123509.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella pneumophila
           str. Paris]
 gi|148358769|ref|YP_001249976.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella pneumophila
           str. Corby]
 gi|296106814|ref|YP_003618514.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Legionella pneumophila 2300/99 Alcoy]
 gi|59798141|sp|Q5X5Y5|KDSA_LEGPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|59798154|sp|Q5ZWA3|KDSA_LEGPH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166199038|sp|A5IB80|KDSA_LEGPC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|52628527|gb|AAU27268.1| 2-dehydro-3-deoxyphosphonooctonate aldolase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|53750925|emb|CAH12336.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) [Legionella pneumophila str. Paris]
 gi|148280542|gb|ABQ54630.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase) (3-deoxy-D-
           manno-octulosonic acid 8-phosphate synthetase)
           [Legionella pneumophila str. Corby]
 gi|295648715|gb|ADG24562.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Legionella pneumophila 2300/99 Alcoy]
          Length = 274

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 129/265 (48%), Positives = 175/265 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++   LIAGPC IES + A   A  L  +C  LNI  +YKSSFDKANRSS++  
Sbjct: 5   GFEAGLDKPLFLIAGPCVIESEELALETAGYLKEMCSQLNIPFIYKSSFDKANRSSISSY 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G +KG  I   +K + G P+LTDVH +     ++  VD+LQ PA LCRQT+ +   A
Sbjct: 65  RGPGFEKGLSILEKVKSQIGVPVLTDVHEDTPLFEVSSVVDVLQTPAFLCRQTNFIQKVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
              + +N+KKGQFL+PWEM +++ K  A G + ++ CERG SFGYN LV+DMRS+ IM  
Sbjct: 125 AMNKPVNIKKGQFLAPWEMKHVIAKAKAQGNEQIMACERGVSFGYNNLVSDMRSLVIMRE 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV++DA+HSVQ PG +   SGG+R++I  LA+AAVA+GI+G+F+ETH DPD A SDG
Sbjct: 185 TGCPVVYDATHSVQLPGGNNGVSGGQREFIPALARAAVAVGISGLFMETHPDPDKALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + +LL  L A D++ K 
Sbjct: 245 PNSWPLDKMKQLLESLKAADEVYKK 269


>gi|163750762|ref|ZP_02157997.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella benthica
           KT99]
 gi|161329457|gb|EDQ00451.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella benthica
           KT99]
          Length = 282

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 121/266 (45%), Positives = 177/266 (66%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIEIANDKPFVLFGGMNVLESRDLAMKIAETYAEVTQKLGIPYVFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF+++K+ +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFQEIKQTFNLPLITDVHEIHQCAPVAEVVDIIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDNIILCERGSSFGYNNLVVDMLGMDEMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFD +H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  D
Sbjct: 189 QSGYPVIFDVTHALQRPGGRTDSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+Q+ A+D ++K 
Sbjct: 249 GPCALPLDQLENYLTQMKAVDDLVKS 274


>gi|303230207|ref|ZP_07316975.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella atypica
           ACS-134-V-Col7a]
 gi|303230952|ref|ZP_07317695.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514334|gb|EFL56333.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302515133|gb|EFL57107.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 272

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 132/267 (49%), Positives = 181/267 (67%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
               +T    +   ++AGPC IE +D    I ++  AIC+ L I  V+K+SFDKANRSS 
Sbjct: 5   NVGNMTIGGGKGLFVLAGPCVIEDYDRTLAIGKEAKAICERLGIPYVFKASFDKANRSSF 64

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG GL++G +I   +KK+   P+++D+H+ +Q E  A+ +DILQIPA LCRQTDL+ 
Sbjct: 65  NSFRGPGLEEGLKILASIKKELNVPVVSDIHSIEQIEPAAEVLDILQIPAFLCRQTDLVY 124

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
            AA+TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PI
Sbjct: 125 GAAKTGKCVNVKKGQFMAPKDMENVLNKMKESGNENLMLTERGFSFGYNNLVVDMRSFPI 184

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M S   PVIFDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A 
Sbjct: 185 MRSFDYPVIFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEAL 244

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
           SDGPNM+ +     LL  L+AIDKI+K
Sbjct: 245 SDGPNMVYLNQFEDLLKDLVAIDKIVK 271


>gi|220934357|ref|YP_002513256.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|254807752|sp|B8GQ74|KDSA_THISH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|219995667|gb|ACL72269.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 280

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 129/265 (48%), Positives = 176/265 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 E    LI+GPC IES   A   A +L  +C+ + +  +YKSSFDKANRSS    
Sbjct: 5   HFEAGLEHPIFLISGPCVIESEQLALDTAGQLKELCERVGVPFIYKSSFDKANRSSTRSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+GL++G  I   +K++ G P+LTDVH +   E +A  VD+LQ PA LCRQT+ +   A
Sbjct: 65  RGLGLEEGLRILETVKQQIGVPVLTDVHEDTPLEEVAAVVDVLQTPAFLCRQTNFIQNVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + GR +N+KKGQFL+PW+M N++ K    G   ++ CERG SFGYNTLV+DMR + +M  
Sbjct: 125 RQGRPVNIKKGQFLAPWDMGNVVDKAREAGNDQIMVCERGVSFGYNTLVSDMRGLAVMRE 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA G+AG+F+ETH DPD A SDG
Sbjct: 185 TGCPVVFDATHSVQQPGGKGTSSGGQREFVPVLARAAVASGVAGLFMETHPDPDKALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + +LL  L  +D ++K 
Sbjct: 245 PNAWPLPLMEELLVTLKTLDDVVKA 269


>gi|262038488|ref|ZP_06011857.1| 3-deoxy-8-phosphooctulonate synthase [Leptotrichia goodfellowii
           F0264]
 gi|261747357|gb|EEY34827.1| 3-deoxy-8-phosphooctulonate synthase [Leptotrichia goodfellowii
           F0264]
          Length = 278

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 134/280 (47%), Positives = 183/280 (65%), Gaps = 4/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +I+    + +      +   N +   LIAGPC IES D    +A K+  I   L I  V+
Sbjct: 2   IINKVNEVKI---TENIKVGNGK-MFLIAGPCVIESEDLVNEVAAKMKEITDKLGIQYVF 57

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS++  RG G++KG EI   +K+KYG  + TD+H    C+  A+ +D+LQI
Sbjct: 58  KASFDKANRSSISSFRGPGIEKGLEILSRVKEKYGVALATDIHEPWHCKVAAEVIDLLQI 117

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA L RQTDLL AA +TG+ +N+KKGQFL+PW+M N+++K    G K+++ CERG SFGY
Sbjct: 118 PAFLSRQTDLLIAAGETGKAVNIKKGQFLAPWDMKNVVKKFEEIGNKNIMLCERGASFGY 177

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LV DMR +  M   G PV+FDA+HSVQ PG  G  SGG   Y+ PLA+AA+A+G+ GI
Sbjct: 178 NNLVVDMRGLLEMRKFGYPVVFDATHSVQIPGGQGETSGGNSVYVYPLARAALAVGVDGI 237

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F E H DP  A SDGPNM+ ++D+  +L  LL  D++ K 
Sbjct: 238 FAEVHPDPSVAKSDGPNMLKLEDVENILKHLLKYDELTKG 277


>gi|313204154|ref|YP_004042811.1| 2-dehydrO-3-deoxyphosphooctonate aldolase [Paludibacter
           propionicigenes WB4]
 gi|312443470|gb|ADQ79826.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Paludibacter
           propionicigenes WB4]
          Length = 456

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 141/267 (52%), Positives = 189/267 (70%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N+       RFVLIAGPC IES +   M+A KL  IC+ L+I L++KSSFDKANRSS+  
Sbjct: 12  NRFEIGGSNRFVLIAGPCAIESEEMTMMVAAKLKEICEELDIHLIFKSSFDKANRSSVKA 71

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G+K+G EI + +K +   PI+TDVH   QC  +A   D+LQIPA L RQTDLL AA
Sbjct: 72  PRGLGMKRGLEILQRVKTELDLPIVTDVHEAWQCAEVAKVADMLQIPAFLSRQTDLLVAA 131

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           AQTG+++NVKKGQF++PW+M N++ KL   G +++L CERG+SFGYN LV DM  +  M 
Sbjct: 132 AQTGKIVNVKKGQFMAPWDMKNVIDKLRDSGNENILLCERGSSFGYNNLVVDMTGLVEMR 191

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PV+FDA+H+VQ+PG  G  +GG R+ +  L +AA+A+G+  IF E H DPD+A SD
Sbjct: 192 SYGFPVVFDATHAVQKPGGQGTSTGGNREMVPYLMRAALAVGVDAIFAEVHPDPDHAFSD 251

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GPN I++  + ++L Q +AID I K L
Sbjct: 252 GPNQIHLSRIKEILEQAIAIDNITKQL 278


>gi|153875642|ref|ZP_02003353.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Beggiatoa sp. PS]
 gi|152067894|gb|EDN66647.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Beggiatoa sp. PS]
          Length = 283

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 127/265 (47%), Positives = 175/265 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAGPC IES   A   A +L  I   L I  +YKSSFDKANRSS    
Sbjct: 5   DFEIGLDKPFFLIAGPCVIESEQLALETAFQLKTITDELAIPFIYKSSFDKANRSSYHSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           R +G+++G  I   ++ +   P+LTDVH +   + +A  VD+LQ PA LCRQT+ +   A
Sbjct: 65  RSLGIEEGLRILETVRTQIEVPVLTDVHEDTPLQEVASVVDVLQTPAFLCRQTNFIQNVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G  +N+KKGQFL+PW+M ++++K  A G K ++ CERG SFGYN LV+DMRS+ +M +
Sbjct: 125 RQGLPVNIKKGQFLAPWDMTHVVEKARAVGNKKIMVCERGVSFGYNNLVSDMRSLAVMRN 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFDA+HSVQ PG  G+ SGG+R+++  LA+AA+A+GI+GIF+ETH  PD A SDG
Sbjct: 185 TGCPVIFDATHSVQLPGGQGHASGGQREFVPVLARAAIAVGISGIFMETHPQPDKALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
            N   ++ +  LL  L AID  +K 
Sbjct: 245 LNAWPLEQMFPLLETLKAIDDTVKK 269


>gi|154253594|ref|YP_001414418.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Parvibaculum
           lavamentivorans DS-1]
 gi|154157544|gb|ABS64761.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Parvibaculum
           lavamentivorans DS-1]
          Length = 277

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 151/279 (54%), Positives = 199/279 (71%), Gaps = 5/279 (1%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +  N  + +G     +  +N++ FVLIAGPCQ+E+  HAF +A  +  I   L IG +YK
Sbjct: 1   MPANQTVRIG----NLEIANDKPFVLIAGPCQLETRQHAFDMAGAVKEITDRLGIGFIYK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANR+S    RG+GL+    IF DLKK+ G P+LTDVH   QC  +A  VD+LQIP
Sbjct: 57  TSFDKANRTSRNATRGLGLELALPIFEDLKKELGLPVLTDVHERDQCAEVASVVDVLQIP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A LCRQTDLL AAAQTG+V+NVKKGQFL+PW+M N++ K+   G  +VL  ERG SFGYN
Sbjct: 117 AFLCRQTDLLEAAAQTGKVVNVKKGQFLAPWDMKNVVNKVVDAGNPNVLATERGVSFGYN 176

Query: 202 TLVTDMRSIPIMTSMG-VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           TLV DMR++PIM      PV+ DA+HSVQQPG  G  SGG+R+ +  +A AAV++G+A +
Sbjct: 177 TLVNDMRALPIMKEQCRCPVVIDATHSVQQPGGQGTASGGDRRMVPHIATAAVSLGVAAV 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+ETHQDPDNAPSDGPNM+ + +L  LL++L   D++ K
Sbjct: 237 FIETHQDPDNAPSDGPNMVKLDELEALLARLRKFDELAK 275


>gi|307609938|emb|CBW99466.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Legionella pneumophila
           130b]
          Length = 274

 Score =  290 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 129/265 (48%), Positives = 175/265 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++   LIAGPC IES + A   A  L  +C  LNI  +YKSSFDKANRSS++  
Sbjct: 5   GFEAGLDKPLFLIAGPCVIESEELALETAGYLKEMCIQLNIPFIYKSSFDKANRSSISSY 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G +KG  I   +K + G P+LTDVH +     ++  VD+LQ PA LCRQT+ +   A
Sbjct: 65  RGPGFEKGLSILEKVKSQIGVPVLTDVHEDTPLFEVSSVVDVLQTPAFLCRQTNFIQKVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
              + +N+KKGQFL+PWEM +++ K  A G + ++ CERG SFGYN LV+DMRS+ IM  
Sbjct: 125 AXNKPVNIKKGQFLAPWEMKHVIAKAKAQGNEQIMACERGVSFGYNNLVSDMRSLVIMRE 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV++DA+HSVQ PG +   SGG+R++I  LA+AAVA+GI+G+F+ETH DPD A SDG
Sbjct: 185 TGCPVVYDATHSVQLPGGNNGVSGGQREFIPALARAAVAVGISGLFMETHPDPDKALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + +LL  L A D++ K 
Sbjct: 245 PNSWPLDKMKQLLESLKAADEVYKK 269


>gi|288572978|ref|ZP_06391335.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288568719|gb|EFC90276.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 286

 Score =  290 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 123/277 (44%), Positives = 183/277 (66%), Gaps = 5/277 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
               I +G    +V         +IAGPC +ES + +    +++  I + L +  ++K+S
Sbjct: 1   MVTEIEIG----KVRIGGG-PLAVIAGPCSLESLELSMETGKRIKEISEELGLNYIFKAS 55

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           +DKANR+S+   RG GL+KG     ++K+  G P++TD+H   Q   +A+  D+LQIPA 
Sbjct: 56  YDKANRTSIHSYRGPGLEKGLRWLSEIKETLGVPVITDIHEPWQAAPVAEVADVLQIPAF 115

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AA++TG+ +NVKKGQF+SP++M  ++ K +  G   V+ CERGT+ GY  L
Sbjct: 116 LCRQTDLLVAASKTGKPLNVKKGQFMSPYDMKAVVSKCNEAGNDKVMLCERGTTMGYGQL 175

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DMRS+PIM SMG PV+FDA+HSVQ PG  G+ SGG+R+++  L++AAV +GI  +FLE
Sbjct: 176 VVDMRSLPIMRSMGCPVVFDATHSVQMPGGRGDTSGGDRRFVPALSRAAVGLGIDALFLE 235

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            H +PD A SDGPNM+ +  L  +L+ +  +D ++K 
Sbjct: 236 VHPNPDEALSDGPNMVPLDRLKDILTGIKVLDDLVKS 272


>gi|127513832|ref|YP_001095029.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella loihica PV-4]
 gi|158513476|sp|A3QH22|KDSA_SHELP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|126639127|gb|ABO24770.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella loihica PV-4]
          Length = 282

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 127/278 (45%), Positives = 183/278 (65%), Gaps = 4/278 (1%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            +N  I LGS    +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+
Sbjct: 1   MSNKTIKLGS----IEIANDKPFVLFGGMNVLESRDLAMQIAETYAEVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF+++K  +  P++TDVH   QC+ +A+ VDI+Q+PA
Sbjct: 57  SFDKANRSSVNSYRGPGMEEGLKIFQEIKDTFNLPLITDVHEPYQCQPVAEVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+ FGYN 
Sbjct: 117 FLARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSCFGYNN 176

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV DM  +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+
Sbjct: 177 LVVDMLGMDEMKQSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFI 236

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           E H DPDNA  DGP  + +  L   L+Q+ AID ++K 
Sbjct: 237 EAHPDPDNAKCDGPCALPLHQLENYLTQMKAIDDLVKS 274


>gi|307546340|ref|YP_003898819.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halomonas elongata DSM
           2581]
 gi|307218364|emb|CBV43634.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halomonas elongata DSM
           2581]
          Length = 283

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 116/265 (43%), Positives = 167/265 (63%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +   N Q   L  G   +ES + A  +AE    +   L +  V+K+SFDKANRSS+   
Sbjct: 12  GLRVGNSQPLTLFGGMNVLESRELALEVAEAYVEVTSRLGMPYVFKASFDKANRSSIHSF 71

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL+ G  +  ++K+++G P++TDVH   Q   +A+  D++Q+PA L RQTDL+ A A
Sbjct: 72  RGPGLEDGVAMLAEIKERFGVPVITDVHEPWQAAPVAEVADVIQLPAFLARQTDLVVAMA 131

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG VIN+KK QFL+P EM +IL+K    G   ++ CERG+SFGYN LV DM     M  
Sbjct: 132 ETGAVINIKKPQFLAPHEMRHILRKCEEAGNDRLILCERGSSFGYNNLVVDMLGFGDMKQ 191

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G P++FD +HS+Q+PG   + + G R  +  LA+A VA+G+AG+FLE+H DPDNA  DG
Sbjct: 192 TGYPLLFDVTHSLQRPGGRADSADGRRAQVAELARAGVAVGLAGLFLESHPDPDNAKCDG 251

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           P  + +  L   L+QL A+D ++K 
Sbjct: 252 PCALPLDKLEPFLAQLKALDDLVKG 276


>gi|157962938|ref|YP_001502972.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella pealeana ATCC
           700345]
 gi|189028418|sp|A8H7A0|KDSA_SHEPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|157847938|gb|ABV88437.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella pealeana ATCC
           700345]
          Length = 282

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 122/266 (45%), Positives = 176/266 (66%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEIANDKPFVLFGGMNVLESRDLAMQIAETYAEVTQKLGIPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++K  +  P++TDVH   QC  +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKSTFNLPLITDVHEVHQCAPVAEVVDVIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIMLCERGSSFGYNNLVVDMLGMDEMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  D
Sbjct: 189 QTGYPVIFDATHALQRPGGRSDSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+Q+ AID ++K 
Sbjct: 249 GPCALPLHQLENYLTQMKAIDDLVKS 274


>gi|198283106|ref|YP_002219427.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665807|ref|YP_002425335.1| 3-deoxy-8-phosphooctulonate synthase [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|226722928|sp|B7J6R3|KDSA_ACIF2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226722929|sp|B5EPM6|KDSA_ACIF5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|198247627|gb|ACH83220.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518020|gb|ACK78606.1| 3-deoxy-8-phosphooctulonate synthase [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 281

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 128/264 (48%), Positives = 176/264 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +  F L+AGPC IES   A   AE L  IC  L I  +YKSS+DKANRSS    
Sbjct: 5   GFEAGLQHPFFLMAGPCAIESESLALRTAEDLRDICARLGIPFIYKSSYDKANRSSGQSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+ +G  I   ++++ G P++TDVH ++   A+A+ VD+LQ PA LCRQTD + A A
Sbjct: 65  RGPGMDEGLRILEKVRREVGVPVVTDVHEKEDVSAVAEVVDVLQTPAFLCRQTDFIQAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
             G+ +N+KKGQFL+PW+M ++  K  A G + ++ CERG SFGYN LV+DMRS+ +M  
Sbjct: 125 AAGKPVNIKKGQFLAPWDMLHVASKAKATGNEQIMVCERGASFGYNNLVSDMRSLAVMRQ 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R++I  LA+AAVA G++G+F+ETH +P +A SDG
Sbjct: 185 TGCPVVFDATHSVQLPGGQGDRSGGQREFIPVLARAAVAAGVSGLFMETHPNPADALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN   +  +  LL  L  ID ++K
Sbjct: 245 PNAWPLGRMEDLLRILQHIDHVVK 268


>gi|229541726|ref|ZP_04430786.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bacillus coagulans 36D1]
 gi|229326146|gb|EEN91821.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bacillus coagulans 36D1]
          Length = 280

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 139/267 (52%), Positives = 184/267 (68%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
            +++ F      VLIAGPC IES   A   A  L  I   L I  V+K+SFDKANRSS+ 
Sbjct: 7   NSRIAFGQRLPLVLIAGPCVIESETMAMETAATLQTIAGKLGIPFVFKASFDKANRSSIF 66

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
            KRG GL+KG EI   +K  +G P+ +D+H   Q +A  + +DILQIPA LCRQTDLL A
Sbjct: 67  SKRGPGLEKGLEILDRIKNVFGVPVTSDIHEPHQAKAAGEVLDILQIPAFLCRQTDLLLA 126

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
           AA TG+++NVKKGQFL+PW+M N++QKL   G   +L  ERG++FGYN LV DMR++P M
Sbjct: 127 AAATGKIVNVKKGQFLAPWDMKNVIQKLEESGTDKILLTERGSTFGYNNLVVDMRALPEM 186

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
             +G PV+FDA+HSVQ PG +G  +GG+R ++  LA+AA A GI  +FLE H DPD A S
Sbjct: 187 RRLGYPVVFDATHSVQIPGGNGTSTGGKRAFVPYLARAAAACGIDALFLEAHPDPDQAWS 246

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGPNM+ + DL ++L  ++ ID++IK 
Sbjct: 247 DGPNMVKLDDLEEMLKPVIEIDRMIKE 273


>gi|56478956|ref|YP_160545.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aromatoleum aromaticum
           EbN1]
 gi|81598523|sp|Q5NZ70|KDSA_AZOSE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|56314999|emb|CAI09644.1| 2-dehydro-3-deoxyphosphooctonate aldolase (EC 2.5.1.55)
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) (KDOPS) [Aromatoleum aromaticum EbN1]
          Length = 279

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 138/267 (51%), Positives = 180/267 (67%), Gaps = 2/267 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAGPC IES D AF  A  L  IC  L I  +YKSS+DKANRSS    
Sbjct: 5   GFEAGLDKPFFLIAGPCVIESRDMAFETAGALKEICVELGIPFIYKSSYDKANRSSGKSY 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G++KG EI  D+KK+ G P+LTDVH   +  A+A +VD+LQ PA LCRQTD + A A
Sbjct: 65  RGMGMEKGLEILADVKKQLGVPVLTDVHAIDEIPAVAAAVDVLQTPAFLCRQTDFIHAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHG--AKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            +GR +N+KKGQFL+P +M N++ K       A  ++ CERG SFGYN LV+DMRS+ IM
Sbjct: 125 ASGRPVNIKKGQFLAPGDMKNVVDKAREANGGADTIMVCERGASFGYNNLVSDMRSLAIM 184

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
              G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GIAG+F+E+H DP  A S
Sbjct: 185 RETGCPVVFDATHSVQLPGGQGTASGGQREFVPVLARAAVAVGIAGLFMESHPDPAKALS 244

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGPN   +  +  LL+ L  ID ++K 
Sbjct: 245 DGPNAWPLPKMKALLATLKEIDALVKA 271


>gi|320355399|ref|YP_004196738.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfobulbus
           propionicus DSM 2032]
 gi|320123901|gb|ADW19447.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfobulbus
           propionicus DSM 2032]
          Length = 283

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 135/267 (50%), Positives = 183/267 (68%)

Query: 32  SGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSS 91
           +    +T       +L+AGPC +ES D A+ IA ++ AI   L +  V+K+SFDKANR+S
Sbjct: 10  TPAGPITIGPGAPLLLMAGPCVLESGDLAWEIAREMKAIAARLGVSYVFKASFDKANRTS 69

Query: 92  LAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLL 151
           L+  RG G +KG  I   L+ + G P+++D+H   Q E  AD +DILQIPA LCRQTDLL
Sbjct: 70  LSSFRGPGAEKGLRILGRLRAEVGVPVVSDIHEPGQAELAADCLDILQIPAFLCRQTDLL 129

Query: 152 TAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIP 211
            AAA+TG+V+NVKKGQF+SPW+M + + KL   G + +L  ERG SFGYN LV DMRS+ 
Sbjct: 130 MAAARTGKVVNVKKGQFVSPWDMEHAVNKLRGAGTEKILLTERGASFGYNNLVVDMRSLV 189

Query: 212 IMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
           +M + G PV+FDA+HSVQ PG  G  SGG+R++I  LA+AA+A+GI G+FLE H  PD A
Sbjct: 190 VMRAFGYPVVFDATHSVQLPGGAGGSSGGQREFIPALARAAMAVGIDGLFLEVHPQPDKA 249

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKII 298
             DGPN + +  +  LL QLLA+ + +
Sbjct: 250 LCDGPNSLPLDQVEPLLKQLLAVRQAV 276


>gi|238019685|ref|ZP_04600111.1| hypothetical protein VEIDISOL_01559 [Veillonella dispar ATCC 17748]
 gi|237863726|gb|EEP65016.1| hypothetical protein VEIDISOL_01559 [Veillonella dispar ATCC 17748]
          Length = 272

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 128/265 (48%), Positives = 181/265 (68%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T    +   ++AGPC IE +D    I ++   IC+ L I  ++K+SFDKANRSS    
Sbjct: 8   DITVGGGKGLFVLAGPCVIEDYDRTLAIGKRAKEICERLGIPYIFKASFDKANRSSYGSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G +I   +KK+   P+++D+H+ +Q E  A+ +D+LQIPA LCRQTDL+  AA
Sbjct: 68  RGPGLEEGLKILASIKKELNVPVVSDIHSIEQIEPAAEVLDVLQIPAFLCRQTDLVYGAA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S
Sbjct: 128 KTGKCVNVKKGQFMAPKDMENVLNKMKETGNENLMLTERGFSFGYNNLVVDMRSFPIMRS 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDG
Sbjct: 188 FDYPVVFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNM+ + +   LL  L+AIDKI+K 
Sbjct: 248 PNMLYLDNFEALLKDLVAIDKIVKG 272


>gi|282850053|ref|ZP_06259435.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella parvula ATCC
           17745]
 gi|282580242|gb|EFB85643.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella parvula ATCC
           17745]
          Length = 272

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 127/265 (47%), Positives = 180/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T    +   ++AGPC IE +D    I ++   IC+ L +  ++K+SFDKANRSS    
Sbjct: 8   DITVGGGKGLFVLAGPCVIEDYDRTLAIGKRAKEICERLGVPYIFKASFDKANRSSFNSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++   +KK+   P+++D+H+ +Q E  A+ +DILQIPA LCRQTDL+  AA
Sbjct: 68  RGPGLEEGLKMLASIKKELNVPVVSDIHSIEQIEPAAEVLDILQIPAFLCRQTDLVYGAA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S
Sbjct: 128 KTGKCVNVKKGQFMAPKDMENVLNKMKETGNENLMLTERGFSFGYNNLVVDMRSFPIMRS 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PVIFDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDG
Sbjct: 188 FDYPVIFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNM+ +     +L  L+AIDKI+K 
Sbjct: 248 PNMLYLDQFEDVLRDLVAIDKIVKG 272


>gi|161579543|ref|YP_114925.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylococcus capsulatus
           str. Bath]
 gi|59798158|sp|Q604M5|KDSA_METCA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
          Length = 283

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 129/265 (48%), Positives = 174/265 (65%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 E    LIAGPC IE+   A   A  L  I   L I  +YKSSFDKANRSS A  
Sbjct: 15  GFPVGLEHPLFLIAGPCVIETEQLALDTAGALKEITDGLGIPFIYKSSFDKANRSSHASY 74

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G  I  ++K++ G P+LTDVH +   + +A  VD+LQ PA LCRQT+ +   A
Sbjct: 75  RGPGMEEGLRILAEVKRQIGVPVLTDVHEDTPLQEVASVVDVLQTPAFLCRQTNFIQNVA 134

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
            TG+ +N+KKGQFL+PW+M ++  K  A G + ++ CERG SFGYN LV+DMRS+ IM  
Sbjct: 135 NTGKPVNLKKGQFLAPWDMKHVAAKALATGNRHIMVCERGVSFGYNNLVSDMRSLSIMRE 194

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV++DA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F+ETH DPD A SDG
Sbjct: 195 TGCPVVYDATHSVQLPGGQGTASGGQREFVPALARAAVAVGISGLFMETHPDPDRALSDG 254

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  +  LL  L  +D+ +K 
Sbjct: 255 PNSWPLDRMKALLELLSTLDRTVKA 279


>gi|313894612|ref|ZP_07828175.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella sp. oral taxon
           158 str. F0412]
 gi|313440802|gb|EFR59231.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella sp. oral taxon
           158 str. F0412]
          Length = 272

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 128/265 (48%), Positives = 180/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T    +   ++AGPC IE +D    I ++   ICQ L +  ++K+SFDKANRSS    
Sbjct: 8   DITVGGGKGLFVLAGPCVIEDYDRTLAIGKRAKEICQRLGVPYIFKASFDKANRSSFGSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++   +KK+   P+++D+H+ +Q E  A+ +DILQIPA LCRQTDL+  AA
Sbjct: 68  RGPGLEEGLKMLASIKKELNVPVVSDIHSIEQIEPAAEVLDILQIPAFLCRQTDLVYGAA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S
Sbjct: 128 KTGKCVNVKKGQFMAPKDMENVLNKMKETGNENLMLTERGFSFGYNNLVVDMRSFPIMRS 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PVIFDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDG
Sbjct: 188 FDYPVIFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNM+ +     +L  L+AIDKI+K 
Sbjct: 248 PNMLYLDQFEAMLRDLVAIDKIVKG 272


>gi|294795175|ref|ZP_06760309.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella sp. 3_1_44]
 gi|294453967|gb|EFG22342.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella sp. 3_1_44]
          Length = 272

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 127/265 (47%), Positives = 181/265 (68%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T    +   ++AGPC IE +D    I ++   IC+ L +  ++K+SFDKANRSS +  
Sbjct: 8   DITVGGGKGLFVLAGPCVIEDYDRTLAIGKRAKEICERLGVPYIFKASFDKANRSSFSSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++   +KK+   P+++D+H+ +Q E  A+ +DILQIPA LCRQTDL+  AA
Sbjct: 68  RGPGLEEGLKMLASIKKELNVPVVSDIHSIEQIEPAAEVLDILQIPAFLCRQTDLVYGAA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S
Sbjct: 128 KTGKCVNVKKGQFMAPKDMENVLNKMKETGNENLMLTERGFSFGYNNLVVDMRSFPIMRS 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PVIFDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDG
Sbjct: 188 FDYPVIFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNM+ +     +L  L+AIDKI+K 
Sbjct: 248 PNMLYLDQFEDVLRDLVAIDKIVKG 272


>gi|329113485|ref|ZP_08242266.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acetobacter pomorum
           DM001]
 gi|326697310|gb|EGE48970.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acetobacter pomorum
           DM001]
          Length = 277

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 149/266 (56%), Positives = 195/266 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +   N+Q FVLIAGPCQIES  HA   A  L  ICQ   +GL+YKSSFDKANR+S++ 
Sbjct: 12  GSLYIGNDQPFVLIAGPCQIESAVHAMETATALKEICQKAGVGLIYKSSFDKANRTSISS 71

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G+ +G +I  +++     P+LTDVH  +QC  +A++VD+LQIPA LCRQTDLL AA
Sbjct: 72  ARGIGMAEGLDILANVRNTLDIPVLTDVHAPEQCAPVAEAVDVLQIPAFLCRQTDLLLAA 131

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG  +NVKKGQFL+PW+M ++  K+ + G   ++ CERGTSFGYNTLV DMR +PIM 
Sbjct: 132 GKTGAAVNVKKGQFLAPWDMKHVAAKIASTGNNRIMLCERGTSFGYNTLVNDMRGLPIMA 191

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G  SGG+R++   L++AA+AIG+A +F+ETH++PD APSD
Sbjct: 192 QTGYPVVFDATHSVQQPGGLGGASGGQREFAPVLSRAALAIGVASLFIETHENPDQAPSD 251

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNM+ IK LP LL Q   ID +IK 
Sbjct: 252 GPNMLPIKSLPALLEQFKKIDALIKG 277


>gi|294142134|ref|YP_003558112.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella violacea
           DSS12]
 gi|293328603|dbj|BAJ03334.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella violacea
           DSS12]
          Length = 282

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 122/266 (45%), Positives = 178/266 (66%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIEIANDKPFVLFGGMNVLESRDLAMKIAETYAEVTQKLGIPYVFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF+++K+ +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFQEIKQTFNLPLITDVHEIDQCAPVAEVVDIIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIISKFNEAGNDNIILCERGSSFGYNNLVVDMLGMDEMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  D
Sbjct: 189 QSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+Q+ A+D ++K 
Sbjct: 249 GPCALPLNQLENYLTQMKAVDDLVKS 274


>gi|120600158|ref|YP_964732.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. W3-18-1]
 gi|146291914|ref|YP_001182338.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella putrefaciens
           CN-32]
 gi|158512984|sp|A1RND3|KDSA_SHESW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166220460|sp|A4Y3K6|KDSA_SHEPC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|120560251|gb|ABM26178.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. W3-18-1]
 gi|145563604|gb|ABP74539.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella putrefaciens
           CN-32]
 gi|319425205|gb|ADV53279.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella putrefaciens
           200]
          Length = 282

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 123/266 (46%), Positives = 175/266 (65%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++KK +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKKTFNLPLITDVHETYQCAPVAEVVDIIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+ FGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSCFGYNNLVVDMLGMDEMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  D
Sbjct: 189 QSGYPVIFDATHALQRPGGRSDSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L Q+ AID ++K 
Sbjct: 249 GPCALPLHQLENYLKQMKAIDDLVKS 274


>gi|294793356|ref|ZP_06758501.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella sp. 6_1_27]
 gi|294455787|gb|EFG24152.1| 3-deoxy-8-phosphooctulonate synthase [Veillonella sp. 6_1_27]
          Length = 272

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 127/265 (47%), Positives = 180/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T    +   ++AGPC IE +D    I ++   IC+ L +  ++K+SFDKANRSS    
Sbjct: 8   DITVGGGKGLFVLAGPCVIEDYDRTLAIGKRAKEICERLGVPYIFKASFDKANRSSFNSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++   +KK+   P+++D+H+ +Q E  A+ +DILQIPA LCRQTDL+  AA
Sbjct: 68  RGPGLEEGLKMLASIKKELNVPVVSDIHSIEQIEPAAEVLDILQIPAFLCRQTDLVYGAA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG SFGYN LV DMRS PIM S
Sbjct: 128 KTGKCVNVKKGQFMAPKDMENVLNKMKETGNENLMLTERGFSFGYNNLVVDMRSFPIMRS 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PVIFDA+HSVQ PG  G  S G R+++  LA+AAVA G+ G+F E H +P+ A SDG
Sbjct: 188 FDYPVIFDATHSVQLPGGAGTKSSGNREFVPNLARAAVASGVDGLFFEVHDNPEEALSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNM+ +     +L  L+AIDKI+K 
Sbjct: 248 PNMLYLDQFEAVLRDLVAIDKIVKG 272


>gi|39996992|ref|NP_952943.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sulfurreducens
           PCA]
 gi|48428283|sp|P61655|KDSA_GEOSL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|39983880|gb|AAR35270.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sulfurreducens
           PCA]
 gi|298506009|gb|ADI84732.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Geobacter sulfurreducens KN400]
          Length = 272

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 131/276 (47%), Positives = 192/276 (69%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
               I +GS    V    ++  VLIAGPC IE+       AE+L  IC  +++ LV+K+S
Sbjct: 1   MTREITIGS----VKIGGDRPLVLIAGPCVIENEAATLRCAERLMTICNGVSVSLVFKAS 56

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           +DKANR+S+   RG G+++G  I + +K   G P+++D+H+ +Q +  A+ +DI+Q+PA 
Sbjct: 57  YDKANRTSVTSFRGPGMQEGLRILQKVKDSLGIPVISDIHSIEQVKPAAEVLDIIQVPAF 116

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDL+    +T RV+NVKKGQF++PW+M N++ K+ + G + ++  ERG +FGYN L
Sbjct: 117 LCRQTDLVVEVGRTNRVVNVKKGQFMAPWDMENVVGKILSTGNERIILTERGVTFGYNNL 176

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM  +G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA GI GIF+E
Sbjct: 177 VSDMRSLPIMRRIGFPVVFDATHSVQLPGGQGGSSGGQREFVEYLSRAAVATGIDGIFME 236

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H+DP+ A  DGPN + + DLP LL +L AID I+K
Sbjct: 237 VHEDPEKALCDGPNSVKLDDLPALLKKLKAIDAIVK 272


>gi|113971497|ref|YP_735290.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. MR-4]
 gi|123324720|sp|Q0HFD4|KDSA_SHESM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|113886181|gb|ABI40233.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. MR-4]
          Length = 282

 Score =  288 bits (737), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 123/266 (46%), Positives = 175/266 (65%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++KK +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKKTFNLPLITDVHEPYQCAPVAEVVDIIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+ FGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSCFGYNNLVVDMLGMDEMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  D
Sbjct: 189 QSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L Q+ AID ++K 
Sbjct: 249 GPCALPLHQLENYLKQMKAIDDLVKS 274


>gi|114046310|ref|YP_736860.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. MR-7]
 gi|117919227|ref|YP_868419.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. ANA-3]
 gi|122944922|sp|Q0HYK2|KDSA_SHESR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|158512314|sp|A0KT94|KDSA_SHESA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|113887752|gb|ABI41803.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. MR-7]
 gi|117611559|gb|ABK47013.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sp. ANA-3]
          Length = 282

 Score =  288 bits (737), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 123/266 (46%), Positives = 175/266 (65%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++KK +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKKTFNLPLITDVHETYQCAPVAEVVDIIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+ FGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSCFGYNNLVVDMLGMDEMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  D
Sbjct: 189 QSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L Q+ AID ++K 
Sbjct: 249 GPCALPLHQLENYLKQMKAIDDLVKS 274


>gi|167625118|ref|YP_001675412.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella halifaxensis
           HAW-EB4]
 gi|189028417|sp|B0TR22|KDSA_SHEHH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|167355140|gb|ABZ77753.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella halifaxensis
           HAW-EB4]
          Length = 282

 Score =  288 bits (737), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 122/266 (45%), Positives = 177/266 (66%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEIANDKPFVLFGGMNVLESRDLAMQIAETYAEVTQKLGIPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++K  +  P++TDVH  QQC  +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKSTFNLPLITDVHEVQQCAPVAEVVDVIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIMLCERGSSFGYNNLVVDMLGMDEMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  D
Sbjct: 189 QTGYPVIFDATHALQRPGGRSDSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+Q+ A+D ++K 
Sbjct: 249 GPCALPLHQLENYLTQMKAVDDLVKS 274


>gi|78485605|ref|YP_391530.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thiomicrospira crunogena
           XCL-2]
 gi|123769088|sp|Q31G67|KDSA_THICR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|78363891|gb|ABB41856.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Thiomicrospira crunogena XCL-2]
          Length = 277

 Score =  288 bits (737), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 122/264 (46%), Positives = 172/264 (65%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q   LIAGPC IES   A   A +L  +  +L I  +YKSS+DKANRSS    
Sbjct: 5   GFDVGIDQPLFLIAGPCVIESEQLAIETAGQLKELTDALGIPFIYKSSYDKANRSSTKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+++G  I + +K + G P+LTDVH +   + +A  VD++Q PA L RQT+ +    
Sbjct: 65  RGLGVEEGLRILQKVKDEIGVPVLTDVHEDTPLDEVASVVDVMQTPAFLVRQTNFIQNVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G  +N+KKGQF +PW+M  ++ K    G   ++ C+RGTSFGYNTL++DMR +  M  
Sbjct: 125 RQGLPVNIKKGQFQAPWDMDQVVAKAREVGNDQIMVCDRGTSFGYNTLISDMRGLASMRQ 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQQPG  G  SGG+R+ +  LA+AA+A GI+G+F+ETH DP+NA SDG
Sbjct: 185 TGCPVVFDATHSVQQPGGQGTTSGGQREMVPVLARAAIAAGISGVFMETHPDPENALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM  I  L  LL  +  +D+++K
Sbjct: 245 PNMWPISRLKPLLETMKELDEVVK 268


>gi|148265017|ref|YP_001231723.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter uraniireducens
           Rf4]
 gi|189028410|sp|A5G5T2|KDSA_GEOUR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|146398517|gb|ABQ27150.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter uraniireducens
           Rf4]
          Length = 272

 Score =  288 bits (737), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 133/265 (50%), Positives = 189/265 (71%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             V    ++  VLIAGPC IE+       AE+L  IC  ++I L++K+S+DKANR+S+  
Sbjct: 8   GNVKIGGDRPLVLIAGPCVIENEVATMRCAERLMTICNGVSIPLIFKASYDKANRTSVNS 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+K G +I + +K+  G P+L+D+H+ +Q E  A+ +D++QIPA LCRQTDL+ AA
Sbjct: 68  FRGPGMKDGLKILKKVKEALGVPVLSDIHSIEQVEPAAEVLDVVQIPAFLCRQTDLVVAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A++G+V+N+KKGQFL+PW+M N+  K  + G  +++  ERG SFGYN LV+DMRS PI+ 
Sbjct: 128 ARSGKVVNIKKGQFLAPWDMENVAGKAVSTGNDNIILTERGVSFGYNNLVSDMRSFPILR 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            +G PV+FDA+HSVQ PG  G  SGG+R+++  L +AAVA GI GIF+E H DP+ A  D
Sbjct: 188 KIGYPVVFDATHSVQLPGGLGGSSGGQREFVEYLGRAAVATGIDGIFMEVHDDPEKALCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + ++DLP LL +L AID I+K
Sbjct: 248 GPNSVKLEDLPALLKKLKAIDAIVK 272


>gi|254374034|ref|ZP_04989516.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella novicida
           GA99-3548]
 gi|151571754|gb|EDN37408.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella novicida
           GA99-3548]
          Length = 282

 Score =  288 bits (737), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 126/265 (47%), Positives = 178/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   
Sbjct: 12  NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSF 71

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    
Sbjct: 72  RGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVC 131

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G+ +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 132 KQGKPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKA 191

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDG
Sbjct: 192 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAIAVGIDGLFMETHPNPDEAKSDG 251

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + + LS L  +D ++K 
Sbjct: 252 PNSFPMYKIKEFLSLLKELDHLVKS 276


>gi|24375317|ref|NP_719360.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella oneidensis
           MR-1]
 gi|37999694|sp|Q8EAR9|KDSA_SHEON RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|24350130|gb|AAN56804.1|AE015816_1 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella oneidensis
           MR-1]
          Length = 282

 Score =  288 bits (737), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 123/266 (46%), Positives = 175/266 (65%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++KK +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKKTFNLPLITDVHETYQCAPVAEVVDIIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+ FGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSCFGYNNLVVDMLGMDEMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  D
Sbjct: 189 QSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L Q+ AID ++K 
Sbjct: 249 GPCALPLHQLENYLKQMKAIDDLVKS 274


>gi|89256819|ref|YP_514181.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica LVS]
 gi|167009858|ref|ZP_02274789.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica FSC200]
 gi|290953515|ref|ZP_06558136.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica URFT1]
 gi|295313207|ref|ZP_06803866.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica URFT1]
 gi|123401558|sp|Q2A271|KDSA_FRATH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|89144650|emb|CAJ79974.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica LVS]
          Length = 275

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 127/265 (47%), Positives = 179/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   
Sbjct: 5   NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD+LQIPA LCRQT+ +    
Sbjct: 65  RGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQIPAFLCRQTNFILEVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G+ +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 125 KQGKPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKA 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDG
Sbjct: 185 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + + LS L  +D ++K 
Sbjct: 245 PNSFPMYKIKEFLSLLKELDHLVKS 269


>gi|115315205|ref|YP_763928.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica OSU18]
 gi|169656693|ref|YP_001429050.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica FTNF002-00]
 gi|254368101|ref|ZP_04984121.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           holarctica 257]
 gi|115130104|gb|ABI83291.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134253911|gb|EBA53005.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           holarctica 257]
 gi|164551761|gb|ABU62094.2| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           holarctica FTNF002-00]
          Length = 282

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 127/265 (47%), Positives = 179/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   
Sbjct: 12  NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSF 71

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD+LQIPA LCRQT+ +    
Sbjct: 72  RGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQIPAFLCRQTNFILEVC 131

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G+ +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 132 KQGKPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKA 191

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDG
Sbjct: 192 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDG 251

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + + LS L  +D ++K 
Sbjct: 252 PNSFPMYKIKEFLSLLKELDHLVKS 276


>gi|58040706|ref|YP_192670.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconobacter oxydans
           621H]
 gi|58003120|gb|AAW62014.1| 2-Dehydro-3-deoxyphosphooctonate aldolase [Gluconobacter oxydans
           621H]
          Length = 274

 Score =  288 bits (736), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 148/266 (55%), Positives = 204/266 (76%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +T   +Q F LIAGPCQIES +HA  +A+ + ++C+ L IGL+YKSSFDKANRSS+  
Sbjct: 6   GDLTVGQDQPFTLIAGPCQIESREHATEMADAISSLCRELGIGLIYKSSFDKANRSSVNA 65

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG+  G +I   +++++G P+LTDVHT +QC   A +VD+LQIPA LCRQTDLL AA
Sbjct: 66  ARGVGMDAGLDILASIRERFGVPVLTDVHTAEQCAPAAQAVDVLQIPAFLCRQTDLLLAA 125

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TGR IN+KKGQFL+PW+M N+  K+ + G + ++ C+RGTSFGYNTLV+DMR +PIM 
Sbjct: 126 GKTGRAINIKKGQFLAPWDMANVAAKIASTGNERIMLCDRGTSFGYNTLVSDMRGLPIMA 185

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G  +GG+R+++ PLA+AA++IG+A +F+ETHQDPD+APSD
Sbjct: 186 QTGYPVVFDATHSVQQPGGLGASTGGQREFVEPLARAALSIGVAAVFIETHQDPDHAPSD 245

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP M+ + ++  LL++L A D + K 
Sbjct: 246 GPTMVPLSEMSGLLTRLKAFDALAKS 271


>gi|322418946|ref|YP_004198169.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sp. M18]
 gi|320125333|gb|ADW12893.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sp. M18]
          Length = 274

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 137/265 (51%), Positives = 190/265 (71%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +    ++  VL+AGPC IE+       AE+L +IC  + I L++K+S+DKANR+S+  
Sbjct: 8   GDIKIGGDRPLVLVAGPCVIENETATLRHAERLMSICNGVGIPLIFKASYDKANRTSVTA 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+K+G  I   +K+  G P+L+D+H+ +Q E  AD +D+LQIPA LCRQTDLL AA
Sbjct: 68  FRGPGVKEGLRILSKVKESLGVPVLSDIHSIEQVEPAADVLDVLQIPAFLCRQTDLLVAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A TG+VINVKKGQFL+PW+M N++ K+ +   ++++  ERG SFGYN LV DMRS PIM 
Sbjct: 128 ANTGKVINVKKGQFLAPWDMKNVVGKIRSCENENIILTERGASFGYNNLVVDMRSFPIMR 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFDA+HSVQ PG  G  SGG+R+++  L++AAVA G+ GIF+E H++P+ A  D
Sbjct: 188 STGYPVIFDATHSVQLPGGEGTSSGGQREFVEFLSRAAVAAGVDGIFMEVHEEPEQALCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + + DLP LL++L AID I+K
Sbjct: 248 GPNSVRLDDLPVLLNRLKAIDAIVK 272


>gi|224456892|ref|ZP_03665365.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|282158997|gb|ADA78388.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis NE061598]
          Length = 275

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 126/265 (47%), Positives = 178/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   
Sbjct: 5   NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    
Sbjct: 65  RGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G+ +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 125 KQGKPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKA 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDG
Sbjct: 185 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + + LS L  +D ++K 
Sbjct: 245 PNSFPMYKIKEFLSLLKELDHLVKS 269


>gi|62258804|gb|AAX77821.1| unknown protein [synthetic construct]
          Length = 317

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 126/265 (47%), Positives = 178/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   
Sbjct: 38  NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSF 97

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    
Sbjct: 98  RGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVC 157

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G+ +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 158 KQGKPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKA 217

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDG
Sbjct: 218 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDG 277

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + + LS L  +D ++K 
Sbjct: 278 PNSFPMYKIKEFLSLLKELDHLVKS 302


>gi|56707821|ref|YP_169717.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110670292|ref|YP_666849.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis FSC198]
 gi|134302406|ref|YP_001122376.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|254370317|ref|ZP_04986322.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254372575|ref|ZP_04988064.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254874635|ref|ZP_05247345.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|56604313|emb|CAG45334.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320625|emb|CAL08717.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis FSC198]
 gi|134050183|gb|ABO47254.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|151568560|gb|EDN34214.1| hypothetical protein FTBG_00072 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|151570302|gb|EDN35956.1| 3-deoxy-8-phosphooctulonate synthase [Francisella novicida
           GA99-3549]
 gi|254840634|gb|EET19070.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. tularensis MA00-2987]
          Length = 282

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 126/265 (47%), Positives = 178/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   
Sbjct: 12  NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSF 71

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    
Sbjct: 72  RGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVC 131

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G+ +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 132 KQGKPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKA 191

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDG
Sbjct: 192 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDG 251

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + + LS L  +D ++K 
Sbjct: 252 PNSFPMYKIKEFLSLLKELDHLVKS 276


>gi|83858275|ref|ZP_00951797.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853098|gb|EAP90950.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanicaulis alexandrii
           HTCC2633]
          Length = 286

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 148/280 (52%), Positives = 201/280 (71%), Gaps = 1/280 (0%)

Query: 22  IHTNAAIHLGSGKNQV-TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           ++ N  + +      V    NE+   +IAGPCQ+ES +H   +++ L  I     + LVY
Sbjct: 1   MNPNTVVEIPLPHGGVLEMGNEKPLTIIAGPCQLESREHGLEVSQALKEIADRTGVKLVY 60

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANR+SL+GKRG+GL    ++F ++++  G P+LTD+HTE+QC  +A++ DILQI
Sbjct: 61  KTSFDKANRTSLSGKRGLGLSASMDVFNEIRETTGLPLLTDIHTEEQCAIVAEAADILQI 120

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TG+VINVKKGQFL+PW+M N++ K+   G  +V+  ERG SFGY
Sbjct: 121 PAFLCRQTDLLIAAAKTGKVINVKKGQFLAPWDMPNVIGKITGAGNANVIATERGASFGY 180

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           NTLV DMRS PIM   G PV+ DA+H+VQQPG  G  SGG+RQY   LA+A+V++GIAG+
Sbjct: 181 NTLVVDMRSFPIMKQTGAPVVMDATHAVQQPGGQGGSSGGQRQYAPHLARASVSLGIAGV 240

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+ETH DPDNAPSDGPNMI +    +++  L+A D + K 
Sbjct: 241 FMETHPDPDNAPSDGPNMIPLNRFEEVVRDLMAFDALAKS 280


>gi|153002115|ref|YP_001367796.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS185]
 gi|166220459|sp|A6WSE4|KDSA_SHEB8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|151366733|gb|ABS09733.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS185]
          Length = 282

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 124/266 (46%), Positives = 176/266 (66%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++KK +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKKTFNLPLITDVHEVHQCAPVAEVVDIIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGTIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSSFGYNNLVVDMLGMDEMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  D
Sbjct: 189 QSGYPVIFDATHALQRPGGRADSAGGRRAQAAELARSGMALGLAGLFIEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L Q+ AID ++K 
Sbjct: 249 GPCALPLHQLENYLKQMKAIDDLVKS 274


>gi|126172951|ref|YP_001049100.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS155]
 gi|160876835|ref|YP_001556151.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS195]
 gi|217974694|ref|YP_002359445.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS223]
 gi|304410650|ref|ZP_07392268.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS183]
 gi|307304747|ref|ZP_07584497.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           BA175]
 gi|166220458|sp|A3D0G8|KDSA_SHEB5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|189028416|sp|A9L2C8|KDSA_SHEB9 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|254807751|sp|B8E809|KDSA_SHEB2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|125996156|gb|ABN60231.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS155]
 gi|160862357|gb|ABX50891.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS195]
 gi|217499829|gb|ACK48022.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS223]
 gi|304351134|gb|EFM15534.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS183]
 gi|306912149|gb|EFN42573.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           BA175]
 gi|315269038|gb|ADT95891.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella baltica
           OS678]
          Length = 282

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 124/266 (46%), Positives = 176/266 (66%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++KK +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKKTFNLPLITDVHEVHQCAPVAEVVDIIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSSFGYNNLVVDMLGMDEMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  D
Sbjct: 189 QSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L Q+ AID ++K 
Sbjct: 249 GPCALPLHQLENYLKQMKAIDDLVKS 274


>gi|220932727|ref|YP_002509635.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halothermothrix orenii H
           168]
 gi|219994037|gb|ACL70640.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halothermothrix orenii H
           168]
          Length = 279

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 130/268 (48%), Positives = 180/268 (67%), Gaps = 1/268 (0%)

Query: 34  KNQVTFSN-EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
              + F +  +  VLIAGPC +E  D    IAE +  I   L I  V+KSS+DKANRSS+
Sbjct: 11  NQDIVFGDSNRPLVLIAGPCVLEEEDRVLKIAETVKEITSRLGIPYVFKSSYDKANRSSI 70

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG GL+ G ++   +K++ G P+LTDVH   Q    A+ VDI+QIPA L RQTDL+ 
Sbjct: 71  KSFRGPGLEDGLKLLERVKREVGVPLLTDVHEPDQAALAAEVVDIVQIPAFLSRQTDLVV 130

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           AA +TG+++NVKKGQFL+PW++  +++K+ + G + +L  ERG SFGYN LV DMRS+P 
Sbjct: 131 AAGRTGKIVNVKKGQFLAPWDIDRVVEKIESTGNEKILLTERGVSFGYNNLVVDMRSLPR 190

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M   G PV+FDA+HSVQ PG  G  SGG+R+++  L +AAV  G+  +F+E H +PD A 
Sbjct: 191 MRETGYPVVFDATHSVQLPGGAGETSGGDRKFVPYLTRAAVGTGVDALFMEVHDNPDVAL 250

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           SDGPNM+ +  L  +L + LAID+I+K 
Sbjct: 251 SDGPNMVPLDQLEGILIKALAIDEIVKG 278


>gi|303257814|ref|ZP_07343824.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderiales bacterium
           1_1_47]
 gi|330998764|ref|ZP_08322492.1| 3-deoxy-8-phosphooctulonate synthase [Parasutterella
           excrementihominis YIT 11859]
 gi|302859417|gb|EFL82498.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderiales bacterium
           1_1_47]
 gi|329576261|gb|EGG57777.1| 3-deoxy-8-phosphooctulonate synthase [Parasutterella
           excrementihominis YIT 11859]
          Length = 284

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 123/271 (45%), Positives = 173/271 (63%), Gaps = 6/271 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  + F+L+AGPC IES      IA K+  I   L I  V+K+S+DKANRSS    
Sbjct: 5   GFEVGLNRPFILLAGPCVIESEQLTLDIAGKMKEITDKLGIPYVFKASYDKANRSSDTSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+  G  I  +++++ G P++TDVHT  +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMTNGLRILEEVRRQIGVPVVTDVHTADEVPEVAAVVDLLQTPAFLCRQTDFIAACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M  ++ K               + CERG  FGYN LV+DMRS
Sbjct: 125 KSGKPVNIKKGQFLAPQDMKQVVLKARHAAAAAGLSEDRFMVCERGACFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PVIFDA+HSVQ PG  G  SGG R+++ PLA+AAVA+G++G+F+ETH +P 
Sbjct: 185 LVIMRDCDAPVIFDATHSVQLPGGQGTSSGGRREFVPPLARAAVAVGVSGLFMETHPNPC 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            A SDGPNM+ +  +  LL+ L  ID+++K 
Sbjct: 245 CAKSDGPNMVPLDKMEALLTNLQGIDRLVKS 275


>gi|49475364|ref|YP_033405.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella henselae str.
           Houston-1]
 gi|59798265|sp|Q6G409|KDSA_BARHE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|49238170|emb|CAF27379.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella henselae str.
           Houston-1]
          Length = 279

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 173/277 (62%), Positives = 216/277 (77%), Gaps = 4/277 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
            NA + +G     + FSNE  F LIAGPCQIES DHAF +A ++  I   + IG VYKSS
Sbjct: 4   PNAIVKVG----NIIFSNEAPFSLIAGPCQIESRDHAFEMAGRIKTITDQVGIGFVYKSS 59

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           +DKANR+SL+  RGVGL+    IF DLKK++G PILTDVHTE+QC  +A +VDILQIPA 
Sbjct: 60  YDKANRTSLSAVRGVGLENAMAIFSDLKKEFGCPILTDVHTEEQCTVVASTVDILQIPAF 119

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRVIN+KKGQFL+PW+M N+L+K+   G ++V+ CERGTSFGYN L
Sbjct: 120 LCRQTDLLVAAAKTGRVINIKKGQFLAPWDMKNVLRKVTQSGNRNVMLCERGTSFGYNRL 179

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           ++DMRS+PI+ S G PVIFDA+HSVQ+PG  G+ SGG+RQ++  LA+AAV++G+AGIFLE
Sbjct: 180 ISDMRSLPILRSFGAPVIFDATHSVQEPGGQGDSSGGQRQFVEILARAAVSVGVAGIFLE 239

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           THQDPDNAPSDGPNMI I  L +LL  L+  D + K 
Sbjct: 240 THQDPDNAPSDGPNMIKIDHLQRLLETLMEFDYLSKK 276


>gi|118497210|ref|YP_898260.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. novicida U112]
 gi|194323509|ref|ZP_03057286.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           novicida FTE]
 gi|254807746|sp|A0Q5J1|KDSA_FRATN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|118423116|gb|ABK89506.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthase [Francisella
           novicida U112]
 gi|194322364|gb|EDX19845.1| 3-deoxy-8-phosphooctulonate synthase [Francisella tularensis subsp.
           novicida FTE]
          Length = 275

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 126/265 (47%), Positives = 178/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   
Sbjct: 5   NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTRDLGINFVYKSSFDKANRSSINSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    
Sbjct: 65  RGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G+ +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 125 KQGKPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKA 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDG
Sbjct: 185 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + + LS L  +D ++K 
Sbjct: 245 PNSFPMYKIKEFLSLLKELDHLVKS 269


>gi|170728005|ref|YP_001762031.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella woodyi ATCC
           51908]
 gi|238688638|sp|B1KDA1|KDSA_SHEWM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|169813352|gb|ACA87936.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella woodyi ATCC
           51908]
          Length = 282

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 123/268 (45%), Positives = 176/268 (65%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
           G   +  +N++ FVL  G   +ES D A  IAE      Q L I  V+K+SFDKANRSS+
Sbjct: 7   GLGSIEIANDKPFVLFGGMNVLESRDLAMKIAETYAETTQKLGIPYVFKASFDKANRSSV 66

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG G+++G +IF ++K  +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ 
Sbjct: 67  NSYRGPGMEEGLKIFEEIKSTFNLPLITDVHEIHQCAPVAEVVDIIQLPAFLARQTDLVV 126

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN LV DM  +  
Sbjct: 127 AMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSSFGYNNLVVDMLGMDE 186

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA 
Sbjct: 187 MKQTGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAK 246

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP  + +  L   L+Q+ A+D ++K 
Sbjct: 247 CDGPCALPLHQLEAYLTQMKAVDDLVKS 274


>gi|254369703|ref|ZP_04985713.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica FSC022]
 gi|157122662|gb|EDO66791.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. holarctica FSC022]
          Length = 282

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 127/265 (47%), Positives = 178/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   
Sbjct: 12  NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSF 71

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    
Sbjct: 72  RGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVC 131

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G+ +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 132 KQGKPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKA 191

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDG
Sbjct: 192 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDG 251

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + + LS L  +D +IK 
Sbjct: 252 PNSFPMYKIKEFLSLLKELDHLIKS 276


>gi|330839731|ref|YP_004414311.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Selenomonas sputigena
           ATCC 35185]
 gi|329747495|gb|AEC00852.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Selenomonas sputigena
           ATCC 35185]
          Length = 276

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 135/265 (50%), Positives = 178/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
             T       VL+AGPC +E  +   +I   +  I   L I  ++K+SFDKANRSS    
Sbjct: 9   DFTIGGGSPLVLMAGPCVLEEMERCLLIGRTIKEITARLGIPYIFKASFDKANRSSFNSF 68

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GLKKG E+ + +K++   P++TDVH E Q    A  VD+LQIPA LCRQTDL+ AAA
Sbjct: 69  RGPGLKKGLEMLQAIKEELDVPVVTDVHKESQIAPAAKVVDVLQIPAFLCRQTDLIYAAA 128

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           ++G V+NVKKGQFL+P +M N++ KLH  G  D+L  ERG SFGYN LV DMRS PIM +
Sbjct: 129 KSGCVVNVKKGQFLAPRDMGNVVDKLHEGGCSDILLTERGASFGYNNLVVDMRSFPIMRT 188

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFDA+HSVQ PG  G  SGG R+++ PLA+AAVA G+ G+F+E H +P+ A  DG
Sbjct: 189 FGAPVIFDATHSVQLPGGAGTSSGGNREFVEPLARAAVAAGVDGLFMEVHDNPEEALCDG 248

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN + +  L +LL ++LAI  ++K 
Sbjct: 249 PNSLYLDKLEELLKEVLAIYNVVKG 273


>gi|260886286|ref|ZP_05897549.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas sputigena ATCC
           35185]
 gi|260864005|gb|EEX78505.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas sputigena ATCC
           35185]
          Length = 296

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 135/265 (50%), Positives = 178/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
             T       VL+AGPC +E  +   +I   +  I   L I  ++K+SFDKANRSS    
Sbjct: 29  DFTIGGGSPLVLMAGPCVLEEMERCLLIGRTIKEITARLGIPYIFKASFDKANRSSFNSF 88

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GLKKG E+ + +K++   P++TDVH E Q    A  VD+LQIPA LCRQTDL+ AAA
Sbjct: 89  RGPGLKKGLEMLQAIKEELDVPVVTDVHKESQIAPAAKVVDVLQIPAFLCRQTDLIYAAA 148

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           ++G V+NVKKGQFL+P +M N++ KLH  G  D+L  ERG SFGYN LV DMRS PIM +
Sbjct: 149 KSGCVVNVKKGQFLAPRDMGNVVDKLHEGGCSDILLTERGASFGYNNLVVDMRSFPIMRT 208

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFDA+HSVQ PG  G  SGG R+++ PLA+AAVA G+ G+F+E H +P+ A  DG
Sbjct: 209 FGAPVIFDATHSVQLPGGAGTSSGGNREFVEPLARAAVAAGVDGLFMEVHDNPEEALCDG 268

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN + +  L +LL ++LAI  ++K 
Sbjct: 269 PNSLYLDKLEELLKEVLAIYNVVKG 293


>gi|91776262|ref|YP_546018.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacillus
           flagellatus KT]
 gi|123078804|sp|Q1H010|KDSA_METFK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|91710249|gb|ABE50177.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacillus
           flagellatus KT]
          Length = 279

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 132/267 (49%), Positives = 180/267 (67%), Gaps = 2/267 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q   LIAGPC IES + A   A +L  I  +L I  +YKSS+DKANRSS    
Sbjct: 5   GFEVGIDQPLFLIAGPCVIESQEMAIETAGQLKEITTALGINFIYKSSYDKANRSSNKTF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+ +G +I  +++++ G PILTDVHTE Q   +A  VD+LQ PA LCRQTD +TA A
Sbjct: 65  RGFGMDEGLKILDEVRRQVGVPILTDVHTEAQVPHVAAVVDVLQTPAFLCRQTDFITACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHG--AKDVLFCERGTSFGYNTLVTDMRSIPIM 213
           Q+G+ +N+KKGQFL+P +M  ++QK       A  ++ CERG SFGYNTL++DMR + IM
Sbjct: 125 QSGKPVNIKKGQFLAPGDMKQVVQKAKEANGGADTIMVCERGASFGYNTLISDMRGLAIM 184

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
                PV+FDA+HSVQQPG  G+ SGG+R+++  LA+AAVA G+AG+F+ETH DP  A S
Sbjct: 185 RETNCPVVFDATHSVQQPGGQGDKSGGQREFVPVLARAAVASGVAGVFMETHPDPAQALS 244

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGPN   +  +  LL  L+ +D+++K 
Sbjct: 245 DGPNAWPLSKMKALLEVLVDLDRVVKK 271


>gi|208779003|ref|ZP_03246349.1| 3-deoxy-8-phosphooctulonate synthase [Francisella novicida FTG]
 gi|208744803|gb|EDZ91101.1| 3-deoxy-8-phosphooctulonate synthase [Francisella novicida FTG]
          Length = 275

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 127/265 (47%), Positives = 178/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   
Sbjct: 5   NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    
Sbjct: 65  RGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + GR +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 125 KQGRPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKA 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDG
Sbjct: 185 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + + LS L  +D ++K 
Sbjct: 245 PNSFPMYKIKEFLSLLKELDHLVKS 269


>gi|93006698|ref|YP_581135.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychrobacter
           cryohalolentis K5]
 gi|92394376|gb|ABE75651.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychrobacter
           cryohalolentis K5]
          Length = 291

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 128/283 (45%), Positives = 178/283 (62%), Gaps = 1/283 (0%)

Query: 19  NHMIHTNAAIHLGSGKN-QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIG 77
            +++   + I L +  N  ++  N+Q FVL  G   +ES + AF IAE+   ICQ L IG
Sbjct: 2   ENLLTAQSHIQLNTPDNKNISIGNDQPFVLFGGMNVLESKEMAFEIAEQYVDICQRLGIG 61

Query: 78  LVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDI 137
            V+K+SFDKANRSSL   RG GL+KG +    +K+K+  PI+TDVH   Q   +A+  DI
Sbjct: 62  YVFKASFDKANRSSLTSYRGPGLEKGIDWLGQIKEKFQVPIITDVHEPYQAAPVAEVADI 121

Query: 138 LQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTS 197
           +Q+PA L RQTDL+ A A+T  +IN+KK QFL+P EM +I+ K    G   ++ CERG++
Sbjct: 122 IQLPAFLSRQTDLVHAMAKTDAIINIKKAQFLAPHEMRHIVNKCLEGGNDKLILCERGSA 181

Query: 198 FGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGI 257
           FGYN LV DM     M  M +PV FD +HS+QQPG   + +GG R+ I  LA+A +A GI
Sbjct: 182 FGYNNLVVDMLGFDTMKQMEIPVFFDVTHSLQQPGGRSDSAGGRREQITTLARAGMATGI 241

Query: 258 AGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           AG+FLE H +P+ A  DGP  + +  L   L QL  +D ++K 
Sbjct: 242 AGLFLEAHPNPEVAKCDGPCALRMSQLEPFLRQLKQLDDLVKG 284


>gi|328676682|gb|AEB27552.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Francisella cf. novicida Fx1]
          Length = 275

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 127/265 (47%), Positives = 178/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   
Sbjct: 5   NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTRDLGINFVYKSSFDKANRSSINSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    
Sbjct: 65  RGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + GR +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 125 KQGRPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKA 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDG
Sbjct: 185 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + + LS L  +D ++K 
Sbjct: 245 PNSFPMYKIKEFLSLLKELDHLVKS 269


>gi|194289290|ref|YP_002005197.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cupriavidus taiwanensis
           LMG 19424]
 gi|238692756|sp|B3R497|KDSA_CUPTR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|193223125|emb|CAQ69130.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Cupriavidus
           taiwanensis LMG 19424]
          Length = 289

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 130/270 (48%), Positives = 177/270 (65%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAGPC IES   A   A +L AI   L I  +YKSSFDKANRSS    
Sbjct: 5   GFEVGLDKPFFLIAGPCVIESEQMALDTAGELKAITTELGIPFIYKSSFDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G++KG EI   +K++ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMEKGLEILAHVKREIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLPDDVFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA G+AG+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVATGVAGLFMETHPDPS 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  + +LL+ L  +D ++K
Sbjct: 245 KAMSDGPNAVPLSRMKELLTVLKELDTLVK 274


>gi|206889727|ref|YP_002249520.1| 3-deoxy-8-phosphooctulonate synthase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741665|gb|ACI20722.1| 3-deoxy-8-phosphooctulonate synthase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 271

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 134/270 (49%), Positives = 183/270 (67%), Gaps = 1/270 (0%)

Query: 32  SGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSS 91
              N      +    LIAGPC IES +  F  A  L  I Q+L I  ++KSS+DKANRSS
Sbjct: 3   FSINNTRI-QKNELFLIAGPCVIESEEIVFKTAFALKEISQNLKIPFIFKSSYDKANRSS 61

Query: 92  LAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLL 151
           +   RG G+KKG EI   +KK++  P+L+DVH+ ++ +   D +DI+QIPA LCRQTD++
Sbjct: 62  INSYRGPGIKKGLEILNKVKKEFEVPVLSDVHSVEEVQIAKDFLDIIQIPAFLCRQTDII 121

Query: 152 TAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIP 211
              A+TG+ +NVKKGQFL+PW++ NI++K+ + G + ++  ERGTSFGYN LV D RS P
Sbjct: 122 VEVAKTGKPVNVKKGQFLAPWDVKNIIEKIKSTGNEKIIITERGTSFGYNNLVVDFRSFP 181

Query: 212 IMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
           I+ SMGV V+FDA+HSVQ PG  G CS G+R++I  L++AAVA G+ G+F E H +P+ A
Sbjct: 182 IIRSMGVFVVFDATHSVQLPGGAGTCSSGQREFIPYLSRAAVACGVDGLFFEVHPEPEKA 241

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
             DGPNMI +KD   L+  LL I   +K L
Sbjct: 242 LCDGPNMIPLKDFKNLILTLLEIHNTVKKL 271


>gi|254524316|ref|ZP_05136371.1| 3-deoxy-8-phosphooctulonate synthase [Stenotrophomonas sp. SKA14]
 gi|219721907|gb|EED40432.1| 3-deoxy-8-phosphooctulonate synthase [Stenotrophomonas sp. SKA14]
          Length = 276

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 124/265 (46%), Positives = 170/265 (64%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q   LIAGPC IES       A KL  I   L +  ++KSSFDKANR+S    
Sbjct: 5   GFEVGLDQPLFLIAGPCVIESMQLQLDTAGKLKEITDRLGVNFIFKSSFDKANRTSGTAF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G ++  ++KK+ G P+LTDVH     E +A  VD+LQ PA L RQTD +    
Sbjct: 65  RGPGMEEGLKVLAEVKKQIGVPVLTDVHEYTPMEEVASVVDVLQTPAFLVRQTDFIRKVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
             G+ +N+KKGQFL+PW+M  +++K  A G + ++ CERG SFGYN LV+DMRS+ +M  
Sbjct: 125 SAGKPVNIKKGQFLAPWDMKPVVEKAKATGNEQIMVCERGASFGYNNLVSDMRSLAVMRD 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP  A SDG
Sbjct: 185 TGCPVVFDATHSVQLPGGQGTSSGGQREHVPVLARAAVAVGISGLFAETHPDPSKALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  +  LL  L+ +D + K 
Sbjct: 245 PNAWPLDQMEALLETLMELDAVTKK 269


>gi|157376582|ref|YP_001475182.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sediminis
           HAW-EB3]
 gi|189028419|sp|A8FYY1|KDSA_SHESH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|157318956|gb|ABV38054.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella sediminis
           HAW-EB3]
          Length = 282

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 122/268 (45%), Positives = 175/268 (65%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
           G   +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+
Sbjct: 7   GLGSIEIANDKPFVLFGGMNVLESRDLAMKIAETYAEVTQKLGIPYVFKASFDKANRSSV 66

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG G+++G +IF ++K  +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ 
Sbjct: 67  NSYRGPGMEEGLKIFEEIKSTFNLPLITDVHEVHQCAPVAEVVDIIQLPAFLARQTDLVV 126

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           A A+T  +INVKK QFL+P EM +I+ K +  G   ++ CERG+SFGYN LV DM  +  
Sbjct: 127 AMAKTDAIINVKKPQFLAPHEMRHIITKFNEAGNDKIILCERGSSFGYNNLVVDMLGMDE 186

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA 
Sbjct: 187 MKQSGYPVIFDATHALQRPGGRSDSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAK 246

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP  + +  L   L+Q+ A+D ++K 
Sbjct: 247 CDGPCALPLHQLEAYLTQMKAVDDLVKS 274


>gi|119775693|ref|YP_928433.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella amazonensis
           SB2B]
 gi|158513092|sp|A1S8Q7|KDSA_SHEAM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|119768193|gb|ABM00764.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Shewanella amazonensis SB2B]
          Length = 282

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 123/266 (46%), Positives = 178/266 (66%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  IAEK   + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIAIANDKPFVLFGGMNVLESRDLAMSIAEKYLEVTQKLGIPYVFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF+++K  +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFQEIKDTFNVPLITDVHEPHQCAPVAEVVDIIQLPAFLARQTDLVIAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I++K +  G  +++ CERG+ FGYN LV DM  +  M 
Sbjct: 129 ARTGAIINVKKPQFLAPHEMRHIVKKFNEAGNDEIILCERGSCFGYNNLVVDMLGMDEMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA  D
Sbjct: 189 QSGYPVIFDATHALQRPGGREDSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   LSQ+ A+D ++K 
Sbjct: 249 GPCALPLHQLEAYLSQMKAVDDLVKS 274


>gi|212634001|ref|YP_002310526.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella piezotolerans
           WP3]
 gi|226722937|sp|B8CKA0|KDSA_SHEPW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|212555485|gb|ACJ27939.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella piezotolerans
           WP3]
          Length = 282

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 122/268 (45%), Positives = 176/268 (65%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
               +  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+
Sbjct: 7   DLGSIEIANDKPFVLFGGMNVLESRDLAMQIAETYAEVTQKLGIPYVFKASFDKANRSSV 66

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG G+++G +IF ++K  +  P++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ 
Sbjct: 67  NSYRGPGMEEGLKIFEEIKSTFNLPLITDVHEVHQCAPVAEVVDIIQLPAFLARQTDLVV 126

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           A A+TG +INVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN LV DM  +  
Sbjct: 127 AMAKTGAIINVKKPQFLAPHEMRHIISKFNEAGNDEIILCERGSSFGYNNLVVDMLGMDE 186

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DPDNA 
Sbjct: 187 MKQSGYPVIFDATHALQKPGGRSDSAGGRRAQATELARSGMALGLAGLFIEAHPDPDNAK 246

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP  + +  L   L+Q+ A+D ++K 
Sbjct: 247 CDGPCALPLHQLENYLTQMKAVDDLVKS 274


>gi|163868052|ref|YP_001609256.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella tribocorum
           CIP 105476]
 gi|189028406|sp|A9IS46|KDSA_BART1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|161017703|emb|CAK01261.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella tribocorum CIP 105476]
          Length = 278

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 167/279 (59%), Positives = 214/279 (76%), Gaps = 4/279 (1%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             NA + +G     + FSNE    LIAGPCQ+ES DHAF +A ++  +   L IG VYKS
Sbjct: 3   KPNARVKVG----NIIFSNEMPLSLIAGPCQMESRDHAFEMAGRIKTMTDQLGIGFVYKS 58

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           S+DKANR+SL+  RG+GL+K   IF DLKK++  PILTDVHTE+QC  ++ +VDILQIPA
Sbjct: 59  SYDKANRTSLSAARGIGLEKAMAIFSDLKKEFDCPILTDVHTEEQCTIVSSTVDILQIPA 118

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            LCRQTDLL AAA+TG V+N+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGYN 
Sbjct: 119 FLCRQTDLLVAAAKTGCVVNIKKGQFLAPWDMENVLKKVVHSGNPNVMLCERGTSFGYNR 178

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           L++DMRS+PI+ S G PVIFDA+HSVQ+PG  G  SGG+RQ++  LA+AAV++G+AGIFL
Sbjct: 179 LISDMRSLPILRSFGAPVIFDATHSVQEPGGQGASSGGQRQFVEVLARAAVSVGVAGIFL 238

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           ETHQDPD+APSDGPNMI I DL +L+  L+  D + K L
Sbjct: 239 ETHQDPDHAPSDGPNMIKIDDLQRLIETLMEFDDLSKKL 277


>gi|121998220|ref|YP_001003007.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halorhodospira halophila
           SL1]
 gi|121589625|gb|ABM62205.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halorhodospira halophila
           SL1]
          Length = 278

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 124/265 (46%), Positives = 179/265 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 EQ   LIAGPC +ES   A   A +L  +C  L + L+YKSSFDKANRSS    
Sbjct: 8   GFRAGIEQPLFLIAGPCVVESEALALESALELRDLCAELGVPLIYKSSFDKANRSSAQSY 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G++ G  +   ++++ G P++TDVH +   + +A  VD+LQ PA LCRQT+ +   A
Sbjct: 68  RGPGMEAGLRVLERVRREVGVPVVTDVHEDTPLDEVASVVDVLQTPAFLCRQTNFIQRVA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
             G  +N+KKGQFL+PW+M +++ K  A G + +L CERG SFGYN L++DMR++ +M  
Sbjct: 128 ACGLPVNLKKGQFLAPWDMTHVVDKARATGNEHILVCERGVSFGYNNLISDMRALAVMRQ 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  LA+AAVA G++G+F+ETH DPD A SDG
Sbjct: 188 TGAPVVFDATHSVQLPGGQGHASGGQREFVPVLARAAVAAGVSGLFMETHPDPDAALSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + +LL+ L+A+D+++K 
Sbjct: 248 PNAWPLDRMRELLATLIALDRVVKE 272


>gi|239816417|ref|YP_002945327.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Variovorax paradoxus
           S110]
 gi|259494409|sp|C5CSV4|KDSA_VARPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|239802994|gb|ACS20061.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Variovorax paradoxus
           S110]
          Length = 285

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 135/271 (49%), Positives = 174/271 (64%), Gaps = 6/271 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q F LIAGPC +ES       A  L  I  SL I  ++KSSFDKANRSS    
Sbjct: 5   GFDIGLDQPFFLIAGPCVVESEQLQMDTAGTLKEITSSLGIPFIFKSSFDKANRSSGTSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G +KG EI   +K++ G P+LTDVHTE      A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGPGREKGLEILAKVKRELGLPVLTDVHTEDDITEAAKVVDVLQTPAFLCRQTDFIRAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K  A            + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARAAAKEAGLPEDSFMACERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+ +  L++AAVA+G+AG+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTTSGGQREMVPVLSRAAVAVGVAGLFMETHPDPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            A SDGPN + +K +  LL  LLA+D++ K 
Sbjct: 245 KALSDGPNAVPLKHMKALLETLLALDQVTKK 275


>gi|329903712|ref|ZP_08273588.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548233|gb|EGF32932.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 284

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 133/271 (49%), Positives = 185/271 (68%), Gaps = 6/271 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q F LIAGPC IES   AF  A +L  I  +L I  +YKSSFDKANRSS    
Sbjct: 5   GFDIGLDQPFFLIAGPCVIESRQMAFDTAGQLKEITAALGIPFIYKSSFDKANRSSGTSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI  D+K++ G P+LTD+H  ++ + ++  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDKGLEILADVKRELGVPVLTDIHAIEEIKPVSAVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+GR +N+KKGQFL+P +M N++ K  A          + + CERG SFGYN LV+DMRS
Sbjct: 125 QSGRPVNIKKGQFLAPHDMVNVINKARAAAKEAGLAEDNFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G P++FDA+HSVQ PG  G+ SGG+R+++  LA+AAVA+GI+G+F+ETH +P 
Sbjct: 185 LAIMRETGCPIVFDATHSVQLPGGQGSSSGGQREFVPVLARAAVAVGISGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            A SDGPN + +  + +LLS L+ +D+++K 
Sbjct: 245 EAMSDGPNAVPLGRMRELLSTLIELDRVVKK 275


>gi|190573695|ref|YP_001971540.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Stenotrophomonas
           maltophilia K279a]
 gi|229830631|sp|B2FK85|KDSA_STRMK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|190011617|emb|CAQ45236.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase
           [Stenotrophomonas maltophilia K279a]
          Length = 276

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 121/265 (45%), Positives = 170/265 (64%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q   LIAGPC IES       A KL  +   L +  ++KSSFDKANR+S    
Sbjct: 5   GFEVGLDQPLFLIAGPCVIESMQLQLDTAGKLKEVTDKLGVNFIFKSSFDKANRTSGTAF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G ++  +++K+ G P+LTDVH     + +A  VD+LQ PA L RQTD +    
Sbjct: 65  RGPGMEEGLKVLAEVRKQIGVPVLTDVHEYTPMDEVASVVDVLQTPAFLVRQTDFIRKVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
             G+ +N+KKGQFL+PW+M  +++K  A G + ++ CERG SFGYN LV+DMRS+ +M  
Sbjct: 125 SAGKPVNIKKGQFLAPWDMKPVVEKAKATGNEQIMVCERGASFGYNNLVSDMRSLAVMRD 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP  A SDG
Sbjct: 185 TGCPVVFDATHSVQLPGGQGTSSGGQREHVPVLARAAVAVGISGLFAETHPDPSKALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  +  LL  L+ +D + K 
Sbjct: 245 PNAWPLDQMEALLETLMELDAVTKK 269


>gi|121604092|ref|YP_981421.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polaromonas
           naphthalenivorans CJ2]
 gi|158513868|sp|A1VLH2|KDSA_POLNA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|120593061|gb|ABM36500.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polaromonas
           naphthalenivorans CJ2]
          Length = 285

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 136/271 (50%), Positives = 177/271 (65%), Gaps = 6/271 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q F LIAGPC +ES       A  L  I  SL I  ++KSS+DKANRSS    
Sbjct: 5   GFDIGLDQPFFLIAGPCVVESEQLQMDTAGTLKEITASLGIPFIFKSSYDKANRSSGTSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G++KG +I   +K++ G PILTDVH+E +  A+A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGPGMEKGLQILAKVKRELGLPILTDVHSEAEITAVAAVVDVLQTPAFLCRQTDFIHAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+GR +N+KKGQFL+P +M N++ K  A            + CERG SFGYN LV+DMRS
Sbjct: 125 QSGRPVNIKKGQFLAPGDMKNVIDKARAAAREKGLDEDRFMACERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+ +  LA+AAVA+GIAG+F+ETH DP 
Sbjct: 185 LAIMRETRAPVVFDATHSVQLPGGMGTSSGGQREMVPVLARAAVAVGIAGLFMETHPDPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           NA SDGPN + +K +  LL  LL +D++ K 
Sbjct: 245 NAMSDGPNAVPLKHMKALLETLLELDRVTKK 275


>gi|74316638|ref|YP_314378.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thiobacillus
           denitrificans ATCC 25259]
 gi|123759171|sp|Q3SL44|KDSA_THIDA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|74056133|gb|AAZ96573.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thiobacillus
           denitrificans ATCC 25259]
          Length = 280

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 133/264 (50%), Positives = 174/264 (65%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q   LI+GPC IES   A   A +L  +C  L I  +YKSSFDKANRSS    
Sbjct: 5   HFEAGLDQPLFLISGPCVIESEQLAMDTAGQLKEMCAGLGIPFIYKSSFDKANRSSTKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+GL++G  I  D+K K G P+LTDVH +   + +A  VD+LQ PA LCRQT+ +   A
Sbjct: 65  RGLGLEEGLRILADVKAKIGVPVLTDVHEDTPLDEVAAVVDVLQTPAFLCRQTNFIQNVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + GR +N+KKGQFL+PW+M N++ K    G   ++ CERG SFGYNTLV+DMR + IM  
Sbjct: 125 RAGRPVNIKKGQFLAPWDMQNVVDKAREVGNDQIMVCERGVSFGYNTLVSDMRGLAIMRG 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA G+AG+F ETH DP  A SDG
Sbjct: 185 TGCPVVFDATHSVQQPGGQGATSGGQREFVPVLARAAVASGVAGVFAETHPDPACALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN   +  + +LL  L  ID ++K
Sbjct: 245 PNAWPLGMMRELLETLKEIDALVK 268


>gi|197117988|ref|YP_002138415.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter bemidjiensis
           Bem]
 gi|226761659|sp|B5E8N4|KDSA_GEOBB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|197087348|gb|ACH38619.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Geobacter bemidjiensis Bem]
          Length = 273

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 136/275 (49%), Positives = 187/275 (68%), Gaps = 4/275 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
               I +G     V     +   L+AGPC IE+       AE+L +IC  + I L++K+S
Sbjct: 1   MTREITVGG----VKIGGGRPLALVAGPCVIENETATLRCAERLMSICNGVGISLIFKAS 56

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           +DKANR+S+   RG G+K+G  I   +K+  G P+L+D+H+ +Q E  A+ +D+LQIPA 
Sbjct: 57  YDKANRTSVTAFRGPGMKEGLRILAKVKEALGVPVLSDIHSIEQVEPAAEVLDVLQIPAF 116

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AA  TG+VINVKKGQFL+PW+M N++ K+ +    +++  ERG SFGYN L
Sbjct: 117 LCRQTDLLVAAGNTGKVINVKKGQFLAPWDMKNVVGKISSCDNDNIILTERGASFGYNNL 176

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DMRS PIM S G PVIFDA+HSVQ PG  G  SGG+R+Y+  L++AAVA G+ GIF+E
Sbjct: 177 VVDMRSFPIMRSTGYPVIFDATHSVQLPGGEGTSSGGQREYVEFLSRAAVAAGVDGIFME 236

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKII 298
            H++P+ A  DGPN + + D+P LL +L AID I+
Sbjct: 237 VHEEPEQALCDGPNSVRLDDMPALLKKLKAIDAIV 271


>gi|146329714|ref|YP_001209280.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dichelobacter nodosus
           VCS1703A]
 gi|254807740|sp|A5EW23|KDSA_DICNV RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|146233184|gb|ABQ14162.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dichelobacter nodosus
           VCS1703A]
          Length = 277

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 132/264 (50%), Positives = 177/264 (67%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N++ F LIAGPC IES   A   AE L  I   L I  +YKSSFDKANRSS A  
Sbjct: 5   DFDVDNDRPFFLIAGPCVIESEYLALHTAEVLKTITDELKIPFIYKSSFDKANRSSGASF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+GL +G  I   +K+ +  PILTDVH     + +A  VD+LQ PA LCRQTD +T   
Sbjct: 65  RGLGLAEGLRILAKVKETFAVPILTDVHEYTPLDEVASVVDVLQTPAFLCRQTDFITRVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
             G+ +N+KKGQFL+PW+M +++ K  A G + ++ CERG SFGYN LV DMRS+ +M +
Sbjct: 125 AQGKPVNIKKGQFLAPWDMKHVVAKAKATGNEQIMLCERGASFGYNNLVADMRSLAVMKT 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQ PG +G  SGG+R+++  LA+AA+A+G+AGIF+ETH +P+ A SDG
Sbjct: 185 FSAPVVFDATHSVQLPGGNGASSGGQREFVPVLARAAIAVGVAGIFMETHPEPEKALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
            N I +  +  LL QL A+D ++K
Sbjct: 245 ANSIPLAQMRHLLQQLRALDTLVK 268


>gi|114561911|ref|YP_749424.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella frigidimarina
           NCIMB 400]
 gi|122300706|sp|Q087H9|KDSA_SHEFN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|114333204|gb|ABI70586.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shewanella frigidimarina
           NCIMB 400]
          Length = 283

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 126/272 (46%), Positives = 179/272 (65%)

Query: 29  HLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKAN 88
            +    N V  +N++ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKAN
Sbjct: 4   KIIQLSNNVQVANDKPFVLFGGMNVLESRDLAMSIAEHYVEVTQKLGIPYVFKASFDKAN 63

Query: 89  RSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQT 148
           RSS+   RG G+++G  IF ++K  +  P++TDVH   QC  +A+ VDI+Q+PA L RQT
Sbjct: 64  RSSVNSYRGPGMEEGLRIFEEIKSTFNVPMITDVHEIHQCAPVAEVVDIIQLPAFLARQT 123

Query: 149 DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMR 208
           DL+ A A+TG VINVKK QFL+P EM +I+ K +  G  +++ CERG+SFGYN LV DM 
Sbjct: 124 DLVVAMAKTGAVINVKKPQFLAPHEMRHIITKFNEAGNDNIILCERGSSFGYNNLVVDML 183

Query: 209 SIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP 268
            +  M   G PVIFDA+H++Q+PG   + +GG R     LA++ +A+G+AG+F+E H DP
Sbjct: 184 GMDEMKQTGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIEAHPDP 243

Query: 269 DNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DNA  DGP  + +  L K L+Q+ A+D+++K 
Sbjct: 244 DNAKCDGPCALPLHLLEKYLTQMKAVDELVKS 275


>gi|329847846|ref|ZP_08262874.1| 3-deoxy-8-phosphooctulonate synthase [Asticcacaulis biprosthecum
           C19]
 gi|328842909|gb|EGF92478.1| 3-deoxy-8-phosphooctulonate synthase [Asticcacaulis biprosthecum
           C19]
          Length = 271

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 141/268 (52%), Positives = 192/268 (71%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
               +    ++ F LIAGPCQIES DHA M+AE++   C       +YKSS+DKANRSS+
Sbjct: 3   EVGGIQIGGDEPFALIAGPCQIESRDHALMMAERIAEACAPTGTKFIYKSSYDKANRSSI 62

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG+G+ +G +I  D++ ++G P+LTDVH   QC  +   VD++QIPA LCRQTDLL 
Sbjct: 63  GTARGIGMDEGLQILADVRAQFGCPVLTDVHDAYQCPPVGQVVDVIQIPAFLCRQTDLLL 122

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           AA +TG+ INVKKGQFL+PW+M N+ +K+ + G + V+ C+RGTSFGYNTLVTD R +PI
Sbjct: 123 AAGETGKAINVKKGQFLAPWDMANVAKKIASTGNERVMLCDRGTSFGYNTLVTDFRGLPI 182

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M   G P++FDA+HSVQQPG  G  SGG+R++   LA+AA AIG++ +F+ETH++PD AP
Sbjct: 183 MAQTGYPIVFDATHSVQQPGGQGTTSGGQREFAPVLARAACAIGVSAVFIETHENPDCAP 242

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           SDGPNMI I+ + +L+  L A D + K 
Sbjct: 243 SDGPNMIPIEQMRELIGVLRAFDDLAKG 270


>gi|71066195|ref|YP_264922.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychrobacter arcticus
           273-4]
 gi|71039180|gb|AAZ19488.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase protein
           [Psychrobacter arcticus 273-4]
          Length = 291

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 127/283 (44%), Positives = 178/283 (62%), Gaps = 1/283 (0%)

Query: 19  NHMIHTNAAIHLGSGKNQ-VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIG 77
            +++   + I L +  N+ +   N+Q FVL  G   +ES + AF IAE+   ICQ L IG
Sbjct: 2   ENLLTAQSHIQLNTPNNKSINIGNDQPFVLFGGMNVLESKEMAFEIAEQYVDICQRLGIG 61

Query: 78  LVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDI 137
            V+K+SFDKANRSSL   RG GL+KG +    +K+K+  PI+TDVH   Q   +A+  DI
Sbjct: 62  YVFKASFDKANRSSLTSYRGPGLEKGIDWLGQIKEKFQVPIITDVHEPYQAAPVAEVADI 121

Query: 138 LQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTS 197
           +Q+PA L RQTDL+ A A+T  +IN+KK QFL+P EM +I+ K    G   ++ CERG++
Sbjct: 122 IQLPAFLSRQTDLVHAMAKTDAIINIKKAQFLAPHEMRHIVNKCLEGGNDKLILCERGSA 181

Query: 198 FGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGI 257
           FGYN LV DM     M  M +PV FD +HS+QQPG   + +GG R+ I  LA+A +A G+
Sbjct: 182 FGYNNLVVDMLGFDTMKQMEIPVFFDVTHSLQQPGARSDSAGGRREQITTLARAGMATGL 241

Query: 258 AGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           AG+FLE H +P+ A  DGP  + +  L   L QL  +D ++K 
Sbjct: 242 AGLFLEAHPNPETAKCDGPCALRMSQLEPFLRQLKQLDDLVKG 284


>gi|221068543|ref|ZP_03544648.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Comamonas testosteroni
           KF-1]
 gi|299530810|ref|ZP_07044225.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Comamonas testosteroni
           S44]
 gi|220713566|gb|EED68934.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Comamonas testosteroni
           KF-1]
 gi|298721326|gb|EFI62268.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Comamonas testosteroni
           S44]
          Length = 285

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 137/270 (50%), Positives = 179/270 (66%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++RF LIAGPC +ES      +A +L  I  SL I  ++KSSFDKANRSS    
Sbjct: 5   GFDIGLDKRFFLIAGPCVVESEQLQMDVAGQLKEITSSLGIHFIFKSSFDKANRSSGTSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G++KG EI   +KK+   PILTDVHTE +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGPGMEKGLEILAKVKKELNVPILTDVHTEAEVPYVASVVDMLQTPAFLCRQTDFIRAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K  A        A     CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARAAAVEAGLPADSFTACERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG +G  SGG R+ +  L++AAVA+G+AG+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGNGTSSGGMREMVPVLSRAAVAVGVAGLFMETHPDPC 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           NA SDGPN + +K +  LL  L+A+D + K
Sbjct: 245 NALSDGPNAVPLKHMKALLETLVALDDVTK 274


>gi|254468351|ref|ZP_05081757.1| 3-deoxy-8-phosphooctulonate synthase [beta proteobacterium KB13]
 gi|207087161|gb|EDZ64444.1| 3-deoxy-8-phosphooctulonate synthase [beta proteobacterium KB13]
          Length = 275

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 128/262 (48%), Positives = 182/262 (69%), Gaps = 2/262 (0%)

Query: 40  SNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVG 99
              Q F LIAGPC IE+      +AE+L     SL I  ++KSSFDKANRSS    RG G
Sbjct: 9   GLNQPFFLIAGPCVIENESMTMSVAEQLKETTSSLGINFIFKSSFDKANRSSNNTFRGHG 68

Query: 100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGR 159
           +++G  I   +KK++  P+LTDVH+E Q +++A+ VD+LQ PA LCRQTD + A A++G+
Sbjct: 69  IEEGLRILEKVKKEFDLPVLTDVHSEDQVKSVAEVVDVLQTPAFLCRQTDFIHAVAKSGK 128

Query: 160 VINVKKGQFLSPWEMHNILQKLHAHG--AKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
            +N+KKGQFL+P +M  +++K         +++ CERG SFGYNTLV+DMRS+ IM +  
Sbjct: 129 PVNIKKGQFLAPQDMSMVVKKAKEANGGIDNIMVCERGVSFGYNTLVSDMRSLSIMRATN 188

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
            PV+FDA+HSVQQPG  G+ SGG+ +++  LA+AA+A+GI+GIF+ETH +P  A SDGPN
Sbjct: 189 CPVVFDATHSVQQPGGQGDRSGGQSEFVPLLARAAMAVGISGIFMETHPNPSEALSDGPN 248

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
            + + ++  LL  L  ID ++K
Sbjct: 249 AVPLDNMKDLLKTLQGIDHLVK 270


>gi|114327493|ref|YP_744650.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Granulibacter
           bethesdensis CGDNIH1]
 gi|122327535|sp|Q0BTX5|KDSA_GRABC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|114315667|gb|ABI61727.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 282

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 147/266 (55%), Positives = 196/266 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             V F N+  FVLIAGPCQIES  HA  +A +L+AIC  L+I LV+K+S+DKANR+S+ G
Sbjct: 16  GNVRFGNDLPFVLIAGPCQIESRAHAEGVAAELHAICARLDIPLVFKASYDKANRTSVGG 75

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG+++G +I   +++++  P+LTD+H   QC+  A++VDILQIPA LCRQTDLL AA
Sbjct: 76  ARGVGMERGLDILAGIRERFDIPVLTDIHDIGQCKPAAEAVDILQIPAFLCRQTDLLLAA 135

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TGR INVKKGQFL+PW+M N+  K+ + G  ++L  ERG SFGYNTLVTD R++PIM 
Sbjct: 136 GETGRTINVKKGQFLAPWDMRNVAAKIASTGNHNLLLTERGASFGYNTLVTDFRALPIMA 195

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQQPG  G  SGG+R +   LA+AA+A+G+A +F+E H DPD APSD
Sbjct: 196 QTGYPVVFDATHSVQQPGGQGTASGGDRTFAPILARAALAVGVASVFIECHPDPDRAPSD 255

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNMI +  + + L +L   D + K 
Sbjct: 256 GPNMIPLDQMEETLRRLKQFDVLGKA 281


>gi|260655090|ref|ZP_05860578.1| 3-deoxy-8-phosphooctulonate synthase [Jonquetella anthropi E3_33
           E1]
 gi|260630201|gb|EEX48395.1| 3-deoxy-8-phosphooctulonate synthase [Jonquetella anthropi E3_33
           E1]
          Length = 283

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 128/265 (48%), Positives = 181/265 (68%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
             +  +     +IAGPC +ES +    +   L  IC  L +  ++K+SFDKANR+S+  K
Sbjct: 7   NFSIGDGSPLAVIAGPCALESLELGLQVGGALKEICSRLGLNYIFKASFDKANRTSIHSK 66

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+ +G E    +K +   P+LTD+H   Q E +A  VD+LQIPA LCRQTDLL AAA
Sbjct: 67  RGPGIDQGLEWLGTIKGELDVPVLTDIHESWQAEPVAQVVDVLQIPAFLCRQTDLLVAAA 126

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TGR +NVKK QFL+P +M +++ KLH  G  +V+ CERGTS GY+ LV DMRS+PIM S
Sbjct: 127 KTGRPVNVKKAQFLAPGDMKSVITKLHEAGNDNVMVCERGTSMGYHQLVVDMRSLPIMRS 186

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           +G PV+FDA+H VQ P   G+ SGG+R++ +PLA+AAVAIG+ G+F+E H  P+ A SDG
Sbjct: 187 LGRPVVFDATHCVQMPSGQGDSSGGDRRFTLPLARAAVAIGVDGLFMEVHPKPEEAFSDG 246

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNM+ +    + L+ + AID++++ 
Sbjct: 247 PNMVPLSMAERFLTDIAAIDRLVRS 271


>gi|225025649|ref|ZP_03714841.1| hypothetical protein EIKCOROL_02551 [Eikenella corrodens ATCC
           23834]
 gi|224941599|gb|EEG22808.1| hypothetical protein EIKCOROL_02551 [Eikenella corrodens ATCC
           23834]
          Length = 283

 Score =  284 bits (727), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 128/268 (47%), Positives = 170/268 (63%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
             +  T +N + FVL  G   +ES D A  IAE    IC+ L+I  V+K+SFDKANRSSL
Sbjct: 9   PLHGFTIANHRPFVLFGGMNVLESRDLAMEIAETYIEICRKLDIPYVFKASFDKANRSSL 68

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG GL+KG +   D+K  Y  P++TD+H   Q    A+  DILQ+PA L RQTDL+ 
Sbjct: 69  HSFRGPGLEKGLQWLADIKAAYNVPVITDIHEPYQAAPAAEVADILQLPAFLSRQTDLVH 128

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           A A+TG +INVKK QFL+P EM +I+ K    G   ++ CERG++FGYN LV DM     
Sbjct: 129 AMARTGAIINVKKAQFLAPHEMRHIINKCLEAGNDKIILCERGSAFGYNNLVVDMLGFDT 188

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M  M VPV FD +HS+QQPG   + +GG R+ IV LA+A +A+G+AG+FLE H DP+ A 
Sbjct: 189 MKQMNVPVFFDVTHSLQQPGARSDSAGGRREQIVTLARAGMAVGLAGLFLEAHPDPEQAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP  + +  L   L+QL  ID ++K 
Sbjct: 249 CDGPCALRLSQLEPFLNQLKQIDNLVKG 276


>gi|187932013|ref|YP_001891998.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|254807745|sp|B2SDK5|KDSA_FRATM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|187712922|gb|ACD31219.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthase [Francisella
           tularensis subsp. mediasiatica FSC147]
          Length = 275

 Score =  284 bits (727), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 125/265 (47%), Positives = 177/265 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   
Sbjct: 5   NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    
Sbjct: 65  RGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G+ +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 125 KQGKPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKA 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH +PD A SDG
Sbjct: 185 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEAKSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
            N   +  + + LS L  +D ++K 
Sbjct: 245 LNSFPMYKIKEFLSLLKELDHLVKS 269


>gi|194365227|ref|YP_002027837.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Stenotrophomonas
           maltophilia R551-3]
 gi|238693476|sp|B4SR83|KDSA_STRM5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|194348031|gb|ACF51154.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Stenotrophomonas
           maltophilia R551-3]
          Length = 276

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 122/265 (46%), Positives = 170/265 (64%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q   LIAGPC IES       A KL  +   L +  ++KSSFDKANR+S    
Sbjct: 5   GFEVGLDQPLFLIAGPCVIESMQLQLDTAGKLKEVTDRLGVNFIFKSSFDKANRTSGTAF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G ++  ++KK+ G P+LTDVH     + +A  VD+LQ PA L RQTD +    
Sbjct: 65  RGPGMEEGLKVLAEVKKQIGVPVLTDVHEYTPMDEVASVVDVLQTPAFLVRQTDFIRKVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
             G+ +N+KKGQFL+PW+M  +++K  A G + ++ CERG SFGYN LV+DMRS+ +M  
Sbjct: 125 SAGKPVNIKKGQFLAPWDMKPVVEKAKATGNEQIMVCERGASFGYNNLVSDMRSLAVMRD 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP  A SDG
Sbjct: 185 TGCPVVFDATHSVQLPGGQGTSSGGQREHVPVLARAAVAVGISGLFAETHPDPSKALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  +  LL  L+ +D + K 
Sbjct: 245 PNAWPLDQMEALLETLMELDAVTKK 269


>gi|113867206|ref|YP_725695.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia eutropha H16]
 gi|122946983|sp|Q0KCE4|KDSA_RALEH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|113525982|emb|CAJ92327.1| 2-Dehydro-3-deoxyphosphooctonate aldolase [Ralstonia eutropha H16]
          Length = 289

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 130/270 (48%), Positives = 177/270 (65%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAGPC IES   A   A +L AI   L I  +YKSSFDKANRSS    
Sbjct: 5   GFEAGLDKPFFLIAGPCVIESEQMALDTAGELKAITAELGIPFIYKSSFDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G++KG EI   +K++ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMEKGLEILATVKREIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLPDDVFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA G+AG+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVATGVAGLFMETHPDPS 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  + +LL+ L  +D ++K
Sbjct: 245 KAMSDGPNAVPLSRMKELLAVLKELDTLVK 274


>gi|307825181|ref|ZP_07655401.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacter
           tundripaludum SV96]
 gi|307733637|gb|EFO04494.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylobacter
           tundripaludum SV96]
          Length = 277

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 128/265 (48%), Positives = 172/265 (64%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q F LIAGPC IES   A   A  L  +   LNI  +YKSSFDKANRSS    
Sbjct: 5   GFEAGLDQPFFLIAGPCVIESEQMALDTAGYLKELTTQLNIPFIYKSSFDKANRSSHESY 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G +I   +K++ G P+LTDVH +     +A  VD++Q PA LCRQT+ +   A
Sbjct: 65  RGPGVEEGLKILEKVKQQIGVPVLTDVHEDTPLAEVASVVDVMQTPAFLCRQTNFIQQVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
             G  +N+KKGQFL+PW+M ++  K  A G + ++ CERG SFGYN LV+DMRS+ +M  
Sbjct: 125 SQGIPVNIKKGQFLAPWDMVHVANKAKATGNQQIMVCERGVSFGYNNLVSDMRSLAVMRD 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GIAG+F+ETH +P  A SDG
Sbjct: 185 TDCPVVFDATHSVQLPGGQGTVSGGQREFVPVLARAAVAVGIAGLFMETHPNPAEAKSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + +LL  LL ID  +K 
Sbjct: 245 PNSWPLHRMKELLEVLLTIDSAVKA 269


>gi|289523514|ref|ZP_06440368.1| 3-deoxy-8-phosphooctulonate synthase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503206|gb|EFD24370.1| 3-deoxy-8-phosphooctulonate synthase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 282

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 134/265 (50%), Positives = 190/265 (71%), Gaps = 1/265 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           + +T     RFVL+AGPC +ES + A  +A ++  IC  L +G ++KSSFDKANR+S+  
Sbjct: 8   DGMTIGEG-RFVLVAGPCVLESLELALEVACEVKKICDGLGLGYIFKSSFDKANRTSIYS 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+ G     ++K K G P+LTD+H  +Q + ++  VDI+QIPA LCRQTDL+ +A
Sbjct: 67  FRGPGLEVGLRWLEEVKTKVGVPVLTDIHEPKQADLVSSVVDIIQIPAFLCRQTDLIMSA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+ +N+KK QFLSP++M  +L+K    G   V+ CERGT+FGY  LV D RS+ IM 
Sbjct: 127 AKTGKPLNIKKAQFLSPYDMRFVLEKAKESGNDQVILCERGTTFGYKQLVVDFRSLSIMR 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PV+FDA+HSVQ PG  G  SGG+RQ+++PL++AAV++GI  +F+E H DPDNA SD
Sbjct: 187 SFGCPVMFDATHSVQMPGGQGASSGGKRQFVLPLSRAAVSVGIDALFMEVHPDPDNAKSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNM+ + +L  LL +L+A+D ++K
Sbjct: 247 GPNMVALSNLRGLLEELIALDDLVK 271


>gi|163737727|ref|ZP_02145144.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Phaeobacter
           gallaeciensis BS107]
 gi|161389253|gb|EDQ13605.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Phaeobacter
           gallaeciensis BS107]
          Length = 277

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 142/265 (53%), Positives = 199/265 (75%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            ++  N++   LIAGPCQ+ES DHA MIA ++   C       V+K+S+DKANR+SL+GK
Sbjct: 8   DLSIGNDRPLTLIAGPCQLESLDHARMIAGQMKEACAKYGAQYVFKASYDKANRTSLSGK 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G ++ + + K++  P+LTDVHTE QC   A++VDILQIPA LCRQTD+L AA 
Sbjct: 68  RGLGVDEGLKVLQTIAKEFDVPVLTDVHTEAQCAVAAEAVDILQIPAFLCRQTDMLLAAG 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +N+KKGQFL+PW+M N++ K+ + G +++L  ERGTSFGYNTLV DMRS+P M  
Sbjct: 128 KTGKAVNIKKGQFLAPWDMANVVAKVESTGNQNILLTERGTSFGYNTLVADMRSLPQMAQ 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+ DA+HSVQQPG  G  +GG+R++   +A+AAV++GIA +F+ETH+DPDNAPSDG
Sbjct: 188 GGYPVVMDATHSVQQPGGKGGSTGGQREFAPLMARAAVSLGIASVFIETHEDPDNAPSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNMI +  +PKL+  L+  D + K 
Sbjct: 248 PNMIYLDQMPKLIETLMRFDALAKA 272


>gi|46201419|ref|ZP_00055079.2| COG2877: 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate
           synthase [Magnetospirillum magnetotacticum MS-1]
          Length = 282

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 160/266 (60%), Positives = 196/266 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N V   N+   VLIAGPCQ+ES DHA   AE L  +     I L+YKSSFDKANR+SLAG
Sbjct: 11  NDVILGNDLPLVLIAGPCQMESRDHALECAEALKTVASEAGISLIYKSSFDKANRTSLAG 70

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           +RGVGL K   IF ++K K+G P+LTDVHTE+QC   A +VD+LQIPA LCRQTDLL AA
Sbjct: 71  RRGVGLDKALPIFAEIKAKFGLPVLTDVHTEEQCVIAAKAVDVLQIPAFLCRQTDLLVAA 130

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG VINVKKGQFL+PW+M N+  K+ + G   +L  ERG SFGYNTLVTDMR +PIM 
Sbjct: 131 GRTGAVINVKKGQFLAPWDMANVAAKIESTGNSRILLTERGASFGYNTLVTDMRGLPIMG 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVI DA+H+VQ PG  GN SGG+R++   LA+AAVAIG+AG+F+E H DPD+APSD
Sbjct: 191 KTGWPVIMDATHAVQSPGGQGNSSGGDRRFAPVLARAAVAIGVAGVFIECHPDPDHAPSD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNMI +KD+P L+  L+ +D   K 
Sbjct: 251 GPNMIALKDMPALVDVLMKLDATAKS 276


>gi|104783176|ref|YP_609674.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas entomophila
           L48]
 gi|122985779|sp|Q1I645|KDSA_PSEE4 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|95112163|emb|CAK16890.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas entomophila
           L48]
          Length = 281

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 121/266 (45%), Positives = 169/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GNIEIANDKPFVLFGGMNVLESRDLALKVCEEYVRVTEKLGIPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++K+ +  P++TDVH   QCE +A   DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKRTFNVPVITDVHEPYQCEPVAQVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAVINIKKAQFLAPHEMKHILAKCVEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +HS+Q PG   + +GG R  +  LAKA ++ G+AG+FLE H DPDNA  D
Sbjct: 189 QFEYPVFFDVTHSLQTPGGRADSAGGRRAQVTDLAKAGMSQGLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL  +D ++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKQLDDLVKS 274


>gi|163856111|ref|YP_001630409.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bordetella petrii DSM
           12804]
 gi|226761653|sp|A9IIP6|KDSA_BORPD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|163259839|emb|CAP42140.1| 3-deoxy-8-phosphooctulonate synthase [Bordetella petrii]
          Length = 284

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 131/270 (48%), Positives = 178/270 (65%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 E  F LIAGPC IES + AF  A +L  I   L I  +YKSSFDKANRSS    
Sbjct: 5   GFDIGLEHPFFLIAGPCVIESRELAFDTAGRLKEITSRLGIPFIYKSSFDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G +I  D++ + G P+LTDVH  +Q E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGIDEGLKILADVRDQVGVPVLTDVHETEQVEPVAAVVDMLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAK------DVLFCERGTSFGYNTLVTDMRS 209
            + + +N+KKGQFL+P +M  + QK      +      ++L CERG SFGYN LV+DMRS
Sbjct: 125 ASLKPVNIKKGQFLAPHDMVQVAQKARDAAIEAGGDGSNILVCERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+G++G+F+ETH +P 
Sbjct: 185 LAIMRETGCPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVAVGVSGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +P LL  L+ +D++ K
Sbjct: 245 CALSDGPNAVPLDLMPALLESLVELDRVTK 274


>gi|240850257|ref|YP_002971650.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella grahamii
           as4aup]
 gi|240267380|gb|ACS50968.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella grahamii
           as4aup]
          Length = 278

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 166/279 (59%), Positives = 212/279 (75%), Gaps = 4/279 (1%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             NA + +G     + FSNE    LIAGPCQ+ES DHAF +A ++  I   L IG VYKS
Sbjct: 3   KPNACVKVG----NIIFSNEMPLSLIAGPCQMESRDHAFEMAGRIKTITDQLGIGFVYKS 58

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           S+DKANR+SL   RG+GL+K   +F DLKK++  PILTDVHTE+QC  ++ +VDILQIPA
Sbjct: 59  SYDKANRTSLGAARGIGLEKAMAVFSDLKKEFDCPILTDVHTEEQCTIVSSTVDILQIPA 118

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            LCRQTDLL AAA+T  VIN+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGYN 
Sbjct: 119 FLCRQTDLLVAAAKTECVINIKKGQFLAPWDMENVLKKVVYSGNPNVMLCERGTSFGYNR 178

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           L++DMRS+PI+ S G PVIFDA+HSVQ+PG  G  SGG+RQ++  LA+AAV++G+AGIFL
Sbjct: 179 LISDMRSLPILRSFGAPVIFDATHSVQEPGGQGASSGGQRQFVEVLARAAVSVGVAGIFL 238

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           ETHQDPDNAPSDGPNM+ + +L +LL  L+  D + K L
Sbjct: 239 ETHQDPDNAPSDGPNMVKLDNLQRLLETLMEFDYLSKKL 277


>gi|167032178|ref|YP_001667409.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida GB-1]
 gi|189028412|sp|B0KSB8|KDSA_PSEPG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166858666|gb|ABY97073.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida GB-1]
          Length = 281

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 119/266 (44%), Positives = 168/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GNIEIANDKPFVLFGGMNVLESRDLAMKVCEEYVRVTEKLGIPYVFKASFDKANRSSVTS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++K+ +  P++TDVH   Q E +A   DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKRTFNVPVITDVHEPYQAEPVAKVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAVINIKKAQFLAPQEMKHILAKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +H++Q PG   + +GG R  +  LAKA ++ G+AG+FLE H DPDNA  D
Sbjct: 189 QFEYPVFFDVTHALQMPGGRSDSAGGRRAQVTDLAKAGMSQGLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL  +D ++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKQLDDLVKS 274


>gi|254469946|ref|ZP_05083351.1| 3-deoxy-8-phosphooctulonate synthase [Pseudovibrio sp. JE062]
 gi|211961781|gb|EEA96976.1| 3-deoxy-8-phosphooctulonate synthase [Pseudovibrio sp. JE062]
          Length = 282

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 152/277 (54%), Positives = 203/277 (73%), Gaps = 5/277 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
            N+ + +G       FSN++ F LIAGPCQ+ES  HA  +A  +  I + LNIGLV+K+S
Sbjct: 4   PNSEVSVG----NAVFSNDKPFSLIAGPCQMESRAHALEMAHAVKEIAEELNIGLVFKAS 59

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           +DKANR+SL+  RG+G+K G E+F ++K+ YG P++TDVH    C  + +  D+LQIPA 
Sbjct: 60  YDKANRTSLSASRGMGMKGGLEVFAEIKETYGLPVITDVHEPSHCAPVGEVCDVLQIPAY 119

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGR +NVKKGQFL+PW+M N++ K+   G  +V+ CERG +FGYNTL
Sbjct: 120 LCRQTDLLVAAAKTGRALNVKKGQFLAPWDMKNVMTKVVESGNSNVMLCERGATFGYNTL 179

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMR++PIM  MG PV+FDA+HSVQQPG  G  SGG+R+++  LA+AA+A+GIAG+F+E
Sbjct: 180 VSDMRALPIMAEMGAPVVFDATHSVQQPGGLGGSSGGQREFVATLARAAIAVGIAGLFVE 239

Query: 264 THQDPDN-APSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           TH DPDN   SDGPNMI +  L  LL  L   D+I K
Sbjct: 240 THDDPDNTTSSDGPNMIPLNRLKDLLKWLQEFDRIAK 276


>gi|186476198|ref|YP_001857668.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia phymatum
           STM815]
 gi|238691312|sp|B2JIX1|KDSA_BURP8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|184192657|gb|ACC70622.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia phymatum
           STM815]
          Length = 284

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 127/271 (46%), Positives = 174/271 (64%), Gaps = 6/271 (2%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
                  ++ F LIAG C +ES       A KL  IC  L I  +YKSS+DKANRSS   
Sbjct: 4   GDFEIGLDKPFFLIAGTCVVESEQMTIDTAGKLKEICAKLKIPFIYKSSYDKANRSSGKS 63

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G+ +G  I  ++K++ G  +LTDVH+E + E +A  VD+LQ PA LCRQTD + A 
Sbjct: 64  FRGLGMDEGLRILSEVKRQLGLHVLTDVHSEHEIEPVASVVDVLQTPAFLCRQTDFIHAC 123

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMR 208
           A++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMR
Sbjct: 124 ARSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMR 183

Query: 209 SIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP 268
           S+ IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA GIAG+F+ETH +P
Sbjct: 184 SLAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGIAGLFMETHPNP 243

Query: 269 DNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
             A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 244 AEAKSDGPNAVPLHRMADLLETLMTLDQAVK 274


>gi|49474123|ref|YP_032165.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella quintana str.
           Toulouse]
 gi|59798259|sp|Q6G026|KDSA_BARQU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|49239627|emb|CAF25986.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bartonella quintana str.
           Toulouse]
          Length = 278

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 167/280 (59%), Positives = 212/280 (75%), Gaps = 4/280 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   N  + +G     + FSNE  F LI GPCQ+ES DHAF +A ++  I   + IG VY
Sbjct: 1   MFQPNTIVKVG----NIVFSNETPFSLIVGPCQMESRDHAFEMAGRIKTITDQIGIGFVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL   RG+GL+K   IF D+KK++G P+LTDVHTE+QC A+   VD+LQI
Sbjct: 57  KSSYDKANRTSLGAARGIGLEKAMAIFSDIKKEFGCPVLTDVHTEEQCAAVGSVVDVLQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRVIN+KKGQFL+PW+M N+L+K+   G   V+ CERGTSFGY
Sbjct: 117 PAFLCRQTDLLVAAAKTGRVINIKKGQFLAPWDMENVLKKVTQSGNPHVMLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N L++DMRS+PI+ S G PVIFDA+HSVQ+PG  G+ SGG+RQ++  LA+AAV++G+AGI
Sbjct: 177 NRLISDMRSLPILRSFGAPVIFDATHSVQEPGGQGDSSGGQRQFVEVLARAAVSVGVAGI 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLETHQDPDNAPSDGPNM+ I  L +LL  L+  D + K 
Sbjct: 237 FLETHQDPDNAPSDGPNMVKIDHLQRLLETLMEFDYLSKK 276


>gi|253701219|ref|YP_003022408.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sp. M21]
 gi|259494404|sp|C6E0M6|KDSA_GEOSM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|251776069|gb|ACT18650.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sp. M21]
          Length = 273

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 138/275 (50%), Positives = 190/275 (69%), Gaps = 4/275 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
               I +G     V     +   L+AGPC IE+       AE+L +IC  + I L++K+S
Sbjct: 1   MTREITVGG----VKIGGGRPLALVAGPCVIENETATLRCAERLMSICNGVGISLIFKAS 56

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           +DKANR+S+   RG G+K+G  I   +K+  G P+L+D+H+ +Q E  AD +D+LQIPA 
Sbjct: 57  YDKANRTSVTAFRGPGMKEGLRILAKVKEALGVPVLSDIHSIEQVEPAADVLDVLQIPAF 116

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA TG+VINVKKGQFL+PW+M N++ K+ + G ++++  ERG SFGYN L
Sbjct: 117 LCRQTDLLVAAANTGKVINVKKGQFLAPWDMKNVVGKISSCGNENIILTERGASFGYNNL 176

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DMRS PIM S G PVIFDA+HSVQ PG  G  SGG+R+Y+  L++AAVA G+ GIF+E
Sbjct: 177 VVDMRSFPIMRSTGYPVIFDATHSVQLPGGEGTSSGGQREYVEFLSRAAVAAGVDGIFME 236

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKII 298
            H++P+ A  DGPN + + D+P LL +L +ID I+
Sbjct: 237 VHEEPEQALCDGPNSVRLDDMPALLKKLKSIDAIV 271


>gi|167626447|ref|YP_001676947.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|241668879|ref|ZP_04756457.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254877411|ref|ZP_05250121.1| 3-deoxy-8-phosphooctulonate synthase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254807744|sp|B0TZ07|KDSA_FRAP2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|167596448|gb|ABZ86446.1| 3-deoxy-8-phosphooctulonate synthase [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|254843432|gb|EET21846.1| 3-deoxy-8-phosphooctulonate synthase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 275

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 125/265 (47%), Positives = 176/265 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  + + L I  VYKSSFDKANRSS+   
Sbjct: 5   NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD++Q PA LCRQT+ +    
Sbjct: 65  RGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVMQTPAFLCRQTNFILDVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G+ +N+KKGQFL+PW+M +++ K  + G + ++ CERG SFGYN LV+DMRS+ IM S
Sbjct: 125 KQGKPVNIKKGQFLAPWDMQHVVAKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLEIMKS 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+GI G+F+ETH  P  A SDG
Sbjct: 185 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPKPAEALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + + LS L  +D ++K 
Sbjct: 245 PNSFPMYKIKEFLSLLKELDHLVKS 269


>gi|220909562|ref|YP_002484873.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cyanothece sp. PCC 7425]
 gi|254807738|sp|B8HXG7|KDSA_CYAP4 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|219866173|gb|ACL46512.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cyanothece sp. PCC 7425]
          Length = 273

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 140/262 (53%), Positives = 188/262 (71%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            ++  + Q F LI GPC IES D    +A+++  IC  L I  ++KSSFDKANR+S+   
Sbjct: 9   DLSIGDGQPFALIGGPCVIESEDFCLKMADQIRQICDRLQISYIFKSSFDKANRTSIDSF 68

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG  L+ G +  + +K+K G P+LTD+H   Q   +A+ VD+LQIPA LCRQTDLL AAA
Sbjct: 69  RGQSLEDGLQTLQRVKEKIGVPVLTDIHESYQAAIVAEVVDVLQIPAFLCRQTDLLLAAA 128

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
            TGRVINVKKGQFL+PW+M N+++KL   GA+++L  ERG+SFGYNTLV D RS+P M +
Sbjct: 129 ATGRVINVKKGQFLAPWDMQNVVKKLEQGGAQNILLTERGSSFGYNTLVVDFRSLPQMRA 188

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           +G PV+FDA+HSVQ PG  GN SGG+R+++  LA+AAVA+GI  +F+E H++P+ A SDG
Sbjct: 189 LGYPVVFDATHSVQMPGGKGNSSGGQREFVPYLARAAVAVGIDALFMEIHENPEQALSDG 248

Query: 276 PNMINIKDLPKLLSQLLAIDKI 297
           PNM+ +  L   L QLLAI   
Sbjct: 249 PNMVYLSQLEAYLQQLLAIRTA 270


>gi|292669894|ref|ZP_06603320.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Selenomonas noxia ATCC
           43541]
 gi|292648691|gb|EFF66663.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Selenomonas noxia ATCC
           43541]
          Length = 277

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 129/264 (48%), Positives = 176/264 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  +  VLIAGPC +E  + + MI   +  I   L I  V+K+SFDKANRS+    
Sbjct: 10  NFEIGGGEPLVLIAGPCVLEGLERSLMIGRGIKEITNRLGIPYVFKASFDKANRSAYHSF 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G++ G ++ + ++++   P++TD+H   Q E  A +VDILQIPA L RQTDLL AAA
Sbjct: 70  RGPGMEDGLKMLKKIRRELNVPVVTDIHETCQAEPAAKAVDILQIPAFLSRQTDLLHAAA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           QTG ++NVKKGQFLSP +M N++ K+H  G++ +L  ERG SFGYN LV DMR+ PIM S
Sbjct: 130 QTGAIVNVKKGQFLSPNDMRNVVDKIHESGSERILLTERGASFGYNNLVVDMRAFPIMRS 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFD +HSVQ PG  G  S G+R+Y+  L +AAV  G+ G+FLE H +P  A SDG
Sbjct: 190 FGYPVIFDGTHSVQLPGGAGTSSSGQREYVEYLVRAAVGAGVDGLFLEVHDNPPEALSDG 249

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PNM+ +  L +LL + LAI ++++
Sbjct: 250 PNMVYLDKLEELLKEALAIYEVVR 273


>gi|264677265|ref|YP_003277171.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Comamonas testosteroni
           CNB-2]
 gi|262207777|gb|ACY31875.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Comamonas testosteroni
           CNB-2]
          Length = 317

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 137/270 (50%), Positives = 179/270 (66%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++RF LIAGPC +ES      +A +L  I  SL I  ++KSSFDKANRSS    
Sbjct: 37  GFDIGLDKRFFLIAGPCVVESEQLQMDVAGQLKEITSSLGIHFIFKSSFDKANRSSGTSF 96

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G++KG EI   +KK+   PILTDVHTE +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 97  RGPGMEKGLEILAKVKKELNVPILTDVHTEAEVPYVASVVDMLQTPAFLCRQTDFIRAVA 156

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K  A        A     CERG SFGYN LV+DMRS
Sbjct: 157 QSGKPVNIKKGQFLAPHDMKNVIDKARAAAVEAGLPADSFTACERGASFGYNNLVSDMRS 216

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG +G  SGG R+ +  L++AAVA+G+AG+F+ETH DP 
Sbjct: 217 LAIMRETGAPVVFDATHSVQLPGGNGTSSGGMREMVPVLSRAAVAVGVAGLFMETHPDPC 276

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           NA SDGPN + +K +  LL  L+A+D + K
Sbjct: 277 NALSDGPNAVPLKHMKALLETLVALDDVTK 306


>gi|148653465|ref|YP_001280558.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychrobacter sp.
           PRwf-1]
 gi|148572549|gb|ABQ94608.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychrobacter sp.
           PRwf-1]
          Length = 286

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 131/266 (49%), Positives = 172/266 (64%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T  N+Q FVL  G   +ES + AF IAE    IC  L IG V+K+SFDKANRSSL  
Sbjct: 14  NDMTIGNDQPFVLFGGMNVLESKELAFEIAEGYIDICNRLGIGYVFKASFDKANRSSLNS 73

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG +    +K+KY  PI+TDVH   Q E +A+  D++Q+PA L RQTDL+ A 
Sbjct: 74  YRGPGLEKGVDWLSQIKEKYNVPIITDVHEPYQAEPVAEVADVIQLPAFLSRQTDLVQAM 133

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +IN+KK QFL+P EM +I+ K    G   ++ CERGT+FGYN LV DM     M 
Sbjct: 134 AKTGAIINIKKAQFLAPHEMRHIINKCLEAGNDKIILCERGTAFGYNNLVVDMLGFDTMK 193

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +HS+QQPG   + +GG R+ I  LA+A +A G+AG+FLE H +P+ A  D
Sbjct: 194 QMDVPVFFDVTHSLQQPGARSDSAGGRREQITTLARAGMATGLAGLFLEAHPEPEVAKCD 253

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   LSQL  ID ++K 
Sbjct: 254 GPCALRMSQLEAFLSQLKQIDDLVKG 279


>gi|332526691|ref|ZP_08402793.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rubrivivax
           benzoatilyticus JA2]
 gi|332111094|gb|EGJ11126.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rubrivivax
           benzoatilyticus JA2]
          Length = 285

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 130/270 (48%), Positives = 182/270 (67%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LI+GPC +ES      +A +L  I  +L I  ++KSS+DKANRSS +  
Sbjct: 5   GFEVGIDRPFFLISGPCVVESEQLQMDVAGRLKEITSALGIPFIFKSSYDKANRSSGSSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G EI   ++++ G P+LTDVHTE +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGPGMERGLEILAKVRRELGVPVLTDVHTEAEVPQVAAVVDMLQTPAFLCRQTDFIRAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKD------VLFCERGTSFGYNTLVTDMRS 209
           Q G+ +N+KKGQFL+P +M N++ K  A   +          CERG SFGYN LV+DMRS
Sbjct: 125 QCGKPVNIKKGQFLAPHDMKNVVDKARAAAREKGLAEDLFTVCERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAV +G+AG+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVGVGVAGLFMETHPDPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           NA SDGPN + +K +  LL QL+AID+++K
Sbjct: 245 NAMSDGPNAVPLKHMKALLEQLVAIDRVVK 274


>gi|222055367|ref|YP_002537729.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sp. FRC-32]
 gi|254807747|sp|B9M9Q6|KDSA_GEOSF RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|221564656|gb|ACM20628.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter sp. FRC-32]
          Length = 272

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 135/265 (50%), Positives = 188/265 (70%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +    ++  VL+AGPC IE+       AE+L  IC  +++ L++K+S+DKANR+S+  
Sbjct: 8   GNIKIGGDRPLVLVAGPCVIENEAATLRCAERLMTICNGVSMPLIFKASYDKANRTSVNS 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GLK G +I + +K+  G P+L+D+H+ +Q E  A+ +D++QIPA LCRQTDL+ AA
Sbjct: 68  FRGPGLKDGLKILKKVKESLGVPVLSDIHSIEQVEPAAEVLDVIQIPAFLCRQTDLVVAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A +GRVIN+KKGQFL+PW+M N++ K  + G  +V+  ERG SFGYN LV+DMRS PI+ 
Sbjct: 128 AMSGRVINIKKGQFLAPWDMENVVGKAVSTGNDNVILTERGVSFGYNNLVSDMRSFPILR 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+HSVQ PG  G  SGG+R+++  L +AAVA GI GIF+E H+DP+ A  D
Sbjct: 188 QTGYPVIFDATHSVQLPGGLGGSSGGQREFVEYLGRAAVATGIDGIFMEVHEDPEKALCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + + DLP LL +L AID I+K
Sbjct: 248 GPNSVKLDDLPALLKKLKAIDAIVK 272


>gi|253998570|ref|YP_003050633.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylovorus sp. SIP3-4]
 gi|313200643|ref|YP_004039301.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylovorus sp. MP688]
 gi|253985249|gb|ACT50106.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylovorus sp. SIP3-4]
 gi|312439959|gb|ADQ84065.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylovorus sp. MP688]
          Length = 279

 Score =  282 bits (722), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 133/267 (49%), Positives = 176/267 (65%), Gaps = 2/267 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 E    LIAGPC IES   A   A +L  I  ++ I  +YKSS+DKANRSS    
Sbjct: 5   GFDVGIEHPIFLIAGPCVIESKQMAIDTAGQLKEIAAAIGIPFIYKSSYDKANRSSTKTF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G  I  D++ + G PILTDVHTE+Q   +A  VD+LQ PA LCRQTD +TA A
Sbjct: 65  RGFGMEEGLRILDDVRAQIGVPILTDVHTEEQVPHVAAVVDVLQTPAFLCRQTDFITAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHG--AKDVLFCERGTSFGYNTLVTDMRSIPIM 213
             G+ +N+KKGQFL+P +M  ++QK       A  ++ CERG SFGYNTLV+DMR + IM
Sbjct: 125 TCGKPVNIKKGQFLAPGDMKQVVQKAKEANGGADTIMVCERGASFGYNTLVSDMRGLAIM 184

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
                PV+FDA+HSVQQPG  G+ SGG+R+++  LA+AAVA GIAG+F+ETH DP  A S
Sbjct: 185 RETQCPVVFDATHSVQQPGGQGDKSGGQREFVPVLARAAVASGIAGLFMETHPDPSKALS 244

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGPN   +  +  LL  L+ +D+++K 
Sbjct: 245 DGPNAWPLPKMKDLLQVLVELDRVVKK 271


>gi|323140928|ref|ZP_08075841.1| 3-deoxy-8-phosphooctulonate synthase [Phascolarctobacterium sp. YIT
           12067]
 gi|322414666|gb|EFY05472.1| 3-deoxy-8-phosphooctulonate synthase [Phascolarctobacterium sp. YIT
           12067]
          Length = 272

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 135/266 (50%), Positives = 186/266 (69%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
                      +L+AGPC +E ++ + MI ++  AIC  L I  V+K+SFDKANRSS A 
Sbjct: 7   GNYEVGQGHPLMLMAGPCVLEGYERSLMIGQRTKAICDKLGIPYVFKASFDKANRSSYAS 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G ++   +KK  G P++TD+H   Q E  A+ VDILQIPA LCRQTDL+ AA
Sbjct: 67  FRGPGIEEGLKLLAQIKKDLGVPVVTDIHEPWQAEKAAEVVDILQIPAFLCRQTDLVYAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+ +NVKKGQFL+PW+M N+++K+   G  +++  ERG SFGYNTLVTDMR + IM 
Sbjct: 127 AKTGKTVNVKKGQFLAPWDMKNVIKKVEEAGNHNIMLTERGASFGYNTLVTDMRGLAIMR 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            +G PV+ DA+HSVQ PG  G  SGG+ QY+  +A+AA A+GI  +FLE H +P  A SD
Sbjct: 187 ELGYPVVMDATHSVQIPGGQGTSSGGQSQYVPHMARAAAAVGIDALFLEVHDNPAEALSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNM+ + +L KLL+ +LAIDKI++ 
Sbjct: 247 GPNMVKLDNLEKLLTDVLAIDKIVRG 272


>gi|257454630|ref|ZP_05619886.1| 3-deoxy-8-phosphooctulonate synthase [Enhydrobacter aerosaccus
           SK60]
 gi|257447940|gb|EEV22927.1| 3-deoxy-8-phosphooctulonate synthase [Enhydrobacter aerosaccus
           SK60]
          Length = 287

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 133/266 (50%), Positives = 173/266 (65%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T  N+Q FVL  G   +ES D AF IAE    IC+ LNIG V+K+SFDKANRSSL  
Sbjct: 15  NDITIGNDQPFVLFGGMNVLESKDLAFEIAESYIDICKRLNIGYVFKASFDKANRSSLYS 74

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG +   D+KK +  PI+TDVH   Q E +A   DI+Q+PA L RQTDL+ A 
Sbjct: 75  FRGPGLEKGIDWLSDIKKAFNVPIITDVHEPYQAEPVAAVADIIQLPAFLSRQTDLVAAM 134

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K    G   ++ CERG++FGYN LV DM     M 
Sbjct: 135 AKTGAIINVKKAQFLAPHEMKHIINKCLEAGNDKIILCERGSAFGYNNLVVDMLGFDTMK 194

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +HS+QQPG   + +GG R+ I  LA+A +A G+AG+FLE H +PD A  D
Sbjct: 195 KMQVPVFFDVTHSLQQPGARADSAGGRREQITTLARAGMATGLAGLFLEAHPNPDVAKCD 254

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL  +D ++K 
Sbjct: 255 GPCALRLSQLEPFLAQLKQLDTLVKG 280


>gi|26988343|ref|NP_743768.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida
           KT2440]
 gi|148549372|ref|YP_001269474.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida F1]
 gi|32171423|sp|Q88MG0|KDSA1_PSEPK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase 1; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase 1; AltName: Full=KDO-8-phosphate synthase 1;
           Short=KDO 8-P synthase 1; Short=KDOPS 1; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase 1
 gi|24983093|gb|AAN67232.1|AE016350_5 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida
           KT2440]
 gi|148513430|gb|ABQ80290.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida F1]
 gi|313500221|gb|ADR61587.1| KdsA_2 [Pseudomonas putida BIRD-1]
          Length = 281

 Score =  282 bits (721), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 119/266 (44%), Positives = 167/266 (62%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GNIEIANDKPFVLFGGMNVLESRDLAMKVCEEYVRVTEKLGIPYVFKASFDKANRSSVTS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++K+ +  P++TDVH   Q E +A   DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKRTFNVPVITDVHEPYQAEPVAKVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGVVINIKKAQFLAPQEMKHILAKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +H++Q PG   + +GG R  +  LAKA ++ G+AG+FLE H DPDNA  D
Sbjct: 189 QFEYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGMSQGLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L QL  +D ++K 
Sbjct: 249 GPCALRLDKLEPFLVQLKQLDDLVKS 274


>gi|254491579|ref|ZP_05104758.1| 3-deoxy-8-phosphooctulonate synthase [Methylophaga thiooxidans
           DMS010]
 gi|224463057|gb|EEF79327.1| 3-deoxy-8-phosphooctulonate synthase [Methylophaga thiooxydans
           DMS010]
          Length = 281

 Score =  282 bits (721), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 127/262 (48%), Positives = 171/262 (65%)

Query: 38  TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRG 97
               +Q   LIAG C IES      +A +L  I   L I L+YKSSFDKANR+S    RG
Sbjct: 7   EVGGKQPLFLIAGTCVIESEQMTMDVAGQLKEITDKLGISLIYKSSFDKANRTSTKSYRG 66

Query: 98  VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQT 157
            G++ G  I   +KK++  P+LTDVH +     +A  VD+LQ PA LCRQT+ +   A  
Sbjct: 67  PGVEAGLAILEKVKKEFNLPVLTDVHEDTPLAEVASVVDVLQTPAFLCRQTNFIVNVASQ 126

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           G  +N+KKGQFL+PW+M ++  K  + G + ++ CERGTSFGYNTL++DMR +P M  M 
Sbjct: 127 GLPVNIKKGQFLAPWDMQHVADKAKSTGNQQIMLCERGTSFGYNTLISDMRGLPQMRHMD 186

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
            PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P+ A SDGPN
Sbjct: 187 CPVVFDATHSVQQPGGQGGASGGQREFVPVLARAAVATGVAGVFMETHPEPEKALSDGPN 246

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
              +  +  LL  L AID  +K
Sbjct: 247 SWPLHKMSALLETLQAIDTTVK 268


>gi|254448216|ref|ZP_05061678.1| 3-deoxy-8-phosphooctulonate synthase [gamma proteobacterium
           HTCC5015]
 gi|198262083|gb|EDY86366.1| 3-deoxy-8-phosphooctulonate synthase [gamma proteobacterium
           HTCC5015]
          Length = 277

 Score =  282 bits (721), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 126/262 (48%), Positives = 173/262 (66%)

Query: 38  TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRG 97
               +Q F LIAGPC IE    A   AE L  + Q L I  +YKSSFDKANRSS+   RG
Sbjct: 7   QVGLDQPFFLIAGPCAIEGESLAMHTAETLKRLTQDLGIPFIYKSSFDKANRSSIDSPRG 66

Query: 98  VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQT 157
           VGL+KG EI   +K ++  P++TDVH     + +A  VD++Q PA LCRQTD +   A  
Sbjct: 67  VGLEKGLEILAKVKSEFDLPVITDVHEYTPIDEVASVVDVMQTPAFLCRQTDYILKVASA 126

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           G  +N+KKGQFL+PW+M  ++ K  + G + ++ C+RGTSFGYN LV+DMR + +M   G
Sbjct: 127 GLPVNIKKGQFLAPWDMQQVVSKARSTGNEQIMVCDRGTSFGYNNLVSDMRGLAVMRETG 186

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
            PV+FDA+HSVQ PG  G+ SGG+R+++  LA+AA+A G++G+F+ETH DP NA SDGPN
Sbjct: 187 CPVVFDATHSVQLPGGQGSSSGGQREFVPVLARAAIAAGVSGVFMETHPDPANAFSDGPN 246

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
              +  +  LL  +  +D  +K
Sbjct: 247 AWPLDQMKALLHTMKVLDDTVK 268


>gi|167855823|ref|ZP_02478575.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus parasuis
           29755]
 gi|167853036|gb|EDS24298.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus parasuis
           29755]
          Length = 284

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 125/268 (46%), Positives = 175/268 (65%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  + EK   + Q L +  V+K+SFDKANRSS+  
Sbjct: 9   GNIDIANDKPFVLFGGMNVLESRDMAMQVCEKYVEVTQRLGVPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVAEVVDIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ LV DM    +M 
Sbjct: 129 ARTGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGTNFGYDNLVVDMLGFNVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G PVIFD +HS+Q     G  SGG R  +  LA+A +AIG+AG+FLE H DP+ A 
Sbjct: 189 KVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARAGMAIGLAGLFLEAHPDPNKAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 249 CDGPSALPLSKLEAFVSQMKAIDDLVKS 276


>gi|257464825|ref|ZP_05629196.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus minor
           202]
 gi|257450485|gb|EEV24528.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus minor
           202]
          Length = 284

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 131/280 (46%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            TN  + LG     +  +N + FVL  G   +ES D A  + EK   + Q L +  V+K+
Sbjct: 1   MTNKVVTLG----HIEIANNKPFVLFGGMNVLESRDMAMQVCEKYVEVTQKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G  IF++LK+ +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLNIFQELKETFGVKIITDVHEIHQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +HS+Q     G  SGG R  +  LA+A +AIG+AG+
Sbjct: 177 LVVDMLGFNVMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARAGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP+NA  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPDPNNAKCDGPSALPLSKLEAFVSQMKAIDDLVKS 276


>gi|254420742|ref|ZP_05034466.1| 3-deoxy-8-phosphooctulonate synthase [Brevundimonas sp. BAL3]
 gi|196186919|gb|EDX81895.1| 3-deoxy-8-phosphooctulonate synthase [Brevundimonas sp. BAL3]
          Length = 283

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 140/262 (53%), Positives = 189/262 (72%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V      R   IAGPCQ+ES  HA   A  L  I + LN+G++YK+SFDKANR+S +  R
Sbjct: 9   VVIGGGARIAFIAGPCQMESRQHALETAHALKEIGERLNVGIIYKTSFDKANRTSASAAR 68

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+GLK    IF ++++  G P LTDVH+E QC  + + VD+LQIPA L RQTDLL AAA 
Sbjct: 69  GIGLKDAMPIFAEIRETVGLPTLTDVHSEAQCGPVGEVVDVLQIPAFLSRQTDLLLAAAA 128

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ IN+KKGQFL+PW+M N++ K+   G  +V+ CERG SFGYNTLV+DMR++P++  +
Sbjct: 129 TGKAINIKKGQFLAPWDMKNVIAKVVGAGNPNVMACERGASFGYNTLVSDMRALPVLREI 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAV++G+  +F+ETH DPDNAPSDGP
Sbjct: 189 GCPVVFDATHSVQQPGGQGTSSGGQREFVPVLARAAVSVGVDAVFMETHPDPDNAPSDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKII 298
           NM+ +     L +QL+A D + 
Sbjct: 249 NMVPLDQFEALAAQLIAFDDLA 270


>gi|51244617|ref|YP_064501.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfotalea
           psychrophila LSv54]
 gi|59798233|sp|Q6AQ79|KDSA_DESPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|50875654|emb|CAG35494.1| probable 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfotalea
           psychrophila LSv54]
          Length = 280

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 126/280 (45%), Positives = 180/280 (64%), Gaps = 1/280 (0%)

Query: 22  IHTNAAIHLGSGKN-QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +     + +       +   + Q  +LI GPC +ES      +AE +  IC+ L I  V+
Sbjct: 1   MTVVTPVAVAQPNGSDILVGSGQPLLLIGGPCSLESEQLGREVAETVSKICKKLGISYVF 60

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANR+S++  RG GLKKG      +++    P+++D+H   Q    A+ +DI+QI
Sbjct: 61  KASFDKANRTSISSYRGPGLKKGLASLARIREDLQVPVISDIHDISQVGPAAEVLDIIQI 120

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA++G+ +NVKKGQF+SPW+M N + KL   G+  V+  ERG  FGY
Sbjct: 121 PAFLCRQTDLLVAAAKSGKPVNVKKGQFVSPWDMENAIGKLRDAGSDKVMLVERGACFGY 180

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LV DMRS+P+M S   PVI+DA+HSVQ PG  G  S G+R++I PL+KAA+A GI G+
Sbjct: 181 NNLVVDMRSLPVMRSFNCPVIYDATHSVQLPGGAGGSSSGQREFIEPLSKAAIAAGIDGL 240

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DPD A  DGPN I +  + +LL++L+ +   ++ 
Sbjct: 241 FMEIHPDPDKALCDGPNSIALDQVEELLTKLVKVRAAVEE 280


>gi|73540791|ref|YP_295311.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia eutropha
           JMP134]
 gi|123732962|sp|Q473G6|KDSA_RALEJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|72118204|gb|AAZ60467.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia eutropha
           JMP134]
          Length = 289

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 131/270 (48%), Positives = 177/270 (65%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAGPC IES   A   A +L AI   L I  +YKSSFDKANRSS    
Sbjct: 5   GFEVGLDKPFFLIAGPCVIESEQMALDTAGELKAITGELGIPFIYKSSFDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G++KG EI   +K++ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMEKGLEILATVKREIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAARDAGLPDDVFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA GIAG+F+ETH DP+
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVATGIAGLFMETHPDPN 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  + +LL+ L  +D + K
Sbjct: 245 KAMSDGPNAVPLSRMKELLAVLRDLDALTK 274


>gi|77919540|ref|YP_357355.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pelobacter carbinolicus
           DSM 2380]
 gi|123729435|sp|Q3A372|KDSA_PELCD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|77545623|gb|ABA89185.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Pelobacter carbinolicus DSM 2380]
          Length = 277

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 131/265 (49%), Positives = 184/265 (69%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            VTF       LIAGPC +E+  H   IA +L  +   L +G+V+K+SFDKANR+S++  
Sbjct: 9   DVTFGGNHPVALIAGPCVMENEAHTLAIARQLLEVKNELGVGVVFKASFDKANRTSVSAY 68

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL+ G  I   ++++ G PI++D+H   Q EA A+ +DILQIPA LCRQTDLL AA 
Sbjct: 69  RGPGLESGLRILDKVRQQTGLPIVSDIHDVSQVEAAAEVLDILQIPAFLCRQTDLLLAAG 128

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           ++G+V+N+KKGQFL+PW+M N + K+ + G   +L  ERGTSFGYN LV DMRS+ +M  
Sbjct: 129 RSGKVVNIKKGQFLAPWDMANAVAKVASTGNDRILLTERGTSFGYNNLVVDMRSLAVMRE 188

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           +G PV+FDA+H+VQ PG  G  SGG+RQ++  L++AAVA+G+ G+F E H DPD A  DG
Sbjct: 189 LGCPVVFDATHAVQLPGGAGTSSGGQRQFVAALSRAAVAVGVDGLFWEVHPDPDRALCDG 248

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
            N + +  + K L +++AID I+K 
Sbjct: 249 ANSLPLDQVKKTLKEMMAIDAIVKG 273


>gi|253996918|ref|YP_003048982.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylotenera mobilis
           JLW8]
 gi|253983597|gb|ACT48455.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylotenera mobilis
           JLW8]
          Length = 279

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 134/267 (50%), Positives = 179/267 (67%), Gaps = 2/267 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 E    LIAGPC IES   A   A +L  I  +LNI  +YKSS+DKANRSS    
Sbjct: 5   NFDVGLEHPLFLIAGPCVIESQQMAIDTAGQLKEIATALNIPFIYKSSYDKANRSSNKTF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+ +G +I   ++ + G PILTDVHTE+Q   +A  VD+LQ PA LCRQTD +TA A
Sbjct: 65  RGFGMDEGLKILDHVRSQIGVPILTDVHTEEQVPHVAAVVDVLQTPAFLCRQTDFITACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHG--AKDVLFCERGTSFGYNTLVTDMRSIPIM 213
           ++G+ +N+KKGQF++P +M N++QK       A +++ CERG SFGYNTLV+DMR +  M
Sbjct: 125 RSGKPVNIKKGQFMAPGDMKNVVQKAKEANGGADNIMVCERGASFGYNTLVSDMRGLATM 184

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
                PV+FDA+HSVQQPG  G+ SGG+R+++  LA+AAVA GIAGIF+ETH DP  A S
Sbjct: 185 RETHCPVVFDATHSVQQPGGQGDKSGGQREHVPVLARAAVASGIAGIFMETHPDPAKALS 244

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGPN   +  +  LL  L+ +D+++K 
Sbjct: 245 DGPNAWPLHKMRDLLEVLVDLDRLVKK 271


>gi|328675738|gb|AEB28413.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Francisella cf. novicida 3523]
          Length = 275

 Score =  281 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 126/265 (47%), Positives = 176/265 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                N + F L++GPC IES   A   A  L  +   L I  VYKSSFDKANRSS+   
Sbjct: 5   NFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLTEVTNDLGINFVYKSSFDKANRSSINSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ KG EI   +KK Y  P++TDVH +     +A+ VD+LQ PA LCRQT+ +    
Sbjct: 65  RGLGVDKGLEILAKVKKTYNIPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFIVEVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G+ +N+KKGQFL+PW+M N++ K  + G + ++ CERG SFGYN LV+DMRS+ IM +
Sbjct: 125 KQGKPVNIKKGQFLAPWDMQNVVAKAKSTGNQQIMVCERGVSFGYNNLVSDMRSLEIMKA 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G+ SGG+R+++  L+KAA+A+ I G+F+ETH +PD A SDG
Sbjct: 185 TGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVSIDGLFMETHPNPDEAKSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  + + LS L  +D ++K 
Sbjct: 245 PNSFPMYKIKEFLSLLKELDHLVKS 269


>gi|157803247|ref|YP_001491796.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia canadensis
           str. McKiel]
 gi|166220456|sp|A8EXC8|KDSA_RICCK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|157784510|gb|ABV73011.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia canadensis
           str. McKiel]
          Length = 274

 Score =  281 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 155/266 (58%), Positives = 200/266 (75%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           + +   N+  F+LIAGPCQIE  DHA  +AEKL  +   L+I  +YKSSFDKANR+S+ G
Sbjct: 8   HNIKIGNDLPFILIAGPCQIEGQDHALFMAEKLVKLTSKLDIPFIYKSSFDKANRTSING 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G++KG E+   +K ++  PI+TDVH+E QC   A  VDILQIPA LCRQTDLL AA
Sbjct: 68  VRGLGIEKGLEVLSKVKAEFDCPIVTDVHSESQCTETARVVDILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A GA+++LF ERGT FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLKAFGAENILFTERGTCFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPVIFDA+HSVQQPG  G+ +GGER+Y+  LAKAA  +GIAG+++E HQDPDNAPSD
Sbjct: 188 KLNVPVIFDATHSVQQPGGLGDSTGGERKYVELLAKAATTVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP MI + +L  +L +L   DKI K 
Sbjct: 248 GPCMIKLDNLESILIKLKKYDKITKE 273


>gi|92112751|ref|YP_572679.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Chromohalobacter
           salexigens DSM 3043]
 gi|91795841|gb|ABE57980.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Chromohalobacter
           salexigens DSM 3043]
          Length = 283

 Score =  281 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 116/265 (43%), Positives = 164/265 (61%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +   N     L  G   +ES + A  +AE    +   L +  V+KSSFDKANRSS+   
Sbjct: 12  GLRAGNSLPLALFGGMNVLESREMALEVAEAYVEVTGRLGMPYVFKSSFDKANRSSIHSY 71

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL+KG E   ++K+++  P++TDVH   Q + +A+  D++Q+PA L RQTDL+ A A
Sbjct: 72  RGPGLEKGLEWLAEIKERFNVPVITDVHEPWQAKPVAEVADVIQLPAFLARQTDLVVAMA 131

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG  IN+KK QF++P EM +I++K    G   ++ CERG+SFGYN LV DM     M  
Sbjct: 132 ETGAAINIKKPQFIAPHEMRHIIRKCEEVGNSRLILCERGSSFGYNNLVVDMLGFGEMKQ 191

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV FD +H++Q+PG   + + G R  +  LA+A VA+G+AG+FLE H DPDNA  DG
Sbjct: 192 TGYPVFFDVTHALQRPGGRADSADGRRAQVAELARAGVAVGLAGVFLEAHPDPDNAKCDG 251

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           P  + +  L   LSQL AID ++K 
Sbjct: 252 PCALPLNRLEGFLSQLKAIDDLVKG 276


>gi|285808560|gb|ADC36081.1| 2-dehydro-3-deoxyphosphooctonate aldolase [uncultured bacterium
           164]
          Length = 272

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 136/267 (50%), Positives = 187/267 (70%), Gaps = 1/267 (0%)

Query: 32  SGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSS 91
               +V F +     +IAGPC +ES  HA  +A+++  IC+ + +GLVYKSSFDKANRSS
Sbjct: 4   FDVGKVRFGDGG-LAIIAGPCVVESAQHALYMAQEISDICKHVGLGLVYKSSFDKANRSS 62

Query: 92  LAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLL 151
           +   RG G++ G  I   +K++ G P++TD+H   Q E +A+  DILQIPA LCRQTDLL
Sbjct: 63  IESFRGEGMEFGLSILAQVKEEIGVPVITDIHEPWQAEKVAEVADILQIPAFLCRQTDLL 122

Query: 152 TAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIP 211
            AAA+TG+ +NVKKGQFLSPW+  NI++KLHA G + +L  ERG SFGYN LV D+RS P
Sbjct: 123 VAAAKTGKAVNVKKGQFLSPWDAKNIVEKLHAAGGQMILLTERGASFGYNNLVVDLRSFP 182

Query: 212 IMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
           +M S GVPV+FD +HS+Q PG  G  +GG+ +YI   A+A VA G+  +F+E H +P  A
Sbjct: 183 VMRSFGVPVVFDVTHSLQLPGGLGKATGGQSEYIENFARAGVACGVDAVFMEVHDNPAKA 242

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKII 298
           PSDGPN + +  L KLL++L +I +++
Sbjct: 243 PSDGPNQLPLARLEKLLTKLKSIHELV 269


>gi|37197861|dbj|BAC93699.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase [Vibrio
           vulnificus YJ016]
          Length = 298

 Score =  281 bits (719), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 125/295 (42%), Positives = 182/295 (61%), Gaps = 7/295 (2%)

Query: 9   LEEKQRRIDK-NHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKL 67
           + ++   ID+   ++     + +G     +  +N++ F L AG   +ES D A  I E  
Sbjct: 1   MAKRSLYIDQIRDIMMEQKIVQIGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHY 56

Query: 68  YAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQ 127
             +   L I  V+K+SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q
Sbjct: 57  VKVTDKLGIPYVFKASFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQ 116

Query: 128 CEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAK 187
            + +AD VD++Q+PA L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G  
Sbjct: 117 AQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGND 176

Query: 188 DVLFCERGTSFGYNTLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYI 245
            ++ CERG+  GY+ LV DM    +M     G P+IFD +HS+Q     G  SGG R+  
Sbjct: 177 KIILCERGSCHGYDNLVVDMLGFGVMKKASKGSPIIFDVTHSLQMRDPSGAASGGRREQT 236

Query: 246 VPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           V LAKA +A GIAG+F+E H +PD A  DGP+ + +  L   L+Q+ A+D ++K 
Sbjct: 237 VELAKAGLATGIAGLFIEAHPNPDQARCDGPSALPLDKLEPFLAQMKALDDLVKS 291


>gi|237748447|ref|ZP_04578927.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oxalobacter formigenes
           OXCC13]
 gi|229379809|gb|EEO29900.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oxalobacter formigenes
           OXCC13]
          Length = 284

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 128/270 (47%), Positives = 185/270 (68%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAGPC IESH  A   A  L  +   L I  +YKSS+DKANRSS +  
Sbjct: 5   GFEIGLDRPFFLIAGPCVIESHQMAIDTAGALKEMTSELGIPFIYKSSYDKANRSSSSSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G++KG EI  D++K++  P+LTDVHTE +   ++  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMEKGLEILADVRKQFDVPVLTDVHTEVEVGPVSAVVDMLQTPAFLCRQTDFIQACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQF++P +M N+++K             +   CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFMAPDDMMNVVKKAKEAAKEAGVPEDNFTVCERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G+ SGG+R+++  LA+AA+A+G+AG+F+ETH +P 
Sbjct: 185 LAIMRKTGCPVVFDATHSVQLPGGLGDASGGQREFVPVLARAAIAVGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  + +LL+QL+ +DK+++
Sbjct: 245 CAMSDGPNAVPLHRMKELLAQLVTLDKVVR 274


>gi|51473281|ref|YP_067038.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia typhi str.
           Wilmington]
 gi|59798219|sp|Q68XT6|KDSA_RICTY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|51459593|gb|AAU03556.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia typhi str.
           Wilmington]
          Length = 274

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 159/266 (59%), Positives = 202/266 (75%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+ +FVLIAGPCQIE  DHA  +AEKL  +   L+I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLQFVLIAGPCQIEDEDHALFMAEKLIQLTSKLSIPFIYKSSFDKANRTSING 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G++KG EI   +K ++  PI+TDVH+E QC   A  VDILQIPA LCRQTDLL AA
Sbjct: 68  IRGLGIEKGLEILSKVKSEFNCPIITDVHSESQCTDTAKVVDILQIPAFLCRQTDLLKAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A GAKD+LF ERG+ FGYN L++DMRS+ IM+
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGAKDILFTERGSCFGYNNLISDMRSLAIMS 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  SGGER+Y+  LAKAA+++GIAGI++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGRGGSSGGERKYVELLAKAAISVGIAGIYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP MI +  L  +L +L   DKI K 
Sbjct: 248 GPCMIKLDHLESILIKLKKYDKITKE 273


>gi|83854719|ref|ZP_00948249.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfitobacter sp.
           NAS-14.1]
 gi|83941242|ref|ZP_00953704.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfitobacter sp. EE-36]
 gi|83842562|gb|EAP81729.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfitobacter sp.
           NAS-14.1]
 gi|83847062|gb|EAP84937.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfitobacter sp. EE-36]
          Length = 277

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 145/266 (54%), Positives = 194/266 (72%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             V   N++   +IAGPCQ+ES  HA MIA ++   C ++    V+K+S+DKANR+SL G
Sbjct: 7   GNVVIGNDRPLTVIAGPCQLESETHAQMIAGQMKEACDAVGAQFVFKASYDKANRTSLGG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G+ +G  + + + K  G P+LTDVHTE QC   A++VDILQIPA LCRQTD+L AA
Sbjct: 67  KRGLGIDEGLAVLQSVGKSIGVPVLTDVHTEAQCAIAAEAVDILQIPAFLCRQTDMLLAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
             TG+V+NVKKGQFL+PW+M N++ K+ + G K +L  ERGTSFGYNTLV DMRS+P M 
Sbjct: 127 GNTGKVVNVKKGQFLAPWDMPNVVAKIESTGNKRILLTERGTSFGYNTLVADMRSLPQMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAVAIG+  +F+ETH+DPDNAPSD
Sbjct: 187 QTGYPVVMDATHSVQQPGGQGGSSGGQREFAPVMARAAVAIGVGAVFIETHEDPDNAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNMI +  +P L++ L+  D + K 
Sbjct: 247 GPNMIYLDQMPALVASLMKFDALAKE 272


>gi|187924538|ref|YP_001896180.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           phytofirmans PsJN]
 gi|187715732|gb|ACD16956.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           phytofirmans PsJN]
          Length = 284

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 125/271 (46%), Positives = 176/271 (64%), Gaps = 6/271 (2%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
                  ++ F LIAG C +ES      +A +L  IC  LNI  +YKSS+DKANRSS   
Sbjct: 4   GDFEIGLDKPFFLIAGTCVVESEQMTIDVAGRLKEICAKLNIPFIYKSSYDKANRSSGKS 63

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G+ +G  I  ++K++ G P+LTDVH E + E +A  VD+LQ PA LCRQTD + A 
Sbjct: 64  FRGLGMDEGLRILSEVKRQLGLPVLTDVHAEHEIEQVASVVDVLQTPAFLCRQTDFIHAC 123

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMR 208
           A++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMR
Sbjct: 124 ARSGKPVNIKKGQFLAPGDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMR 183

Query: 209 SIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP 268
           S+ IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+G++G+F+ETH +P
Sbjct: 184 SLAIMRETNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVAVGVSGLFMETHPNP 243

Query: 269 DNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
             A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 244 AEARSDGPNAVPLHRMADLLETLVTLDQAVK 274


>gi|296113533|ref|YP_003627471.1| 3-deoxy-8-phosphooctulonate synthase KdsA [Moraxella catarrhalis
           RH4]
 gi|37728655|gb|AAO63018.1| KdsA [Moraxella catarrhalis 7169]
 gi|295921227|gb|ADG61578.1| 3-deoxy-8-phosphooctulonate synthase KdsA [Moraxella catarrhalis
           RH4]
 gi|326559536|gb|EGE09950.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           7169]
 gi|326562726|gb|EGE13028.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           103P14B1]
 gi|326564638|gb|EGE14856.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           46P47B1]
 gi|326565455|gb|EGE15626.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           12P80B1]
 gi|326568582|gb|EGE18653.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           BC7]
 gi|326568707|gb|EGE18777.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           BC8]
 gi|326572576|gb|EGE22565.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           CO72]
 gi|326574172|gb|EGE24120.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           101P30B1]
 gi|326575611|gb|EGE25535.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           O35E]
          Length = 287

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 129/265 (48%), Positives = 171/265 (64%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +   N++ FVL  G   +ES + AF IAE+   ICQ LNIG V+K+SFDKANRSSL   
Sbjct: 16  GIEIGNDKPFVLFGGMNVLESRELAFEIAEQYIDICQRLNIGYVFKASFDKANRSSLHSF 75

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG  L+ G     D+K+ Y  PI+TDVH   Q   +A   DILQ+PA L RQTDL++A A
Sbjct: 76  RGPSLENGLTWLNDIKETYNVPIITDVHEPYQAAPVAKVADILQLPAFLSRQTDLVSAIA 135

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG++INVKK QFL+P EM +I+ K    G   V+ CERG++FGYN LV DM     M S
Sbjct: 136 RTGKIINVKKAQFLAPHEMRHIINKCLEAGNDQVILCERGSAFGYNNLVVDMLGFDTMKS 195

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           M VPV FD +H++Q+PG  G+ +GG R  I  LA+A +A G+AG+FLE H DPD A  DG
Sbjct: 196 MNVPVFFDVTHALQEPGARGDSAGGRRHQITTLARAGMATGLAGLFLEAHPDPDKAKCDG 255

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           P+ + +  L   L Q+  +D ++K 
Sbjct: 256 PSALRLNQLEPFLIQIKQLDDLVKG 280


>gi|67458505|ref|YP_246129.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia felis
           URRWXCal2]
 gi|75537028|sp|Q4UN94|KDSA_RICFE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|67004038|gb|AAY60964.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia felis URRWXCal2]
          Length = 274

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 156/266 (58%), Positives = 197/266 (74%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLIAGPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLIAGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVNG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G++KG EI   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGLGIEKGLEILSKVKSEFDCPIVTDVHSESQCTETAEIADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ I+ 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDILFTERGACFGYNNLVSDMRSLAIIA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  +GGER+Y+  LAKAA A+GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLAKAATAVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP MI + +L  +L +L   DKI K 
Sbjct: 248 GPCMIKLDNLESILIKLKKYDKITKE 273


>gi|157825218|ref|YP_001492938.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia akari str.
           Hartford]
 gi|166220454|sp|A8GM05|KDSA_RICAH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|157799176|gb|ABV74430.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia akari str.
           Hartford]
          Length = 274

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 154/266 (57%), Positives = 199/266 (74%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLIAGPCQIE  DHA  +AEKL  +   L+I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLIAGPCQIEGKDHALFMAEKLVKLTSKLDIAFIYKSSFDKANRTSVNG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG++KG EI   +K ++  PI+TD+H+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGVGIEKGLEILSKVKSEFDCPIVTDIHSESQCTETAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLQAFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VP++FDA+HSVQQPG  G  +GG+R+Y+  LAKAA+A+GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPIVFDATHSVQQPGGLGGSTGGDRKYVELLAKAAIAVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP M+ + +L  +L +L   DKI K 
Sbjct: 248 GPCMMKLDNLESILIKLKKYDKITKE 273


>gi|240950070|ref|ZP_04754372.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus minor
           NM305]
 gi|240295445|gb|EER46200.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus minor
           NM305]
          Length = 284

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 130/280 (46%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            TN  + LG     +  +N + FVL  G   +ES D A  + EK   + Q L +  V+K+
Sbjct: 1   MTNKVVTLG----HIEIANNKPFVLFGGMNVLESRDMAMQVCEKYVEVTQKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK+ +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKETFGVKIITDVHEIHQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +HS+Q     G  SGG R  +  LA+A +AIG+AG+
Sbjct: 177 LVVDMLGFNVMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARAGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPDPNKAKCDGPSALPLSKLEAFVSQMKAIDDLVKS 276


>gi|32033822|ref|ZP_00134107.1| COG2877: 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate
           synthase [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|126209494|ref|YP_001054719.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae L20]
 gi|190151396|ref|YP_001969921.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|303250475|ref|ZP_07336672.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307244796|ref|ZP_07526895.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307251516|ref|ZP_07533423.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307253750|ref|ZP_07535604.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307256015|ref|ZP_07537803.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307258207|ref|ZP_07539950.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307262575|ref|ZP_07544206.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|238692364|sp|B3GZI6|KDSA_ACTP7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|126098286|gb|ABN75114.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|189916527|gb|ACE62779.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302650463|gb|EFL80622.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306854241|gb|EFM86447.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306860980|gb|EFM92986.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306863234|gb|EFM95174.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865437|gb|EFM97332.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306867667|gb|EFM99512.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306872073|gb|EFN03786.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 284

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ F L  G   +ES D A  + E+   +   L +  V+K+
Sbjct: 1   MNNKIVKVG----NIEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVNIITDVHEIYQCKPVAEVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G ++V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIAECGNENVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM     G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 177 LVVDMLGFNIMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP+NA  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPDPNNAKCDGPSALPLSKLEAFVSQMKAIDDLVKS 276


>gi|319761808|ref|YP_004125745.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alicycliphilus
           denitrificans BC]
 gi|330826332|ref|YP_004389635.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alicycliphilus
           denitrificans K601]
 gi|317116369|gb|ADU98857.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alicycliphilus
           denitrificans BC]
 gi|329311704|gb|AEB86119.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alicycliphilus
           denitrificans K601]
          Length = 285

 Score =  281 bits (718), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 134/271 (49%), Positives = 179/271 (66%), Gaps = 6/271 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAGPC +ES      +A +L  I  SL I  ++KSS+DKANRSS A  
Sbjct: 5   GFDIGLDRPFFLIAGPCVVESEQLQMDVAGRLQEITASLGIPFIFKSSYDKANRSSGASF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G++KG EI   +KK+ G P+LTDVHTE +  A+A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGPGMEKGLEILAKVKKQLGVPVLTDVHTEAEIPAVAQVVDVLQTPAFLCRQTDFIRAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K  A            + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARAAAREAGLSEDRFMACERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG R+ +  L++AAVA+G+AG+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGMREMVPVLSRAAVAVGVAGLFMETHPDPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +A SDGPN + +K +  LL  L+ +D + K 
Sbjct: 245 SALSDGPNAVPLKHMRALLETLVQLDAVTKK 275


>gi|113461089|ref|YP_719157.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus somnus
           129PT]
 gi|123327271|sp|Q0I3B9|KDSA_HAES1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|112823132|gb|ABI25221.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus somnus
           129PT]
          Length = 284

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 120/268 (44%), Positives = 174/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +   N + FVL  G   +ES D A  + EK   + Q L +  ++K+SFDKANRSS+  
Sbjct: 9   GNIEIGNNKPFVLFGGMNVLESRDMAMQVCEKYVEVTQKLGVPYIFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF++LK+ +G  ++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFQELKETFGVKVITDVHEIYQCRPVAEVVDIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFLSP ++ NI++K+   G   V+ C+RGT+FGY+ LV DM    IM 
Sbjct: 129 ARTGAVINVKKPQFLSPGQIGNIVEKIAECGNNKVILCDRGTNFGYDNLVVDMLGFNIMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE+H +P+ A 
Sbjct: 189 KVSQGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGLFLESHPNPNQAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   ++Q+ AID ++K 
Sbjct: 249 CDGPSALPLSKLEPFIAQMKAIDDLVKS 276


>gi|85710299|ref|ZP_01041364.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erythrobacter sp. NAP1]
 gi|85689009|gb|EAQ29013.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erythrobacter sp. NAP1]
          Length = 313

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 127/264 (48%), Positives = 175/264 (66%), Gaps = 6/264 (2%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
               LIAGPC IES DH+  +A++L  I + L + L++KSSFDKANR+S    RG G++ 
Sbjct: 36  SPLFLIAGPCVIESEDHSLSVADELAKIAERLGVLLIFKSSFDKANRTSGTSFRGPGMED 95

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G  I   ++ + G P+LTDVH   Q   +A+ VD+LQ PA L RQTD + + A TG+ +N
Sbjct: 96  GLRILEKVRAETGLPVLTDVHEPAQSTPVAEVVDVLQTPAFLARQTDFICSVAATGKPVN 155

Query: 163 VKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           +KK QF++P +M N++ K  +          + L CERGTSFGYNTLV+DMR + IM   
Sbjct: 156 IKKAQFMAPADMQNVVAKARSAAESAGHRPDNFLLCERGTSFGYNTLVSDMRGLSIMAET 215

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQQPG  G+ SGG+ +Y+  LA+AAVA G++G+F+ETH DP NA SDGP
Sbjct: 216 GCPVVFDATHSVQQPGGLGSKSGGQSEYVPLLARAAVAAGVSGVFMETHPDPANALSDGP 275

Query: 277 NMINIKDLPKLLSQLLAIDKIIKP 300
           N + +     L+ QL  ID++ K 
Sbjct: 276 NALPLDRFEGLVRQLQRIDEVTKS 299


>gi|90419618|ref|ZP_01227528.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336555|gb|EAS50296.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 278

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 156/265 (58%), Positives = 200/265 (75%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
              F N + F LIAGPCQ+ES DHA MIAEK+  I   L IG V+K+SFDKANR+SL G+
Sbjct: 12  NTVFDNYRPFALIAGPCQMESRDHAMMIAEKMKRITDDLGIGYVFKASFDKANRTSLQGR 71

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+GL     +F ++ + +  P+LTDVHTE+QC       DILQIPA LCRQTDLL AAA
Sbjct: 72  RGIGLADALPVFEEVARTFDLPVLTDVHTEEQCREAGTVCDILQIPAFLCRQTDLLIAAA 131

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
            TGRV+N+KKGQFL+PW+M N+L K+   G  +VL  ERG SFGYNTLV+D R++PIM  
Sbjct: 132 GTGRVVNIKKGQFLAPWDMSNVLAKVTESGNPNVLLTERGASFGYNTLVSDFRALPIMAG 191

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           MG PV+FDA+HSVQQPG  G  SGGER+++  L++AAVA+G+AG+F+ETH+DPDNAPSDG
Sbjct: 192 MGAPVVFDATHSVQQPGGQGGSSGGERRFVETLSRAAVAVGVAGLFIETHEDPDNAPSDG 251

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNM+ +  +P+LL +L A+D + K 
Sbjct: 252 PNMVPLDRMPELLKRLQALDAVAKG 276


>gi|312144457|ref|YP_003995903.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halanaerobium sp.
           'sapolanicus']
 gi|311905108|gb|ADQ15549.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halanaerobium sp.
           'sapolanicus']
          Length = 282

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 126/267 (47%), Positives = 178/267 (66%), Gaps = 1/267 (0%)

Query: 34  KNQVTFSN-EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
            +++ F + ++ FVL+AGPC IE  +  F IAE +  I   L I  V+KSSFDKANRSS+
Sbjct: 8   NDEIIFGDSKKPFVLLAGPCAIEEEERVFKIAEGIKEITSRLGIPYVFKSSFDKANRSSI 67

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG G+ KG  I + +K++   P+++D+H  +Q E  A+ +DI+QIPA L RQTD+L 
Sbjct: 68  ESYRGPGIDKGLAILKRIKEELNLPVISDIHLPEQAEKAAEVLDIIQIPAFLSRQTDMLV 127

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           AA  T R+INVKKGQFL+PW++  ++ K+ + G + +L  ERG SFGYN LV D RS+P 
Sbjct: 128 AAGNTDRIINVKKGQFLAPWDIDQVVNKIESTGNEKILLTERGVSFGYNNLVVDFRSLPR 187

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M   G PV+FD +HSVQ PG  G+ S GE++++  L +A +A G+  +F+E H +P  A 
Sbjct: 188 MRKTGYPVVFDVTHSVQLPGGAGDSSDGEKEFVPYLMRAGLAAGVDSLFMEVHDNPAEAK 247

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
           SDG NMI +  L K+L Q LAID  +K
Sbjct: 248 SDGANMIPLDKLEKILKQALAIDSAVK 274


>gi|319407095|emb|CBI80732.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella sp. 1-1C]
          Length = 280

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 170/272 (62%), Positives = 211/272 (77%)

Query: 29  HLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKAN 88
           ++      V FSNE    LIAGPCQ+ES DHAF +A ++  I     IG VYKSS+DKAN
Sbjct: 5   NITVKVGNVVFSNEAPLSLIAGPCQMESRDHAFEMAGRIKTIADQFGIGFVYKSSYDKAN 64

Query: 89  RSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQT 148
           R+SL   RG+GL+K   IF DLKK++G P+LTDVHTE+QC AIA  VD+LQIPA LCRQT
Sbjct: 65  RTSLNATRGIGLEKAIAIFSDLKKEFGCPVLTDVHTEEQCMAIASVVDVLQIPAFLCRQT 124

Query: 149 DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMR 208
           DLL AAA+TGR+IN+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGYN LV+DMR
Sbjct: 125 DLLVAAARTGRIINIKKGQFLAPWDMRNVLEKVTKSGNPNVMLCERGTSFGYNRLVSDMR 184

Query: 209 SIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP 268
           S+PIM S G PVIFDA+HSVQ+PG  GN SGG+R+++  LA+AAV+IG+AGIFLETHQDP
Sbjct: 185 SLPIMRSFGAPVIFDATHSVQEPGGQGNSSGGQREFVEVLARAAVSIGVAGIFLETHQDP 244

Query: 269 DNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DNAPSDG NMI I +L +LL  L+  D++ K 
Sbjct: 245 DNAPSDGLNMIKIDNLYRLLEILIDFDRLAKK 276


>gi|157964128|ref|YP_001498952.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia massiliae
           MTU5]
 gi|157843904|gb|ABV84405.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia massiliae MTU5]
          Length = 275

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 154/266 (57%), Positives = 197/266 (74%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLI GPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 9   NNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHG 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G++KG EI   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 69  IRGLGIEKGLEILSKVKSEFDCPIVTDVHSESQCTETAEVADILQIPAFLCRQTDLLQAA 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 129 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDILFTERGACFGYNNLVSDMRSLAIMA 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G+ +GGER+Y+  LAKAA ++GIAG+++E HQDPDNAPSD
Sbjct: 189 ELNVPVVFDATHSVQQPGGLGSSTGGERKYVELLAKAATSVGIAGMYMEVHQDPDNAPSD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP M+ + +L  +L +L   DKI K 
Sbjct: 249 GPCMMKLDNLESILIKLKKYDKITKE 274


>gi|319942353|ref|ZP_08016667.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sutterella
           wadsworthensis 3_1_45B]
 gi|319804041|gb|EFW00949.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sutterella
           wadsworthensis 3_1_45B]
          Length = 285

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 128/269 (47%), Positives = 180/269 (66%), Gaps = 6/269 (2%)

Query: 38  TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRG 97
              N + F LIAGPC IES   A  IA ++  I   L I  ++K+S+DKANR+S    RG
Sbjct: 7   EVGNRRPFFLIAGPCVIESEAMALDIAHQMKEITAELGIPYIFKASYDKANRTSGKSFRG 66

Query: 98  VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQT 157
           +G++KG EI   ++ + G P+LTDVHTE +  A+A  VD+LQ PA LCRQTD + A AQ+
Sbjct: 67  LGMEKGLEILAKVRAEVGVPVLTDVHTEAEVPAVAAVVDVLQTPAFLCRQTDFIRACAQS 126

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRSIP 211
           G+ +N+KKGQFL+P +M N++ K  A            + CERG SFGY  LV+DMR + 
Sbjct: 127 GKPVNIKKGQFLAPGDMANVIAKARAAAQEAGLDPDRFMCCERGASFGYGNLVSDMRGLA 186

Query: 212 IMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
           IM + G PV+ DA+HSVQ PG +G  SGG+RQ++  LA+AA A+G+AG F+ETH +P  A
Sbjct: 187 IMRATGAPVVMDATHSVQLPGGNGTSSGGQRQFVPVLARAACAVGVAGFFMETHPNPAEA 246

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            SDGPN + +  + +LL++L+ ID+++K 
Sbjct: 247 LSDGPNAVPLNRMKELLAELVEIDRLVKA 275


>gi|326567781|gb|EGE17887.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Moraxella catarrhalis
           BC1]
          Length = 287

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 129/265 (48%), Positives = 171/265 (64%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +   N++ FVL  G   +ES + AF IAE+   ICQ LNIG V+K+SFDKANRSSL   
Sbjct: 16  GIEIGNDKPFVLFGGMNVLESRELAFEIAEQYINICQRLNIGYVFKASFDKANRSSLHSF 75

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG  L+ G     D+K+ Y  PI+TDVH   Q   +A   DILQ+PA L RQTDL++A A
Sbjct: 76  RGPSLENGLTWLNDIKETYNVPIITDVHEPYQAAPVAKVADILQLPAFLSRQTDLVSAIA 135

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG++INVKK QFL+P EM +I+ K    G   V+ CERG++FGYN LV DM     M S
Sbjct: 136 RTGKIINVKKAQFLAPHEMRHIINKCLEAGNDQVILCERGSAFGYNNLVVDMLGFDTMKS 195

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           M VPV FD +H++Q+PG  G+ +GG R  I  LA+A +A G+AG+FLE H DPD A  DG
Sbjct: 196 MNVPVFFDVTHALQEPGARGDSAGGRRHQITTLARAGMATGLAGLFLEAHPDPDKAKCDG 255

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           P+ + +  L   L Q+  +D ++K 
Sbjct: 256 PSALRLNQLEPFLIQIKQLDDLVKG 280


>gi|2498500|sp|P95514|KDSA_PASHA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|1683632|gb|AAB36513.1| 3-deoxy-D-manno-octulosonic acid synthetase KdsA [Mannheimia
           haemolytica]
          Length = 284

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 122/268 (45%), Positives = 172/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ F L  G   +ES D A  + EK   +   L +  V+K+SFDKANRSS+  
Sbjct: 9   GNLEIANDKPFTLFGGMNVLESRDMAMAVCEKYVEVTNKLGVPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ LV DM    +M 
Sbjct: 129 ARTGAVINVKKPQFLSPGQMGNIVEKIEECGNDQVILCDRGTNFGYDNLVVDMLGFSVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G PVIFD +HS+Q     G  S G R  +  LA+A +A+GIAG+FLE H DP+NA 
Sbjct: 189 QVSKGCPVIFDVTHSLQCRDPFGAASSGRRAQVTELARAGLAVGIAGLFLEAHPDPNNAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   + Q+ AID ++K 
Sbjct: 249 CDGPSALPLSTLEAFVGQMKAIDDLVKS 276


>gi|149202423|ref|ZP_01879396.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseovarius sp. TM1035]
 gi|149144521|gb|EDM32552.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseovarius sp. TM1035]
          Length = 277

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 146/268 (54%), Positives = 194/268 (72%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
             N     N++   LIAGPCQ+ES DHA MIA  L   C +   GL++K SFDKANR+SL
Sbjct: 5   DLNGWAIGNDRPLTLIAGPCQLESADHAQMIAGTLQEACAAHGAGLIFKGSFDKANRTSL 64

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
           +GKRG+G+ +G ++ + +K   G P+LTD+HT  QC  +A+  D+LQIPA LCRQTDLL 
Sbjct: 65  SGKRGLGVDEGLKVLQSVKDTLGLPVLTDIHTADQCAPVAEVADVLQIPAFLCRQTDLLI 124

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           AA +TG VINVKKGQFL+PW+M N++ K+ + G   +L  ERGTSFGYNTLV DMRS+P 
Sbjct: 125 AAGETGAVINVKKGQFLAPWDMPNVISKIESTGNTRILLTERGTSFGYNTLVADMRSLPQ 184

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M + G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAVA+G+A +F+ETH+DPDNAP
Sbjct: 185 MAATGYPVVMDATHSVQQPGGRGGSSGGQREFAPVMARAAVALGVACVFIETHEDPDNAP 244

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           SDGPNMI +  +  L+  L+  D++ K 
Sbjct: 245 SDGPNMIPLTQMSALIDTLMQFDRLAKA 272


>gi|170717665|ref|YP_001784741.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus somnus 2336]
 gi|238688018|sp|B0UUE2|KDSA_HAES2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|168825794|gb|ACA31165.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus somnus 2336]
          Length = 284

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 120/268 (44%), Positives = 174/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +   N + FVL  G   +ES D A  + EK   + Q L +  ++K+SFDKANRSS+  
Sbjct: 9   GNIEIGNNKPFVLFGGMNVLESRDMAMQVCEKYVEVTQKLGVPYIFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF++LK+ +G  ++TDVH   QC  +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFQELKETFGVKVITDVHEIYQCRPVAEVVDIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFLSP ++ NI++K+   G   V+ C+RGT+FGY+ LV DM    IM 
Sbjct: 129 ARTGAVINVKKPQFLSPGQIGNIVEKIAECGNNKVILCDRGTNFGYDNLVVDMLGFNIMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE+H +P+ A 
Sbjct: 189 KVSQGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGLFLESHPNPNQAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   ++Q+ AID ++K 
Sbjct: 249 CDGPSALPLSKLEPFVAQMKAIDDLVKS 276


>gi|319943952|ref|ZP_08018232.1| bis(5-nucleosyl)-tetraphosphatase [Lautropia mirabilis ATCC 51599]
 gi|319742713|gb|EFV95120.1| bis(5-nucleosyl)-tetraphosphatase [Lautropia mirabilis ATCC 51599]
          Length = 285

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 133/266 (50%), Positives = 179/266 (67%), Gaps = 6/266 (2%)

Query: 40  SNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVG 99
             +Q F L+AGPC IES   A   A +L  IC  L+I  VYKSSFDKANRSS    RG G
Sbjct: 9   GLDQPFFLLAGPCAIESLQLALDTAGQLKEICAELDIPFVYKSSFDKANRSSGKSFRGPG 68

Query: 100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGR 159
           L+ G ++  ++K++ G P++TDVH   Q + +A+ VD+LQ PA LCRQTD + A A +GR
Sbjct: 69  LEGGLKVLAEVKRQIGVPVVTDVHEIDQIKPVAEVVDVLQTPAFLCRQTDFINAVAASGR 128

Query: 160 VINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            +N+KKGQFL+P +M  ++ K  A           V+ CERG SFGYN LV+DMRS+ IM
Sbjct: 129 PVNIKKGQFLAPHDMKQVVAKARAAAKEAGVDEDCVMVCERGASFGYNNLVSDMRSLAIM 188

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
              G PV+FDA+HSVQ PG  G+ SGG+R++I  LA+AAVA G+AG+F+ETH DP++A S
Sbjct: 189 RETGCPVVFDATHSVQLPGGQGDRSGGQREFIPVLARAAVATGVAGLFMETHPDPEHALS 248

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGPN   +  +  LL+ L  +D ++K
Sbjct: 249 DGPNAWPLARMHDLLATLKELDAVVK 274


>gi|332971360|gb|EGK10319.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Psychrobacter sp.
           1501(2011)]
          Length = 286

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 131/266 (49%), Positives = 173/266 (65%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T +N++ FVL  G   +ES + AF IAE    IC  L IG V+K+SFDKANRSSL  
Sbjct: 14  NDMTIANDKPFVLFGGMNVLESKELAFEIAEGYIDICNRLGIGYVFKASFDKANRSSLNS 73

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG +    +K+KY  PI+TDVH   Q + +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 74  YRGPGLEKGVDWLGQIKEKYNVPIITDVHEPYQAQPVAEVADIIQLPAFLSRQTDLVQAM 133

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +IN+KK QFL+P EM +I+ K    G   ++ CERGTSFGYN LV DM     M 
Sbjct: 134 AKTGAIINIKKAQFLAPHEMRHIINKCLEAGNDKIILCERGTSFGYNNLVVDMLGFDTMK 193

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +HS+QQPG   + +GG R+ I  LA+A +A G+AG+FLE H +P+ A  D
Sbjct: 194 QMDVPVFFDVTHSLQQPGARSDSAGGRREQITTLARAGMATGLAGLFLEAHPEPEVAKCD 253

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   LSQL  ID ++K 
Sbjct: 254 GPCALRMSQLEPFLSQLKQIDDLVKG 279


>gi|291532170|emb|CBL05283.1| 3-deoxy-8-phosphooctulonate synthase [Megamonas hypermegale
           ART12/1]
          Length = 273

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 129/266 (48%), Positives = 176/266 (66%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
                      VL+AGPC +ES++ +  I + +  I   L I  V+K+SFDKANRSS  G
Sbjct: 7   GNFEVGAGNPLVLLAGPCVLESYERSLYIGKTIKEITSRLGIPYVFKASFDKANRSSYNG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +  + +K++   P++TD+H E Q E ++  VD+LQIPA L RQTDLL  A
Sbjct: 67  YRGPGLEEGLKWLQSIKEELNVPVVTDIHNETQVEPVSKVVDVLQIPAFLSRQTDLLYTA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A++G V+NVKKGQFL+P +M N+++KL   G++ +L  ERG SFGYN LV DMRS PIM 
Sbjct: 127 AKSGCVVNVKKGQFLAPADMKNVVKKLEEAGSEKILLTERGASFGYNNLVVDMRSFPIMR 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PVIFDA+HSVQ PG  G  S G R+Y+  LA+ A  +G+ G F+E H +P+ A  D
Sbjct: 187 STGYPVIFDATHSVQLPGGAGTSSAGNREYVEFLARGAAGVGVDGFFMEVHDNPEEALCD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNM+ +  L  LL  L+AI++I K 
Sbjct: 247 GPNMVYLDKLEDLLKDLIAINEITKK 272


>gi|330817643|ref|YP_004361348.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia gladioli
           BSR3]
 gi|327370036|gb|AEA61392.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia gladioli
           BSR3]
          Length = 284

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 127/271 (46%), Positives = 172/271 (63%), Gaps = 6/271 (2%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
                  ++ F LIAG C +ES       A +L   C  LNI  +YKSSFDKANRSS   
Sbjct: 4   GDFEVGLDRPFFLIAGTCVVESEQMTIDTAGRLKESCAKLNIPFIYKSSFDKANRSSGTS 63

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+ +G  I  ++K++ G P+LTDVH   + E +A  VD+LQ PA LCRQTD + A 
Sbjct: 64  FRGPGMDEGLRILSEVKRQLGLPVLTDVHEVDEIEPVAAVVDVLQTPAFLCRQTDFIHAC 123

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMR 208
           A++G+ +N+KKGQFL+P +M N++ K  A            + CERG SFGYN LV+DMR
Sbjct: 124 ARSGKPVNIKKGQFLAPHDMKNVIDKARAAAREAGLSEDRFMACERGVSFGYNNLVSDMR 183

Query: 209 SIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP 268
           S+ IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P
Sbjct: 184 SLAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNP 243

Query: 269 DNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
             A SDGPN + +  +  LL  L+ +D  +K
Sbjct: 244 AEAKSDGPNAVPLHRMAALLETLVTLDAAVK 274


>gi|34580951|ref|ZP_00142431.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia sibirica 246]
 gi|28262336|gb|EAA25840.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia sibirica 246]
          Length = 274

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 155/266 (58%), Positives = 197/266 (74%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLI GPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG++KG EI   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGVGIEKGLEILSKVKSEFDCPIVTDVHSESQCTETAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G+ +GGER+Y+  LAKAA ++GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGSSTGGERKYVELLAKAATSVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP M+ + +L  +L +L   DKI K 
Sbjct: 248 GPCMMKLDNLESILIKLKKYDKITKE 273


>gi|119383978|ref|YP_915034.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Paracoccus denitrificans
           PD1222]
 gi|119373745|gb|ABL69338.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Paracoccus denitrificans
           PD1222]
          Length = 277

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 141/266 (53%), Positives = 192/266 (72%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             VT  N+Q   LIAGPCQ+E+ DHA MIAE +   C     G V+K+S+DKANR+SL G
Sbjct: 7   GNVTVGNDQPLALIAGPCQLETLDHALMIAETVAESCAKAGAGFVFKASYDKANRTSLKG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           +RG+G+ +G  +  +++++ G P+LTDVH  +Q       VD++QIPA L RQTDLL AA
Sbjct: 67  RRGIGIDEGLRMLDEVRRRIGCPVLTDVHDIEQARLAGAVVDVIQIPAFLSRQTDLLLAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +T   +N+KKGQFL+PW+M N+ +K+ + G + +L  ERG SFGYNTLV DMRS+PIM 
Sbjct: 127 GETPAAVNIKKGQFLAPWDMPNVAEKVASTGNERILLTERGVSFGYNTLVADMRSLPIMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVI DA+HSVQQPG  G  SGG+R++   +A+AAVA+G+AG+F+ETHQDPDNAPSD
Sbjct: 187 RTGWPVIMDATHSVQQPGGQGGSSGGQREFAPVMARAAVALGVAGVFIETHQDPDNAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNMI++  +P L++ L+  D + K 
Sbjct: 247 GPNMIHLDRMPALIASLMRFDALAKS 272


>gi|219870996|ref|YP_002475371.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus parasuis
           SH0165]
 gi|254807748|sp|B8F521|KDSA_HAEPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|219691200|gb|ACL32423.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus parasuis
           SH0165]
          Length = 284

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 125/268 (46%), Positives = 175/268 (65%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  + EK   + Q L +  V+K+SFDKANRSS+  
Sbjct: 9   GNIDIANDKPFVLFGGMNVLESRDMAMQVCEKYVEVTQRLGVPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVAEVVDIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ LV DM    +M 
Sbjct: 129 ARTGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGTNFGYDNLVVDMLGFNVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G PVIFD +HS+Q     G  SGG R  +  LA+A +AIG+AG+FLE H DP+ A 
Sbjct: 189 KVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTKLARAGMAIGLAGLFLEAHPDPNKAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 249 CDGPSALPLSKLEAFVSQMKAIDDLVKS 276


>gi|78066883|ref|YP_369652.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia sp. 383]
 gi|77967628|gb|ABB09008.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia sp. 383]
          Length = 284

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 125/270 (46%), Positives = 174/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC  LNI  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNIPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILSEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKAREAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETSAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLNRMGALLETLVTLDQAVK 274


>gi|94309998|ref|YP_583208.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cupriavidus
           metallidurans CH34]
 gi|93353850|gb|ABF07939.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Cupriavidus
           metallidurans CH34]
          Length = 289

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 130/270 (48%), Positives = 177/270 (65%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAGPC IES   A   A +L AI   L I  +YKSSFDKANRSS    
Sbjct: 5   GFDVGLDKPFFLIAGPCVIESEQMALDTAGELKAITGELGIPFIYKSSFDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G++KG EI   +K++ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMEKGLEILATVKRQIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLPDDVFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA G+AG+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVATGVAGLFMETHPDPS 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  + +LL+ L  +D ++K
Sbjct: 245 KAMSDGPNAVPLSRMKELLTVLRDLDGMVK 274


>gi|297569296|ref|YP_003690640.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925211|gb|ADH86021.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 284

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 127/275 (46%), Positives = 175/275 (63%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
           +  + I       +      Q   L+AGPC IES      IA  L  +   L + L++K+
Sbjct: 6   NMASVIQPVEIAGRFRIGPGQPLTLLAGPCVIESESIMRQIAGHLKEVSARLGVNLIFKA 65

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANR+SL   RG G  +G  +   + +++  P+++DVH   Q  A A  +D+LQIPA
Sbjct: 66  SFDKANRTSLESYRGPGPAEGLAMLAAIGREFDLPLISDVHESGQAAAAAAVLDVLQIPA 125

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            LCRQTDLL AAAQTG+ +NVKKGQF +PW+M     K+ + G   VL  ERG+SFGYN 
Sbjct: 126 FLCRQTDLLVAAAQTGKPVNVKKGQFAAPWDMAPATAKVRSAGTGGVLLTERGSSFGYNN 185

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV DMRS+P++  +G PVIFDA+HSVQ PG  G+ SGG+R+++  LA+AA A+GI G+F+
Sbjct: 186 LVVDMRSLPLLRQLGSPVIFDATHSVQLPGGAGDRSGGQRRFVPTLARAAAAVGIDGLFM 245

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKI 297
           E H DP  A  DGPN   +  + +LL Q+LAI ++
Sbjct: 246 EVHPDPRQALCDGPNSWPLDQVEELLRQVLAIHQL 280


>gi|221634580|ref|YP_002523268.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           KD131]
 gi|221163453|gb|ACM04415.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           KD131]
          Length = 669

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 142/284 (50%), Positives = 195/284 (68%), Gaps = 4/284 (1%)

Query: 18  KNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIG 77
           +  M  T   + +G     +         LI GPCQ+ES DHA M+AE++   C      
Sbjct: 389 ETAMTETPTIVTIGD----IAIGGGHPIALITGPCQLESLDHARMMAERIAEACAPTGTK 444

Query: 78  LVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDI 137
            ++K+S+DKANRSSL+  RG+G++KG EI   +++++G P+LTDVH    C   A+  D+
Sbjct: 445 FIFKASYDKANRSSLSTARGLGMEKGLEILGRIREEFGVPVLTDVHEPGHCATAAEVCDV 504

Query: 138 LQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTS 197
           LQIPA LCRQTDLL AA +TGR +NVKKGQFL+PW+M N+  K+ + G + +L CERGTS
Sbjct: 505 LQIPAFLCRQTDLLLAAGETGRAVNVKKGQFLAPWDMKNVADKVASTGNRRILLCERGTS 564

Query: 198 FGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGI 257
           FGYNTLVTD R +P M + G PV+FDA+HSVQQPG  G  SGG+R++   LA+AA A+G+
Sbjct: 565 FGYNTLVTDFRGLPTMAATGWPVVFDATHSVQQPGGLGGSSGGQREFAPVLARAACAVGV 624

Query: 258 AGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           + +F+ETH+DPD APSDGPNMI +  + +L++ L A D + K L
Sbjct: 625 SALFIETHEDPDRAPSDGPNMIPVDRMGRLIADLCAFDALAKSL 668


>gi|152979098|ref|YP_001344727.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           succinogenes 130Z]
 gi|171704317|sp|A6VP95|KDSA_ACTSZ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|150840821|gb|ABR74792.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           succinogenes 130Z]
          Length = 284

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 179/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            TN  + +G     +  +N + FVL  G   +ES D A  + EK   +   L +  V+K+
Sbjct: 1   MTNKTVKIG----NIDVANHKPFVLFGGMNVLESRDMAMQVCEKYVEVTDKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LKK +G  ++ DVH   QC  +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKKTFGVKVIADVHEIYQCNPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +HS+Q     G  SGG R+ +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFGVMKKASKGCPVIFDVTHSLQCRDPFGAASGGRREQVTELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP+NA  DGP+ + +  L   + Q+ AID+++K 
Sbjct: 237 FLEAHPDPNNAKCDGPSALPLSALEGFVVQMKAIDELVKS 276


>gi|9106278|gb|AAF84098.1|AE003962_8 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa 9a5c]
          Length = 295

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 124/265 (46%), Positives = 167/265 (63%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  Q   LIAGPC IES       A  L  I   L +  ++KSSFDKANR+S +  
Sbjct: 24  GFEVGLNQPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSF 83

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++   +K + G P+LTDVH     + +A  VD+LQ PA L RQTD +    
Sbjct: 84  RGPGLEEGLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVC 143

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
             G+ +N+KKGQFLSPW+M  +++K  + G   +L CERG SFGYN LV+DMRS+ +M  
Sbjct: 144 AVGKPVNIKKGQFLSPWDMKPVVEKAKSTGNSQILVCERGASFGYNNLVSDMRSLAVMRE 203

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP NA SDG
Sbjct: 204 TGCPVVFDATHSVQLPGAQGGRSGGQREFVPVLARAAVAVGISGLFAETHPDPPNALSDG 263

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  +  LL  L+ +D + K 
Sbjct: 264 PNAWPLHTMAMLLETLVELDAVTKK 288


>gi|77747541|ref|NP_298578.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa 9a5c]
 gi|20532145|sp|Q9PDU0|KDSA_XYLFA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
          Length = 276

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 124/265 (46%), Positives = 167/265 (63%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  Q   LIAGPC IES       A  L  I   L +  ++KSSFDKANR+S +  
Sbjct: 5   GFEVGLNQPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++   +K + G P+LTDVH     + +A  VD+LQ PA L RQTD +    
Sbjct: 65  RGPGLEEGLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
             G+ +N+KKGQFLSPW+M  +++K  + G   +L CERG SFGYN LV+DMRS+ +M  
Sbjct: 125 AVGKPVNIKKGQFLSPWDMKPVVEKAKSTGNSQILVCERGASFGYNNLVSDMRSLAVMRE 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP NA SDG
Sbjct: 185 TGCPVVFDATHSVQLPGAQGGRSGGQREFVPVLARAAVAVGISGLFAETHPDPPNALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   +  +  LL  L+ +D + K 
Sbjct: 245 PNAWPLHTMAMLLETLVELDAVTKK 269


>gi|330994539|ref|ZP_08318463.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter sp.
           SXCC-1]
 gi|329758393|gb|EGG74913.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter sp.
           SXCC-1]
          Length = 282

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 150/265 (56%), Positives = 195/265 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +T  N+  F LIAGPCQIES  HA  +A+ L+ I   L IGL+YKSSFDKANR+S+ G
Sbjct: 10  GSLTVGNQSPFTLIAGPCQIESASHAMEVADALHGIATRLGIGLIYKSSFDKANRTSING 69

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG+ +G +I   ++ ++G P+LTDVH   QC A+A++VD+LQIPA LCRQTDLL AA
Sbjct: 70  ARGVGMAQGLDILGQVRARFGMPVLTDVHLPDQCAAVAETVDVLQIPAFLCRQTDLLLAA 129

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            QTG  IN+KKGQFL+PW+M N+  K+ + G + ++ CERGTSFGYNTLV DMR +PIM 
Sbjct: 130 GQTGAAINIKKGQFLAPWDMANVAAKVASTGNERIMLCERGTSFGYNTLVNDMRGLPIMA 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+HSVQQPG  G  SGG+R +   LA+AA+A+G+AG+F+ETH DPD APSD
Sbjct: 190 GTGYPVIFDATHSVQQPGGLGTSSGGQRVFAPILARAALAVGVAGVFIETHPDPDTAPSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           G  M+ +  +  LL+ LL  D++ K
Sbjct: 250 GTTMLPLACMEDLLTTLLRYDRLTK 274


>gi|259419343|ref|ZP_05743260.1| 3-deoxy-8-phosphooctulonate synthase [Silicibacter sp. TrichCH4B]
 gi|259345565|gb|EEW57419.1| 3-deoxy-8-phosphooctulonate synthase [Silicibacter sp. TrichCH4B]
          Length = 277

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 146/266 (54%), Positives = 196/266 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T  N+    +IAGPCQ+ES DHA MIA KL   C ++    V+K+S+DKANR+SL+G
Sbjct: 7   NGLTIGNDCPLTVIAGPCQLESADHAQMIAGKLKEACDAVGAQFVFKASYDKANRTSLSG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G+ KG ++   ++  +G P+LTDVHTE QC    D VDILQIPA LCRQTD+L AA
Sbjct: 67  KRGLGIDKGLDVLAGVRDTFGVPVLTDVHTEAQCIVAGDVVDILQIPAFLCRQTDMLLAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
             TG+ +N+KKGQFL+PW+M N++ K+ + G   +L  ERGTSFGYN LV DMR +P M 
Sbjct: 127 GNTGKAVNIKKGQFLAPWDMDNVVSKVESTGNDKILLTERGTSFGYNALVADMRGLPRMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+ DA+HSVQQPG  G  +GG+R++   +A+AAV++GIA +F+ETH+DPDNAPSD
Sbjct: 187 QTGYPVVMDATHSVQQPGGQGGSTGGQREFAPVMARAAVSLGIAAVFIETHEDPDNAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNMI +KD+P+L+  L+  DK+ K 
Sbjct: 247 GPNMIYLKDMPQLIDTLMGFDKLAKA 272


>gi|254466542|ref|ZP_05079953.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacterales bacterium
           Y4I]
 gi|206687450|gb|EDZ47932.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacterales bacterium
           Y4I]
          Length = 277

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 141/265 (53%), Positives = 197/265 (74%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T  N++   +IAGPCQ+E+ DHA MIA  L   C       V+K+S+DKANR+SL+GK
Sbjct: 8   GLTVGNDRPLTIIAGPCQLETADHARMIAGALKEACGKAGAQFVFKASYDKANRTSLSGK 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G ++   +++++  P+LTDVHTE QC   A++VDILQIPA LCRQTD+L AA 
Sbjct: 68  RGLGIDEGLKVLDTIRREFDVPVLTDVHTEAQCAVAAEAVDILQIPAFLCRQTDMLLAAG 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
            TG+ +N+KKGQFL+PW+M N++ K+ + G +++L  ERGTSFGYNTLV DMRS+P M  
Sbjct: 128 NTGKAVNIKKGQFLAPWDMANVVAKVESTGNQNILLTERGTSFGYNTLVADMRSLPQMAQ 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+ DA+HSVQQPG  G  +GG+R++   +A+AAV++GIA +F+ETHQDPDNAPSDG
Sbjct: 188 GGYPVVMDATHSVQQPGGKGGSTGGQREFAPLMARAAVSLGIAAVFIETHQDPDNAPSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNMI +  +P+L+  L+  D + K 
Sbjct: 248 PNMIYLDQMPQLIDSLMRFDALAKA 272


>gi|161524337|ref|YP_001579349.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia multivorans
           ATCC 17616]
 gi|189350907|ref|YP_001946535.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia multivorans
           ATCC 17616]
 gi|221214759|ref|ZP_03587728.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia multivorans
           CGD1]
 gi|238687034|sp|A9AGW1|KDSA_BURM1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|160341766|gb|ABX14852.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia multivorans
           ATCC 17616]
 gi|189334929|dbj|BAG43999.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia multivorans
           ATCC 17616]
 gi|221165298|gb|EED97775.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia multivorans
           CGD1]
          Length = 284

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 125/270 (46%), Positives = 174/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC  LNI  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNIPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILSEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLNRMSALLETLVTLDQAVK 274


>gi|15603941|ref|NP_220456.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia prowazekii
           str. Madrid E]
 gi|6647572|sp|Q9ZE84|KDSA_RICPR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|3860632|emb|CAA14533.1| 2-DEHYDRO-3-DEOXYPHOSPHOOCTONATE ALDOLASE (kdsA) [Rickettsia
           prowazekii]
 gi|292571659|gb|ADE29574.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia prowazekii Rp22]
          Length = 275

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 159/267 (59%), Positives = 204/267 (76%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+ +FVLIAGPCQIE  DHA  +AEKL  +   L+I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLQFVLIAGPCQIEGKDHALFMAEKLMKLTSKLSIPFIYKSSFDKANRTSING 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G++KG EI   +K ++  PI+TDVH+E QC   A  VDILQIPA LCRQTDLL AA
Sbjct: 68  IRGLGIEKGLEILSKVKSEFDCPIITDVHSESQCIETAKVVDILQIPAFLCRQTDLLKAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+ +KL   GAKD+LF ERG+ FGYN LV+DMRS+ IM+
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQKKLEVFGAKDILFTERGSCFGYNNLVSDMRSLAIMS 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  SGGER+Y+  LAKAA+++GIAGI++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGRGGSSGGERKYVELLAKAAISVGIAGIYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GP MI + +L  +L +L   DKI K +
Sbjct: 248 GPCMIKLDNLESILIKLKKYDKITKEI 274


>gi|167586763|ref|ZP_02379151.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ubonensis
           Bu]
          Length = 284

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 126/270 (46%), Positives = 176/270 (65%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC+ LNI  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNIPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+ ++ E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILSEVKRQLGLPVLTDVHSIEEIEQVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKAREAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH  P 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPKPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLNRMGALLETLVTLDQAVK 274


>gi|163747509|ref|ZP_02154859.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanibulbus indolifex
           HEL-45]
 gi|161379187|gb|EDQ03606.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanibulbus indolifex
           HEL-45]
          Length = 277

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 140/266 (52%), Positives = 192/266 (72%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +T  N++   +IAGPCQ+ES DHA MIA  L   C +     ++K+S+DKANR+SL+G
Sbjct: 7   GNLTVGNDRPLTVIAGPCQLESEDHAQMIAGVLKEACNAAGAQFIFKASYDKANRTSLSG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G++KG ++ + + +    P+LTDVH E QC    + VD+LQIPA LCRQTD+L AA
Sbjct: 67  KRGLGIEKGLQVLQSVARANDVPVLTDVHNEAQCAQAGEVVDVLQIPAFLCRQTDILLAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG+ +NVKKGQFL+PWEM NI+ K+ + G K++L  ERGT+FGYNTLV DMRS+P M 
Sbjct: 127 GETGKAVNVKKGQFLAPWEMQNIVDKIESTGNKNILLTERGTTFGYNTLVADMRSLPQMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+ DA+HSV QPG  G  SGG+R++   +A+AA +IG+A IF+ETH+DPD APSD
Sbjct: 187 QTGYPVVMDATHSVAQPGGKGGSSGGQREFAPVMARAAASIGVAAIFMETHEDPDRAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNMI +  +P L++ L+  D + K 
Sbjct: 247 GPNMIYLDQMPGLINLLMQFDALAKS 272


>gi|304437446|ref|ZP_07397405.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas sp. oral taxon
           149 str. 67H29BP]
 gi|304369702|gb|EFM23368.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas sp. oral taxon
           149 str. 67H29BP]
          Length = 277

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 130/265 (49%), Positives = 173/265 (65%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  +  VL+AGPC +E  + + MI   +  I   L I  V+K+SFDKANRS+    
Sbjct: 10  NFEIGGGEPLVLLAGPCVLEGLERSLMIGRGIKEITDRLGIPYVFKASFDKANRSAYHSF 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL  G ++   +KK+ G P++TD+H   Q E  A  VDILQIPA L RQTDLL AAA
Sbjct: 70  RGPGLTDGLKMLGQIKKELGVPVVTDIHESCQAEPAAKVVDILQIPAFLSRQTDLLHAAA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           QTG V+NVKKGQFL+P +M N++ K+H  G++ +L  ERG SFGYN LV DMR++PIM S
Sbjct: 130 QTGAVVNVKKGQFLAPNDMRNVVDKIHESGSERILLTERGASFGYNNLVVDMRALPIMRS 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFD +HSVQ PG  G  S G+R+++  L +AAV  G+ G+FLE H +P  A SDG
Sbjct: 190 FGYPVIFDGTHSVQLPGGAGTSSSGQREFVEYLVRAAVGAGVDGLFLEVHDNPAEALSDG 249

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
            NM+ +  L +LL   LAI ++++ 
Sbjct: 250 ANMVYLDKLEELLKDALAIYEVVRK 274


>gi|237807599|ref|YP_002892039.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Tolumonas auensis DSM
           9187]
 gi|237499860|gb|ACQ92453.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Tolumonas auensis DSM
           9187]
          Length = 283

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 122/268 (45%), Positives = 173/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +  +N+Q FVL  G   +ES D A  I E    + + L I LV+K+S+DKANRSS+  
Sbjct: 9   NGINVANDQPFVLFGGMNVLESRDLAMSICETYVTVTEKLGIPLVFKASWDKANRSSVHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G  IF +LKK +G  ++TDVH   Q + I + VD+LQ+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLRIFEELKKTFGVSLITDVHETWQAKPIGEVVDVLQLPAFLARQTDLVEAL 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFLSP ++ NI++K    G   ++ CERG +FGY+ LV DM    +M 
Sbjct: 129 AKTGNVINVKKPQFLSPGQVKNIVEKFAECGNDRIILCERGVNFGYDNLVVDMLGFGVMK 188

Query: 215 --SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
             S G PVIFD +HS+Q     G  S G R+ +  LA+A +A+G+AG+F+E+H DP++A 
Sbjct: 189 DASQGSPVIFDVTHSLQCRDPLGAASSGRREQVTELARAGMAVGLAGLFIESHPDPEHAR 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L Q+ AID ++K 
Sbjct: 249 CDGPSALPLDKLEPFLQQMKAIDDLVKS 276


>gi|310814634|ref|YP_003962598.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ketogulonicigenium
           vulgare Y25]
 gi|308753369|gb|ADO41298.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ketogulonicigenium
           vulgare Y25]
          Length = 277

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 143/265 (53%), Positives = 191/265 (72%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            ++  N Q   LIAGPCQ+ES DHA MIA  L  ICQ      ++K S+DKANR+SL+G 
Sbjct: 8   GLSVGNNQPLTLIAGPCQLESADHAQMIAGTLAEICQRTGAQFIFKGSYDKANRTSLSGT 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G++ G +I   ++  +G P+LTD+H  +QC  +A  VD+LQIPA LCRQTDLL AA 
Sbjct: 68  RGLGMEAGLKILEGVRAAFGCPVLTDIHEREQCAEVASVVDVLQIPAFLCRQTDLLIAAG 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG  IN+KKGQFL+PW+M N+  K+ + G   ++  ERG SFGYNTLVTDMRS+P M  
Sbjct: 128 ETGAAINIKKGQFLAPWDMANVASKVASTGNNRIMLTERGVSFGYNTLVTDMRSLPTMAR 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+ DA+HSVQQPG  GN SGG+R++   +A+ AV++GIA +F+ETHQDPDNAPSDG
Sbjct: 188 TGYPVVMDATHSVQQPGGQGNSSGGQREFAPVMARTAVSLGIAAVFIETHQDPDNAPSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNMI +  + +L++ L+A D + K 
Sbjct: 248 PNMIYLDQMDRLMTSLMAFDALAKA 272


>gi|261867618|ref|YP_003255540.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412950|gb|ACX82321.1| 3-deoxy-8-phosphooctulonate synthase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 284

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 123/268 (45%), Positives = 176/268 (65%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  + EK   + Q L +  V+K+SFDKANRSS+  
Sbjct: 9   GDIQIANDKPFVLFGGMNVLESRDMAMRVCEKYVEVTQKLGVPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF +LK+ +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEQGLKIFAELKQTFGVKIITDVHEIYQCQPVAEVVDIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ LV DM    +M 
Sbjct: 129 ARTGAVINVKKPQFLSPGQMGNIVEKIAECGNDKVILCDRGTNFGYDNLVVDMLGFSVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           +   G PVIFD +HS+Q     G  SGG R  +  LA++ +A+G+AG+FLE H DP NA 
Sbjct: 189 NVSKGCPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGLAVGLAGLFLEAHPDPSNAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   ++Q+ AID ++K 
Sbjct: 249 CDGPSALPLDKLEAFVNQMKAIDNLVKS 276


>gi|28056536|gb|AAO28415.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Temecula1]
          Length = 288

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 124/265 (46%), Positives = 168/265 (63%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  Q   LIAGPC IES       A  L  I   L +  ++KSSFDKANR+S +  
Sbjct: 17  GFEVGLNQPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSF 76

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++   +K + G P+LTDVH     + +A  VD+LQ PA L RQTD +    
Sbjct: 77  RGPGLEEGLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVC 136

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
             G+ +N+KKGQFLSPW+M  +++K  + G   +L CERG SFGYN LV+DMRS+ +M  
Sbjct: 137 AVGKPVNIKKGQFLSPWDMKPVVEKAKSTGNSQILVCERGASFGYNNLVSDMRSLAVMRE 196

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP NA SDG
Sbjct: 197 TGCPVVFDATHSVQLPGAQGGRSGGQREFVPVLARAAVAVGISGLFAETHPDPPNALSDG 256

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   ++ +  LL  L+ +D + K 
Sbjct: 257 PNAWPLRTMAMLLETLVELDAVTKK 281


>gi|71274919|ref|ZP_00651207.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Dixon]
 gi|71902109|ref|ZP_00684143.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Ann-1]
 gi|77747649|ref|NP_778766.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Temecula1]
 gi|170729816|ref|YP_001775249.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa M12]
 gi|182681125|ref|YP_001829285.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa M23]
 gi|32129661|sp|Q87DY7|KDSA_XYLFT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238687968|sp|B0U657|KDSA_XYLFM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238691101|sp|B2I936|KDSA_XYLF2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|71164651|gb|EAO14365.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Dixon]
 gi|71728127|gb|EAO30324.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Ann-1]
 gi|167964609|gb|ACA11619.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa M12]
 gi|182631235|gb|ACB92011.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa M23]
 gi|307579573|gb|ADN63542.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 276

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 124/265 (46%), Positives = 168/265 (63%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  Q   LIAGPC IES       A  L  I   L +  ++KSSFDKANR+S +  
Sbjct: 5   GFEVGLNQPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++   +K + G P+LTDVH     + +A  VD+LQ PA L RQTD +    
Sbjct: 65  RGPGLEEGLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
             G+ +N+KKGQFLSPW+M  +++K  + G   +L CERG SFGYN LV+DMRS+ +M  
Sbjct: 125 AVGKPVNIKKGQFLSPWDMKPVVEKAKSTGNSQILVCERGASFGYNNLVSDMRSLAVMRE 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP NA SDG
Sbjct: 185 TGCPVVFDATHSVQLPGAQGGRSGGQREFVPVLARAAVAVGISGLFAETHPDPPNALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   ++ +  LL  L+ +D + K 
Sbjct: 245 PNAWPLRTMAMLLETLVELDAVTKK 269


>gi|296116174|ref|ZP_06834792.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977280|gb|EFG84040.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 278

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 148/279 (53%), Positives = 200/279 (71%), Gaps = 2/279 (0%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             NA + +      +   N++ F LIAGPCQIES  HA   A+ L A+ + L IGL+YKS
Sbjct: 1   MENAQVEI--RVGDLVIGNDRPFTLIAGPCQIESESHAVETADFLQAVTRRLGIGLIYKS 58

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANR+SL   RG+G  +G EI   +++++  P+LTDVH  +QC   A++VD+LQIPA
Sbjct: 59  SFDKANRTSLTSARGIGANRGLEILARVRERFSIPVLTDVHLPEQCAPAAEAVDVLQIPA 118

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            LCRQTDLL AA +TG  INVKKGQFL+PW+M N+  K+ + G + ++ CERGTSFGYNT
Sbjct: 119 FLCRQTDLLLAAGETGAAINVKKGQFLAPWDMANVAAKIASTGNERIMLCERGTSFGYNT 178

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV DMR +PIM   G PV++DA+HSVQQPG  G+ SGG+R++   L++AA+AIG+A +F+
Sbjct: 179 LVNDMRGLPIMARTGFPVVYDATHSVQQPGGLGSSSGGQREFAPVLSRAALAIGVAAVFI 238

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           ETH+DPD APSDGPNMI +  +  LL+ L   D++ K +
Sbjct: 239 ETHEDPDKAPSDGPNMIALSQMEGLLANLQRYDRLTKGI 277


>gi|327480173|gb|AEA83483.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas stutzeri DSM
           4166]
          Length = 281

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 122/265 (46%), Positives = 170/265 (64%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A    E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GNIEIANDKPFVLFGGINVLESRDLAMQACEEYVRVTEKLGIPYVFKASFDKANRSSITS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF ++KK +G P++TDVH   Q + +AD  DI+Q+PA L RQTDL+ A 
Sbjct: 69  FRGPGLEEGMKIFEEVKKTFGVPVITDVHEPWQAQPVADVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFL+P EM +IL+K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAVINIKKAQFLAPQEMKHILKKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +H++Q PG   + +GG R  +  LAKA ++ G+AG+FLE H DPDNA  D
Sbjct: 189 QFEYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGLSQGLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP  + +  L   L+QL  +D ++K
Sbjct: 249 GPCALRLNKLEAFLTQLKQLDDLVK 273


>gi|239946975|ref|ZP_04698728.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921251|gb|EER21275.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 274

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 155/266 (58%), Positives = 196/266 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLIAGPCQIE  DH   +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLIAGPCQIEGKDHTLFMAEKLVKLTSKLEIQFIYKSSFDKANRTSVNG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G++KG EI   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGLGIEKGLEILSKVKSEFDCPIVTDVHSESQCTETAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  +GGER+Y+  LAKAA ++GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLAKAATSVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP MI + +L  +L +L   DKI K 
Sbjct: 248 GPCMIKLDNLEPVLIKLKKYDKITKE 273


>gi|146281930|ref|YP_001172083.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas stutzeri
           A1501]
 gi|158514174|sp|A4VJU0|KDSA_PSEU5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|145570135|gb|ABP79241.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas stutzeri
           A1501]
          Length = 281

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 122/265 (46%), Positives = 169/265 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A    E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GNIEIANDKPFVLFGGINVLESRDLAMQACEEYVRVTEKLGIPYVFKASFDKANRSSITS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF  +KK +G P++TDVH   Q + +AD  DI+Q+PA L RQTDL+ A 
Sbjct: 69  FRGPGLEEGMKIFEKVKKTFGVPVITDVHEPWQAQPVADVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFL+P EM +IL+K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAVINIKKAQFLAPQEMKHILKKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +H++Q PG   + +GG R  +  LAKA ++ G+AG+FLE H DPDNA  D
Sbjct: 189 QFEYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGLSQGLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP  + +  L   L+QL  +D ++K
Sbjct: 249 GPCALRLNKLEAFLTQLKQLDDLVK 273


>gi|325526448|gb|EGD04030.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia sp. TJI49]
          Length = 284

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 123/270 (45%), Positives = 176/270 (65%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC+ LN+  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+ ++ E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILSEVKRQLGLPVLTDVHSIEEIEPVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMR+
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRA 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLNRMSALLETLVTLDQAVK 274


>gi|152970777|ref|YP_001335886.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|206577322|ref|YP_002237912.1| 3-deoxy-8-phosphooctulonate synthase [Klebsiella pneumoniae 342]
 gi|238895291|ref|YP_002920026.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262041830|ref|ZP_06015015.1| 3-deoxy-8-phosphooctulonate synthase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288934825|ref|YP_003438884.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Klebsiella variicola
           At-22]
 gi|290508968|ref|ZP_06548339.1| 3-deoxy-8-phosphooctulonate synthase [Klebsiella sp. 1_1_55]
 gi|166199037|sp|A6TAN5|KDSA_KLEP7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761661|sp|B5XW55|KDSA_KLEP3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|150955626|gb|ABR77656.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|206566380|gb|ACI08156.1| 3-deoxy-8-phosphooctulonate synthase [Klebsiella pneumoniae 342]
 gi|238547608|dbj|BAH63959.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259040822|gb|EEW41908.1| 3-deoxy-8-phosphooctulonate synthase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288889534|gb|ADC57852.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Klebsiella variicola
           At-22]
 gi|289778362|gb|EFD86359.1| 3-deoxy-8-phosphooctulonate synthase [Klebsiella sp. 1_1_55]
          Length = 284

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 172/280 (61%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEASQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M       PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFGVMKKASNNSPVIFDVTHALQCRDPFGAASGGRRAQVSELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DPD+A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPDHAKCDGPSALPLDKLEPFLKQMKAIDDLVKS 276


>gi|330009863|ref|ZP_08306619.1| 3-deoxy-8-phosphooctulonate synthase [Klebsiella sp. MS 92-3]
 gi|328534689|gb|EGF61254.1| 3-deoxy-8-phosphooctulonate synthase [Klebsiella sp. MS 92-3]
          Length = 284

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 172/280 (61%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEACQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M       PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFGVMKKASNNSPVIFDVTHALQCRDPFGAASGGRRAQVSELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DPD+A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPDHAKCDGPSALPLDKLEPFLKQMKAIDDLVKS 276


>gi|71907984|ref|YP_285571.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dechloromonas aromatica
           RCB]
 gi|123760465|sp|Q47DI0|KDSA_DECAR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|71847605|gb|AAZ47101.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dechloromonas aromatica
           RCB]
          Length = 278

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 126/266 (47%), Positives = 178/266 (66%), Gaps = 2/266 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q F LIAGPC  ES      +A  +  +C  L I  ++K+S+DKANRSS    
Sbjct: 5   GFEAGLDQPFFLIAGPCTAESEQLCLDVAGHMKEVCARLGINYIFKASYDKANRSSGKSV 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+GL++G  IF +++++ G P+LTDVHT +   A+A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGLEEGLRIFSEVQRQIGVPVLTDVHTIEDIPAVAAVVDVLQTPAFLCRQTDFIHAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGA--KDVLFCERGTSFGYNTLVTDMRSIPIM 213
             G+ +N+KKGQFL+P +M N++ K         +++ CERG SFGYN LV+DMRS+ IM
Sbjct: 125 TCGKPVNIKKGQFLAPGDMKNVVDKAREVNNGADNIMVCERGASFGYNNLVSDMRSLAIM 184

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
              G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A+GI+G+F+ETH  P+ A S
Sbjct: 185 RETGCPVVFDATHSVQLPGGQGTTSGGQREFVPVLARAAIAVGISGLFMETHPCPEKAWS 244

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGPN   +  +  LL+ L+A+DK +K
Sbjct: 245 DGPNSWPLDRMESLLATLVALDKAVK 270


>gi|221198413|ref|ZP_03571459.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia multivorans
           CGD2M]
 gi|221208910|ref|ZP_03581907.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia multivorans
           CGD2]
 gi|221171193|gb|EEE03643.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia multivorans
           CGD2]
 gi|221182345|gb|EEE14746.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia multivorans
           CGD2M]
          Length = 284

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 125/270 (46%), Positives = 174/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC  LNI  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICGKLNIPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILSEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLNRMSALLETLVTLDRAVK 274


>gi|52425244|ref|YP_088381.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Mannheimia
           succiniciproducens MBEL55E]
 gi|59798188|sp|Q65TB4|KDSA_MANSM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|52307296|gb|AAU37796.1| KdsA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 284

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 178/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N+  FVL  G   +ES D A  + EK   +   L +  V+K+
Sbjct: 1   MQNKIVRIGD----INVANDNPFVLFGGMNVLESRDMAMQVCEKYVEVTNKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK+ +G  I+TDVH   QC+ +A+  D++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKQTFGVKIITDVHEIYQCKPVAEVADVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +HS+Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFGVMKKVSKGAPVIFDVTHSLQCRDPFGAASGGRRDQVTELARAGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP+NA  DGP+ + +  L   +SQ+ A+D ++K 
Sbjct: 237 FLEAHPDPNNAKCDGPSALPLSVLEGFVSQMKALDDLVKS 276


>gi|303251817|ref|ZP_07337988.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307249117|ref|ZP_07531124.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307260445|ref|ZP_07542140.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|302649247|gb|EFL79432.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306854405|gb|EFM86601.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306869848|gb|EFN01630.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 284

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ F L  G   +ES D A  + E+   +   L +  V+K+
Sbjct: 1   MNNKIVKVG----NIEVANDKPFTLFGGMNVLESRDMAMGVCEQYVEVTNKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVNIITDVHEIYQCKPVAEVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G ++V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIAECGNENVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM     G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 177 LVVDMLGFNIMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP+NA  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPDPNNAKCDGPSALPLSKLEAFVSQMKAIDDLVKS 276


>gi|330975380|gb|EGH75446.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 281

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 116/266 (43%), Positives = 169/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAALVAEVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  D
Sbjct: 189 QFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL ++D+++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKSLDELVKS 274


>gi|165977487|ref|YP_001653080.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|226761651|sp|B0BU69|KDSA_ACTPJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|165877588|gb|ABY70636.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 284

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 124/280 (44%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ F L  G   +ES D A  + E+   +   L +  V+K+
Sbjct: 1   MNNKIVKVG----NIEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVNIITDVHEIYQCKPVAEVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G ++V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIAECGNENVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM     G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 177 LVVDMLGFNIMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP++A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPDPNSAKCDGPSALPLSKLEAFVSQMKAIDDLVKS 276


>gi|83644693|ref|YP_433128.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hahella chejuensis KCTC
           2396]
 gi|123726426|sp|Q2SKX1|KDSA_HAHCH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|83632736|gb|ABC28703.1| 3-deoxy-8-phosphooctulonate synthase [Hahella chejuensis KCTC 2396]
          Length = 281

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 120/277 (43%), Positives = 174/277 (62%), Gaps = 4/277 (1%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            +   + +G     +  +N++ FVL  G   +ES D A  +AE    + Q L I  V+K+
Sbjct: 1   MSTRTVKVGG----IDIANDRPFVLFGGMNVLESRDLALQVAESYVKVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL +G  IF ++K+ +  P++TD+H   Q + +A+  DI+Q+PA
Sbjct: 57  SFDKANRSSINSYRGPGLDEGLRIFEEIKRTFNVPVITDIHEPHQAQPVAEVADIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG  +N+KK QFL+P EM +IL K    G   ++ CERG+SFGYN 
Sbjct: 117 FLSRQTDLVAAMARTGCPVNIKKAQFLAPQEMKHILSKCEEAGNDQLILCERGSSFGYNN 176

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV DM    IM   G PV FD +HS+Q PG   + +GG R+ +V LA++ +A+G+AG+FL
Sbjct: 177 LVVDMLGFGIMKQFGYPVFFDVTHSLQMPGGLSSSAGGRREQVVQLARSGMAVGLAGLFL 236

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           E H DPD A  DGP  + +  L   L+Q+ A+D ++K
Sbjct: 237 EAHPDPDVAKCDGPCALRLSQLEPFLAQMKALDDMVK 273


>gi|294013368|ref|YP_003546828.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingobium japonicum
           UT26S]
 gi|292676698|dbj|BAI98216.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingobium japonicum
           UT26S]
          Length = 276

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 148/277 (53%), Positives = 201/277 (72%), Gaps = 4/277 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
               + +GS    +T  N+  F+LI+GPCQIES DHA M+AE+L    +   +  ++KSS
Sbjct: 4   MTRHVSIGS----LTVGNDLPFILISGPCQIESRDHAMMMAERLSGAAERAGVPFIFKSS 59

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+S++G+RGVG+  G  I  ++K  +G+P+LTDVH   Q  A A++VDILQIPA 
Sbjct: 60  FDKANRTSVSGRRGVGIDAGLAILAEVKAAFGWPVLTDVHEAGQVGAAAEAVDILQIPAF 119

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AA +TG V+NVKKGQFL+PW+M  + QK+ + G + +L  ERG SFGYNTL
Sbjct: 120 LCRQTDLLLAAGRTGAVVNVKKGQFLAPWDMAAVAQKVASTGNERILLTERGASFGYNTL 179

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMR++P+M   G PV+FDA+HSVQQPG  G+ SGG+R +   LA++AVA G+A IF E
Sbjct: 180 VSDMRALPVMAQTGYPVVFDATHSVQQPGGLGSASGGQRDFAPVLARSAVAAGVAAIFAE 239

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            H DPDNAPSDGP M+ ++ +  LL +L AID+++K 
Sbjct: 240 AHDDPDNAPSDGPVMLPVEWVGPLLEKLKAIDEVVKG 276


>gi|206560542|ref|YP_002231307.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           J2315]
 gi|238693116|sp|B4EDA2|KDSA_BURCJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|198036584|emb|CAR52481.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           cenocepacia J2315]
          Length = 284

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 125/270 (46%), Positives = 175/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q F LIAG C +ES       A +L  IC+ LN+  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILSEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLNRMGALLETLVTLDQAVK 274


>gi|237800163|ref|ZP_04588624.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|330896080|gb|EGH28301.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330950659|gb|EGH50919.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae Cit
           7]
 gi|331023020|gb|EGI03077.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 281

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 116/266 (43%), Positives = 169/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  D
Sbjct: 189 QFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL ++D+++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKSLDELVKS 274


>gi|302187917|ref|ZP_07264590.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           syringae 642]
          Length = 281

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 115/266 (43%), Positives = 169/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAIINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  D
Sbjct: 189 QFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL ++D+++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKSLDELVKS 274


>gi|59711379|ref|YP_204155.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio fischeri ES114]
 gi|197335446|ref|YP_002155533.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio fischeri MJ11]
 gi|75431753|sp|Q5E6S9|KDSA_VIBF1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761666|sp|B5FBX4|KDSA_VIBFM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|59479480|gb|AAW85267.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Vibrio fischeri
           ES114]
 gi|197316936|gb|ACH66383.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio fischeri MJ11]
          Length = 284

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 122/281 (43%), Positives = 175/281 (62%), Gaps = 6/281 (2%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +     + +G     +  +N++ F L AG   +ES D A  I EK   +   L I  V+K
Sbjct: 1   MQNQKTVKIG----NIDVANDKPFTLFAGMNVLESRDLAMQICEKYVEVTDRLGIPYVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS+   RG G+++G +IF++LK  +G  I+TD+HTE Q + +AD VD++Q+P
Sbjct: 57  ASFDKANRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDIHTEAQAQPVADVVDVIQLP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G ++++ CERG+  GY+
Sbjct: 117 AFLARQTDLVEAMAKTGAVINVKKPQFMSPDQVGNIIDKFSECGNENIILCERGSCMGYD 176

Query: 202 TLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
            LV DM    +M     G P+IFD +HS+Q     G  SGG R   V LAKA +A GIAG
Sbjct: 177 NLVVDMLGFGVMKKASNGSPIIFDVTHSLQNRDPSGKASGGRRSQTVELAKAGLATGIAG 236

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +F+E H +PD A  DGP+ + +  L   L Q+ ++D +IK 
Sbjct: 237 LFIEAHPNPDKALCDGPSALPLDQLEPFLKQMKSLDDLIKG 277


>gi|189425231|ref|YP_001952408.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter lovleyi SZ]
 gi|238692113|sp|B3E467|KDSA_GEOLS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|189421490|gb|ACD95888.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter lovleyi SZ]
          Length = 272

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 135/265 (50%), Positives = 186/265 (70%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             V     +  VLIAGPC IES +     AE+L  IC  L + L++KSS+DKANR+S+  
Sbjct: 8   GSVKMGGGRLLVLIAGPCVIESEEATLRHAERLMTICNGLGMPLIFKSSYDKANRTSINA 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+ +G  I   +K+  G P+L+D+H+ +Q    A  +D+LQIPA LCRQTDL+ AA
Sbjct: 68  FRGPGMDEGLRILSKVKESLGIPVLSDIHSIEQVAPAAQVLDVLQIPAFLCRQTDLVVAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+V+NVKKGQFL+PW+M N++ K+ A G ++++  ERG SFGYN LV DMRS P+M 
Sbjct: 128 AKTGKVVNVKKGQFLAPWDMRNVVGKVAASGNENIILTERGASFGYNNLVVDMRSFPVMR 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA GI GIF+E H+DP  A  D
Sbjct: 188 SYGYPVVFDATHSVQLPGGQGESSGGQREFVETLSRAAVATGIDGIFMEVHEDPSCALCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN I + +LP LL +L A+D +++
Sbjct: 248 GPNSIPLAELPALLKRLQALDAVVR 272


>gi|107028712|ref|YP_625807.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           AU 1054]
 gi|116690129|ref|YP_835752.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           HI2424]
 gi|122977742|sp|Q1BHS1|KDSA_BURCA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|158512287|sp|A0K8N2|KDSA_BURCH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|105897876|gb|ABF80834.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           AU 1054]
 gi|116648218|gb|ABK08859.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           HI2424]
          Length = 284

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 125/270 (46%), Positives = 175/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q F LIAG C +ES       A +L  IC+ LN+  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKARDAARDAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLNRMGALLETLVTLDQAVK 274


>gi|170733462|ref|YP_001765409.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           MC0-3]
 gi|254247800|ref|ZP_04941121.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Burkholderia cenocepacia PC184]
 gi|238688558|sp|B1JUY7|KDSA_BURCC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|124872576|gb|EAY64292.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Burkholderia cenocepacia PC184]
 gi|169816704|gb|ACA91287.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia cenocepacia
           MC0-3]
          Length = 284

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 125/270 (46%), Positives = 175/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q F LIAG C +ES       A +L  IC+ LN+  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLNRMGALLETLVTLDQAVK 274


>gi|71898807|ref|ZP_00680975.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Ann-1]
 gi|71731393|gb|EAO33456.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Xylella fastidiosa
           Ann-1]
          Length = 276

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 124/265 (46%), Positives = 168/265 (63%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  Q   LIAGPC IES       A  L  I   L +  ++KSSFDKANR+S +  
Sbjct: 5   GFEVGLSQPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G ++   +K + G P+LTDVH     + +A  VD+LQ PA L RQTD +    
Sbjct: 65  RGPGLEEGLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
             G+ +N+KKGQFLSPW+M  +++K  + G   +L CERG SFGYN LV+DMRS+ +M  
Sbjct: 125 AVGKPVNIKKGQFLSPWDMKPVVEKAKSTGNSQILVCERGASFGYNNLVSDMRSLAVMRE 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA+GI+G+F ETH DP NA SDG
Sbjct: 185 TGCPVVFDATHSVQLPGAQGARSGGQREFVPVLARAAVAVGISGLFAETHPDPPNALSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN   ++ +  LL  L+ +D + K 
Sbjct: 245 PNAWPLRTMAMLLETLVELDAVTKK 269


>gi|254293925|ref|YP_003059948.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hirschia baltica ATCC
           49814]
 gi|254042456|gb|ACT59251.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hirschia baltica ATCC
           49814]
          Length = 286

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 145/284 (51%), Positives = 202/284 (71%), Gaps = 1/284 (0%)

Query: 17  DKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNI 76
           D + +   N+ + +   +  +    +       GPC +ES +HA  ++  +  I   L  
Sbjct: 3   DTSSVKALNSTVEIACPRGNIKIGPDAPLTFFLGPCALESREHALFMSNAILEIADKLGA 62

Query: 77  GLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD 136
            +VYK+SFDKANR+S++G RG+ L +  +IF ++K K G P+LTDVH   QCE +A  VD
Sbjct: 63  QVVYKTSFDKANRTSMSGYRGLELDEALDIFAEVKDKTGLPMLTDVHLPDQCEKVAKVVD 122

Query: 137 ILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGT 196
           +LQIPA LCRQTD+L AAA+TG V+ VKKGQFL+PW+M N++ KL + GAKDVL  ERG+
Sbjct: 123 VLQIPAFLCRQTDMLQAAAETGAVVKVKKGQFLAPWDMKNVVNKLISMGAKDVLLTERGS 182

Query: 197 SFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIG 256
           SFGYN LVTDMR +P M +M   V+ DA+HSVQQPG  G  +GG+R+Y+  +AKAAVA+G
Sbjct: 183 SFGYNALVTDMRGLPEMAAMAP-VVIDATHSVQQPGGKGGSTGGQREYVPVIAKAAVAVG 241

Query: 257 IAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           ++G+FLETHQDPDNAPSDGPNM+ + +L KL+S+L+ I+ ++K 
Sbjct: 242 VSGVFLETHQDPDNAPSDGPNMVILSELEKLMSELIQINALVKS 285


>gi|332290279|ref|YP_004421131.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gallibacterium anatis
           UMN179]
 gi|330433175|gb|AEC18234.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gallibacterium anatis
           UMN179]
          Length = 284

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E+   +   L +  ++K+
Sbjct: 1   MQNKMVKVG----NIEIANDKPFVLFGGMNVLESRDMAMQVCEQYVKVTDKLKVPYIFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF +LK+ +G  I+TDVH   QC+ +A+ VDI+Q+PA
Sbjct: 57  SFDKANRSSIYSYRGPGMEEGLKIFEELKQTFGVKIITDVHEIYQCQPVAEVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIKECGNDKVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM     G PVIFD +HS+Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKQVSQGCPVIFDVTHSLQCRDPFGAASGGRRAQVTELARAGLAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P  A  DGP+ + +  L   ++Q+ A+D ++K 
Sbjct: 237 FLEAHPEPAKAKCDGPSALPLDKLEPFVAQMKAVDDLVKS 276


>gi|322513492|ref|ZP_08066602.1| 3-deoxy-8-phosphooctulonate synthase [Actinobacillus ureae ATCC
           25976]
 gi|322120711|gb|EFX92595.1| 3-deoxy-8-phosphooctulonate synthase [Actinobacillus ureae ATCC
           25976]
          Length = 284

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ F L  G   +ES D A  + EK   +   L +  V+K+
Sbjct: 1   MNNKIVKVG----NIEVANDKPFTLFGGMNVLESRDMAMRVCEKYIEVTNKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVNIITDVHEIYQCKPVAEVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G ++V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIAECGNENVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM     G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 177 LVVDMLGFNIMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP++A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPDPNSAKCDGPSALPLSKLEAFVSQMKAIDDLVKS 276


>gi|293392125|ref|ZP_06636459.1| 3-deoxy-8-phosphooctulonate synthase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952659|gb|EFE02778.1| 3-deoxy-8-phosphooctulonate synthase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 284

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 126/268 (47%), Positives = 177/268 (66%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  + EK   + Q L +  V+K+SFDKANRSS+  
Sbjct: 9   GDIQIANDKPFVLFGGMNVLESRDMAMRVCEKYVEVTQKLGVPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF +LK+ +G  I+TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEQGLKIFAELKQTFGVKIITDVHEIYQCQPVAEVVDIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFLSP +M NI++KL   G   V+ C+RGT+FGY+ LV DM    +M 
Sbjct: 129 ARTGAVINVKKPQFLSPGQMGNIVEKLAECGNDKVILCDRGTNFGYDNLVVDMLGFSVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           +   G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE H DP NA 
Sbjct: 189 NVSKGCPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGLAIGLAGLFLEAHPDPSNAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L  L++Q+ AID ++K 
Sbjct: 249 CDGPSALPLDKLEALVNQMKAIDNLVKS 276


>gi|71733430|ref|YP_275959.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257487062|ref|ZP_05641103.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289626015|ref|ZP_06458969.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|123761193|sp|Q48F78|KDSA_PSE14 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|71553983|gb|AAZ33194.1| 3-deoxy-8-phosphooctulonate synthase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320323101|gb|EFW79190.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|330868561|gb|EGH03270.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330894613|gb|EGH27274.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           mori str. 301020]
 gi|330985129|gb|EGH83232.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009301|gb|EGH89357.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 281

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 118/278 (42%), Positives = 173/278 (62%), Gaps = 4/278 (1%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                I +GS    +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+
Sbjct: 1   MAQKTIRVGS----IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA
Sbjct: 57  SFDKANRSSVNSYRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN 
Sbjct: 117 FLSRQTDLVVAMAKTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNN 176

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV DM    +M     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FL
Sbjct: 177 LVVDMLGFGVMKQFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFL 236

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           E H DPDNA  DGP  + +  L   L+QL ++D+++K 
Sbjct: 237 EAHPDPDNAKCDGPCALRLDKLEPFLAQLKSLDELVKS 274


>gi|78222491|ref|YP_384238.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter
           metallireducens GS-15]
 gi|123756462|sp|Q39W61|KDSA_GEOMG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|78193746|gb|ABB31513.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Geobacter
           metallireducens GS-15]
          Length = 272

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 138/265 (52%), Positives = 187/265 (70%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             V     +  VLIAGPC IE+       AE+L  I   L+I L++K+S+DKANR+S+  
Sbjct: 8   GNVKMGGSRPLVLIAGPCVIENETATLRCAERLMTIVNGLSIPLIFKASYDKANRTSVTA 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GLK+G  I   +K+  G P+++D+H+ +Q +  A+ +DILQIPA LCRQTDLL  A
Sbjct: 68  FRGPGLKEGLRILAKVKESLGLPVISDIHSIEQVQPAAEVLDILQIPAFLCRQTDLLVEA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG V+NVKKGQFL+PW+M N++ K+ A G + ++  ERG SFGYN LV+DMRS+PIM 
Sbjct: 128 ARTGCVVNVKKGQFLAPWDMENVVGKIVASGNERIILTERGASFGYNNLVSDMRSLPIMR 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+FDA+HSVQ PG  G  SGG+R+++  L++AAVA GI G+FLE H++PD A  D
Sbjct: 188 RFGFPVVFDATHSVQLPGGQGGSSGGQREFVEYLSRAAVATGIDGVFLEVHEEPDKALCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN + + DLP LL +L AID I+K
Sbjct: 248 GPNSVPLDDLPVLLKKLKAIDAIVK 272


>gi|115352196|ref|YP_774035.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           AMMD]
 gi|171321918|ref|ZP_02910809.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           MEX-5]
 gi|115282184|gb|ABI87701.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           AMMD]
 gi|171092783|gb|EDT38055.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           MEX-5]
          Length = 284

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 125/270 (46%), Positives = 175/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q F LIAG C +ES       A +L  IC+ LN+  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKAREAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETSAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLNRMGALLETLVTLDQAVK 274


>gi|319404083|emb|CBI77671.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 280

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 169/272 (62%), Positives = 212/272 (77%)

Query: 29  HLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKAN 88
           ++      V FSNE    LIAGPCQ+ES DHAF +A ++  I     IG VYKSS+DKAN
Sbjct: 5   NITVKVGNVVFSNEAPLSLIAGPCQMESRDHAFEMAGRIKTIVDQFGIGFVYKSSYDKAN 64

Query: 89  RSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQT 148
           R+SL+  RG+GL+K   IF DLKK++G P+LTDVHTE+QC A+A  VD+LQIPA LCRQT
Sbjct: 65  RTSLSATRGIGLEKAIAIFSDLKKEFGCPVLTDVHTEEQCMAVASVVDVLQIPAFLCRQT 124

Query: 149 DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMR 208
           DLL AAA+TGRVIN+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGYN LV+DMR
Sbjct: 125 DLLVAAARTGRVINIKKGQFLAPWDMENVLEKVTKSGNPNVMLCERGTSFGYNRLVSDMR 184

Query: 209 SIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP 268
           S+PIM S G PVIFDA+HSVQ+PG  G+ SGG+R+++  LA+AAV+IG+AGIFLETHQDP
Sbjct: 185 SLPIMRSFGAPVIFDATHSVQEPGGQGSSSGGQREFVEVLARAAVSIGVAGIFLETHQDP 244

Query: 269 DNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DNAPSDG NMI I +L +LL  L+  D++ K 
Sbjct: 245 DNAPSDGLNMIKIDNLYRLLEILIDFDRLAKK 276


>gi|254230553|ref|ZP_04923921.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio sp. Ex25]
 gi|151936925|gb|EDN55815.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio sp. Ex25]
          Length = 298

 Score =  279 bits (714), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 125/290 (43%), Positives = 180/290 (62%), Gaps = 6/290 (2%)

Query: 13  QRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQ 72
             R  K  +      +++G     +  +N++ F L AG   +ES D A  I E    + +
Sbjct: 6   AYRGQKKRIKMEQKIVNIGD----IQVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTE 61

Query: 73  SLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIA 132
            L I  V+K+SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +A
Sbjct: 62  KLGIPYVFKASFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVA 121

Query: 133 DSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFC 192
           D VD++Q+PA L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G   ++ C
Sbjct: 122 DVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKIILC 181

Query: 193 ERGTSFGYNTLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAK 250
           ERG+  GY+ LV DM    +M +   G P+IFD +HS+Q     G  SGG R+  V LAK
Sbjct: 182 ERGSCHGYDNLVVDMLGFGVMKNASKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAK 241

Query: 251 AAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           A +A GIAG+F+E H +PD A  DGP+ + +  L   L+Q+ ++D +IK 
Sbjct: 242 AGLATGIAGLFIEAHPNPDQARCDGPSALPLDKLEPFLAQMKSLDDLIKS 291


>gi|172061063|ref|YP_001808715.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           MC40-6]
 gi|171993580|gb|ACB64499.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           MC40-6]
          Length = 284

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 125/270 (46%), Positives = 174/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q F LIAG C +ES       A +L  IC  LN+  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDQPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKAREAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETSAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLNRMGALLETLVTLDQAVK 274


>gi|229588822|ref|YP_002870941.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           SBW25]
 gi|259494406|sp|C3K6H5|KDSA_PSEFS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|229360688|emb|CAY47546.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           SBW25]
          Length = 281

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 120/266 (45%), Positives = 170/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKANRSSVTS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF+D+K+ +G PI+TDVH  +Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMRIFQDIKQAFGVPIITDVHEPEQAAVVAEVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAVINIKKAQFLAPQEMKHILNKCVEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  D
Sbjct: 189 QFEYPVFFDVTHALQMPGGRADSAGGRRAQVLDLAKAGISQSLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL  +D+++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKQLDELVKS 274


>gi|148826787|ref|YP_001291540.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittGG]
 gi|166199035|sp|A5UEF6|KDSA_HAEIG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|148718029|gb|ABQ99156.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittGG]
          Length = 284

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGNPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|260432909|ref|ZP_05786880.1| 3-deoxy-8-phosphooctulonate synthase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416737|gb|EEX09996.1| 3-deoxy-8-phosphooctulonate synthase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 277

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 145/265 (54%), Positives = 196/265 (73%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T  N+    +IAGPCQ+E+ DHA MIA ++  IC       V+K+S+DKANR+SL+G+
Sbjct: 8   DLTVGNDLPLTVIAGPCQLETADHAQMIAGRMKDICDKAGAQYVFKASYDKANRTSLSGR 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+  G ++  D++K  G P+LTDVHTE QC   A++VDILQIPA LCRQTD+L AA 
Sbjct: 68  RGMGIDAGLKVLDDIRKTMGVPVLTDVHTEAQCAIAAEAVDILQIPAFLCRQTDMLLAAG 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +NVKKGQFL+PWEM NI++K+ + G +++L  ERGTSFGYNTLV DMRS+P M  
Sbjct: 128 ETGKAVNVKKGQFLAPWEMPNIVEKIESTGNRNILLTERGTSFGYNTLVADMRSLPQMAQ 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++GI  +F+ETHQDPDNAPSDG
Sbjct: 188 TGYPVVMDATHSVQQPGGRGGSSGGQREFAPVMARAAVSLGIGAVFIETHQDPDNAPSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNMI +  +  L+  L+  D + K 
Sbjct: 248 PNMIPLDQMEDLIGTLMQFDALAKA 272


>gi|238927532|ref|ZP_04659292.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas flueggei ATCC
           43531]
 gi|238884814|gb|EEQ48452.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas flueggei ATCC
           43531]
          Length = 275

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 132/265 (49%), Positives = 175/265 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  +  VL+AGPC +E  + + MI   +  I + L I  V+K+SFDKANRS+    
Sbjct: 8   NFEIGGGEPLVLLAGPCVLEGLERSLMIGRGIKEITERLGIPYVFKASFDKANRSAYHSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL  G ++   +KK+ G P++TD+H   Q E  A  VDILQIPA L RQTDLL AAA
Sbjct: 68  RGPGLTDGLKMLGRIKKELGVPVVTDIHETCQAEPAAKVVDILQIPAFLSRQTDLLHAAA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           QTG V+NVKKGQFLSP +M N++ K+H  G++ +L  ERG SFGYN LV DMR++PIM S
Sbjct: 128 QTGAVVNVKKGQFLSPNDMRNVVDKIHESGSERILLTERGASFGYNNLVVDMRALPIMRS 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFD +HSVQ PG  G  S G+R+Y+  L +AAV  G+ G+FLE H +P  A SDG
Sbjct: 188 FGYPVIFDGTHSVQLPGGAGTSSSGQREYVEYLVRAAVGAGVDGLFLEVHDNPAEALSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
            NM+ +  L +LL + L+I +I++ 
Sbjct: 248 ANMVYLDKLEELLKEALSIYEIVRK 272


>gi|251792738|ref|YP_003007464.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aggregatibacter
           aphrophilus NJ8700]
 gi|247534131|gb|ACS97377.1| 3-deoxy-8-phosphooctulonate synthase [Aggregatibacter aphrophilus
           NJ8700]
          Length = 284

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 120/268 (44%), Positives = 176/268 (65%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  + E    + Q L +  V+K+SFDKANRSS+  
Sbjct: 9   GDIQIANDKPFVLFGGMNVLESRDMAIRVCEAYVEVTQKLGVPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF +LK+ +G  ++TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEQGLKIFAELKQTFGVKVITDVHEIYQCQPVAEVVDIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFLSP ++ NI++K+   G   V+ C+RGT+FGY+ LV DM    +M 
Sbjct: 129 ARTGAIINVKKPQFLSPGQVGNIVEKIAECGNDKVILCDRGTNFGYDNLVVDMLGFSVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           +   G PVIFD +HS+Q     G  SGG R  +  LA+A +A+G+AG+FLE H DP+NA 
Sbjct: 189 NVSKGCPVIFDVTHSLQCRDPFGAASGGRRAQVTELARAGMAVGLAGLFLEAHPDPNNAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L  ++ Q+ AID ++K 
Sbjct: 249 CDGPSALPLDKLEGVVRQMKAIDDLVKS 276


>gi|134296289|ref|YP_001120024.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           vietnamiensis G4]
 gi|166199030|sp|A4JFY6|KDSA_BURVG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|134139446|gb|ABO55189.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           vietnamiensis G4]
          Length = 284

 Score =  279 bits (713), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 125/270 (46%), Positives = 174/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q F LIAG C +ES       A +L  IC  LN+  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDQPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETNAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLHRMGALLETLVTLDQAVK 274


>gi|294083772|ref|YP_003550529.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663344|gb|ADE38445.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 271

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 144/266 (54%), Positives = 189/266 (71%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             V+  +    +LIAGPCQIES DHA   AEKL        +G VYKSS+DKANR+S   
Sbjct: 6   GNVSCGDNHPLLLIAGPCQIESLDHALYCAEKLSKAAADAGMGFVYKSSYDKANRTSAGA 65

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G+ +G  I   +K  +G P+L+DVH   QC   A+ +D+LQIPA LCRQTDLL AA
Sbjct: 66  ARGIGMDEGLAIMAKVKDTFGCPVLSDVHLPDQCATAAEVLDVLQIPAFLCRQTDLLLAA 125

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           AQTG V+N+KKGQFL+PW+M ++  K+   G   V+  ERGTSFGYNTLV+DMR +P M 
Sbjct: 126 AQTGAVVNIKKGQFLAPWDMKHVAAKVTGAGNDRVMLTERGTSFGYNTLVSDMRGLPEMA 185

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S+G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+ G+F+E+HQDPDNAPSD
Sbjct: 186 SLGHPVIFDATHSVQQPGGKGGSSGGQREFVPVLARAAVAVGVNGLFMESHQDPDNAPSD 245

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNM+ +  +  +L+ L+ ID   + 
Sbjct: 246 GPNMLPLDAMSDILAALMRIDAARRG 271


>gi|120553852|ref|YP_958203.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinobacter aquaeolei
           VT8]
 gi|166220451|sp|A1TZ47|KDSA_MARAV RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|120323701|gb|ABM18016.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinobacter aquaeolei
           VT8]
          Length = 281

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 124/265 (46%), Positives = 169/265 (63%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +N++ FVL  G   +ES + AF +AEK   +C  L I  V+K+SFDKANRSS+   
Sbjct: 10  GIEIANDRPFVLFGGMNVLESRELAFEVAEKYVDVCTRLGIPYVFKASFDKANRSSVNSF 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL+KG +I  D+K K+G PI++DVH   Q    A+  DI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGLEKGLQILADIKSKFGVPIISDVHEPGQAAPAAEVCDIIQLPAFLSRQTDLVVAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG VIN+KK QFL+P EM +I+ K    G   ++ CERGTSFGYN LV DM    IM  
Sbjct: 130 KTGAVINIKKAQFLAPQEMKHIITKCEEAGNDQIILCERGTSFGYNNLVVDMLGFGIMKQ 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           M VPV FD +H++Q PG   + +GG R  +  LA A ++ G+AG+FLE H DPD A  DG
Sbjct: 190 MNVPVFFDVTHALQMPGGRADSAGGRRAQVTDLALAGMSQGLAGLFLEAHPDPDKARCDG 249

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           P  + +  L   L ++ A+D ++K 
Sbjct: 250 PCALRLSQLEPFLERVKAVDDLVKS 274


>gi|77457347|ref|YP_346852.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           Pf0-1]
 gi|123605782|sp|Q3KH93|KDSA_PSEPF RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|77381350|gb|ABA72863.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           Pf0-1]
          Length = 281

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 121/266 (45%), Positives = 168/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKANRSSVTS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF+D+K+ +G PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMRIFQDIKQAFGVPIITDVHEPDQAAVVAEVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTNAVINIKKAQFLAPQEMKHILNKCVEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +HS+Q PG   + +GG R  +  LAKA ++  +AG+FLE H DPDNA  D
Sbjct: 189 QFEYPVFFDVTHSLQMPGGRSDSAGGRRAQVTDLAKAGMSQSLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL A+D+++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKALDELVKS 274


>gi|88812396|ref|ZP_01127646.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitrococcus mobilis
           Nb-231]
 gi|88790403|gb|EAR21520.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Nitrococcus mobilis
           Nb-231]
          Length = 281

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 129/264 (48%), Positives = 170/264 (64%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q   LIAGPC +ES   A   A +L  IC++L I  VYKSSFDKANRSS    
Sbjct: 8   GFPVGLDQPLFLIAGPCVVESEQLALDSAGELKEICRTLAIPFVYKSSFDKANRSSHHSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL+ G  I   ++++ G P+LTDVH +     +A  VD+LQ PA LCRQT+ + + A
Sbjct: 68  RGPGLEAGLRILEQVRREIGVPVLTDVHEDTPLNEVAAVVDLLQTPAFLCRQTNFIQSVA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G  +N+KKGQFL+PW+M ++ +K  A G + +L CERG SFGYN LV DMRS+  +  
Sbjct: 128 RQGLPVNIKKGQFLAPWDMVHVAEKARAVGNQRILVCERGVSFGYNNLVCDMRSLAALRQ 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQ PG  G  SGG+R++I  LA+AAVA G+ G+F+ETH  PD A SDG
Sbjct: 188 SGSPVVFDATHSVQLPGGQGTVSGGQREFIPVLARAAVAAGVCGVFMETHPRPDEALSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN   +  +  LL  L  ID  +K
Sbjct: 248 PNSWPLARMRSLLEMLKEIDSGVK 271


>gi|300312082|ref|YP_003776174.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Herbaspirillum seropedicae SmR1]
 gi|300074867|gb|ADJ64266.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 284

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 129/271 (47%), Positives = 176/271 (64%), Gaps = 6/271 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +  F LIAG C IES   A   A  L  I   L I  +YKSSFDKANRSS +  
Sbjct: 5   GFDVGLDHPFFLIAGTCVIESEQMALDTAGTLKEITAELGIPFIYKSSFDKANRSSGSSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G++KG EI   +KK+ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMEKGLEILAKVKKEIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K  A            + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMVNVIDKARAAAKEAGLPTDQFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A+GI+G+F+ETH +P 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAIAVGISGVFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            A SDGPN + +  +  LL  ++ +D+I+K 
Sbjct: 245 EAKSDGPNAVPLARMKDLLGTMIDLDRIVKK 275


>gi|323697965|ref|ZP_08109877.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio sp. ND132]
 gi|323457897|gb|EGB13762.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio
           desulfuricans ND132]
          Length = 267

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 132/255 (51%), Positives = 181/255 (70%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
            ++AGPC IES + A   A+ L  +   L + +VYKSSFDKANR+SL   RG G+++G  
Sbjct: 13  FILAGPCAIESRETALQTADVLAGLASKLGLPIVYKSSFDKANRTSLTSFRGPGMEEGLA 72

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
           I  ++K   G P++TD+H  +Q   +A+  D+LQIPA LCRQTDLL AAA+TGRV+NVKK
Sbjct: 73  ILAEVKAATGLPVVTDIHHPEQAAPVAEVADVLQIPAFLCRQTDLLMAAARTGRVVNVKK 132

Query: 166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDAS 225
           GQFL+PW+M N+++KL A G   +   ERG+++GYN LV DMRSIP M + GVPVI DA+
Sbjct: 133 GQFLAPWDMKNVVEKLRAAGNDRIWLTERGSTYGYNNLVVDMRSIPQMQAFGVPVIMDAT 192

Query: 226 HSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLP 285
           HSVQ PG  G  SGG+R+Y+  LA AAVA G+ G+F+E H DPD A  DGPN + +  + 
Sbjct: 193 HSVQLPGGLGGASGGQREYVPVLASAAVAAGVDGVFMEVHPDPDRALCDGPNSLPLNQVE 252

Query: 286 KLLSQLLAIDKIIKP 300
            LL++LLA+ ++++ 
Sbjct: 253 GLLNRLLALWEVVRG 267


>gi|330968940|gb|EGH69006.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 281

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 114/266 (42%), Positives = 169/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEVANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  D++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDVIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAIINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  D
Sbjct: 189 QFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL ++D+++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKSLDELVKS 274


>gi|254251982|ref|ZP_04945300.1| Phospho-2-dehydro-3-deoxyheptonate aldolase [Burkholderia dolosa
           AUO158]
 gi|124894591|gb|EAY68471.1| Phospho-2-dehydro-3-deoxyheptonate aldolase [Burkholderia dolosa
           AUO158]
          Length = 284

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 124/270 (45%), Positives = 174/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC  LN+  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILGEVKRQLGLPVLTDVHSVDEIEQVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETDAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLNRMSALLETLVTLDQAVK 274


>gi|289208645|ref|YP_003460711.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thioalkalivibrio sp.
           K90mix]
 gi|288944276|gb|ADC71975.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thioalkalivibrio sp.
           K90mix]
          Length = 280

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 126/255 (49%), Positives = 170/255 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAGPC IES   A   A  L AI   L I  +YKSSFDKANRSS    
Sbjct: 5   GFEVGLDRPFFLIAGPCVIESEAMALETAGALTAITDELGIPFIYKSSFDKANRSSTKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G  I   +K++ G P+LTDVH +   + +A  VD+LQ PA LCRQT+ +   A
Sbjct: 65  RGPGMEEGLRILEQVKQQLGVPVLTDVHEDTPLDEVASVVDVLQTPAFLCRQTNFIQNVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + GR +N+KKGQFL+PW+M N++ K    G + ++ CERG SFGYNTL++DMR +  M  
Sbjct: 125 RQGRPVNIKKGQFLAPWDMGNVVDKAREAGNEQIMVCERGVSFGYNTLISDMRGLAQMRQ 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQQPG  G  SGG+R+Y+  LA+AAVA G++G+F+ETH DP+ A SDG
Sbjct: 185 TGCPVVFDATHSVQQPGGQGATSGGQREYVPVLARAAVASGVSGLFMETHPDPERALSDG 244

Query: 276 PNMINIKDLPKLLSQ 290
           PN   +  + +LL+ 
Sbjct: 245 PNAWPLPRMAELLTT 259


>gi|125654618|ref|YP_001033812.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           2.4.1]
 gi|126464811|ref|YP_001041787.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           ATCC 17029]
 gi|332561303|ref|ZP_08415618.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           WS8N]
 gi|77386278|gb|ABA81707.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           2.4.1]
 gi|126106626|gb|ABN79151.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           ATCC 17029]
 gi|332274102|gb|EGJ19419.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           WS8N]
          Length = 278

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 141/278 (50%), Positives = 193/278 (69%), Gaps = 4/278 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           T   + +G     +         LI GPCQ+ES DHA M+AE++   C       ++K+S
Sbjct: 4   TPTIVTIGD----IAIGGGHPIALITGPCQLESLDHARMMAERIAEACAPTGTKFIFKAS 59

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           +DKANRSSL+  RG+G++KG EI   +++++G P+LTDVH    C   A+  D+LQIPA 
Sbjct: 60  YDKANRSSLSTARGLGMEKGLEILGRIREEFGVPVLTDVHEPGHCATAAEVCDVLQIPAF 119

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AA +TGR +NVKKGQFL+PW+M N+  K+ + G + +L CERGTSFGYNTL
Sbjct: 120 LCRQTDLLLAAGETGRAVNVKKGQFLAPWDMKNVADKVASTGNRRILLCERGTSFGYNTL 179

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           VTD R +P M + G PV+FDA+HSVQQPG  G  SGG+R++   LA+AA A+G++ +F+E
Sbjct: 180 VTDFRGLPTMAATGWPVVFDATHSVQQPGGLGGSSGGQREFAPVLARAACAVGVSALFIE 239

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           TH+DPD APSDGPNMI +  + +L++ L A D + K L
Sbjct: 240 THEDPDRAPSDGPNMIPVDRMGRLIADLCAFDALAKSL 277


>gi|53729233|ref|ZP_00133757.2| COG2877: 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate
           synthase [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|126209042|ref|YP_001054267.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae L20]
 gi|6647547|sp|O68662|KDSA_ACTPL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|2996207|gb|AAC26633.1| 3-deoxy-D-manno-2-octulosonic acid 8-phosphate synthetase
           [Actinobacillus pleuropneumoniae]
 gi|126097834|gb|ABN74662.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
          Length = 286

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 124/280 (44%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ F L  G   +ES D A  + E+   +   L +  V+K+
Sbjct: 3   ILNKIVKVG----NIEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKA 58

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA
Sbjct: 59  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVSIITDVHEIYQCKPVAEVVDIIQLPA 118

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G ++V+ C+RGT+FGY+ 
Sbjct: 119 FLARQTDLVEAMARTGVVINVKKPQFLSPGQMGNIVEKIAECGNENVILCDRGTNFGYDN 178

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM     G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 179 LVVDMLGFNIMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGL 238

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP++A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 239 FLEAHPDPNSAKCDGPSALPLSKLEAFVSQMKAIDDLVKS 278


>gi|70728577|ref|YP_258326.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           Pf-5]
 gi|123762209|sp|Q4KHF7|KDSA_PSEF5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|68342876|gb|AAY90482.1| 3-deoxy-8-phosphooctulonate synthase [Pseudomonas fluorescens Pf-5]
          Length = 281

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 121/266 (45%), Positives = 168/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GNIEIANDKPMVLFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKASFDKANRSSVTS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF D+K+ +G PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMRIFEDVKQAFGVPIITDVHEPAQAAVVAEVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAVINIKKAQFLAPQEMKHILSKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +H++Q PG   + +GG R  +  LAKA ++  +AG+FLE H DPDNA  D
Sbjct: 189 QFEYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGMSQSLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL A+D+++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKALDELVKS 274


>gi|83720532|ref|YP_442423.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           thailandensis E264]
 gi|167581352|ref|ZP_02374226.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           thailandensis TXDOH]
 gi|167619429|ref|ZP_02388060.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           thailandensis Bt4]
 gi|257138626|ref|ZP_05586888.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           thailandensis E264]
 gi|83654357|gb|ABC38420.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia thailandensis
           E264]
          Length = 284

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 123/270 (45%), Positives = 171/270 (63%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC  L +  +YKSS+DKANRSS    
Sbjct: 5   GFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLGVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLGRMAALLETLVTLDQAVK 274


>gi|66044610|ref|YP_234451.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           syringae B728a]
 gi|75502986|sp|Q4ZWQ9|KDSA_PSEU2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|63255317|gb|AAY36413.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           syringae B728a]
          Length = 281

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 115/266 (43%), Positives = 169/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEVANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAIINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  D
Sbjct: 189 QFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL ++D+++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKSLDELVKS 274


>gi|227111334|ref|ZP_03824990.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
 gi|227328869|ref|ZP_03832893.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 284

 Score =  278 bits (711), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 126/280 (45%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            TN  + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MTNKVVKIGD----IPVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHESHQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMT--SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M   S G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFNVMKHASNGAPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP NA  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPANAKCDGPSALPLDKLEPFLQQIKAIDDLVKS 276


>gi|308186589|ref|YP_003930720.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Pantoea vagans C9-1]
 gi|308057099|gb|ADO09271.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Pantoea vagans C9-1]
          Length = 284

 Score =  278 bits (711), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 119/280 (42%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            T   + +G     +  +N+  FVL  G   +ES + A  I E    +   L I  V+K+
Sbjct: 1   MTQKVVSIGD----INVANDLPFVLFGGMNVLESRELAMRICEHYVTVTNKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEAAQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFAEGGNEQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M       PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMKKVTKNSPVIFDVTHALQTRDPFGAASGGRRAQVAELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHALCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|312959412|ref|ZP_07773929.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           WH6]
 gi|311286129|gb|EFQ64693.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas fluorescens
           WH6]
          Length = 281

 Score =  278 bits (711), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 121/266 (45%), Positives = 170/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++  VL  G   +ES D A  + E+   + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTQKLGIPYVFKASFDKANRSSVTS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF+D+K+ +G PI+TDVH  +Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMRIFQDIKQAFGVPIITDVHEPEQAAVVAEVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAVINIKKAQFLAPQEMKHILNKCVEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  D
Sbjct: 189 QFEYPVFFDVTHALQMPGGRADSAGGRRAQVLDLAKAGLSQSLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL  +D+++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKQLDELVKS 274


>gi|95928729|ref|ZP_01311475.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfuromonas
           acetoxidans DSM 684]
 gi|95135074|gb|EAT16727.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfuromonas
           acetoxidans DSM 684]
          Length = 274

 Score =  278 bits (711), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 130/276 (47%), Positives = 183/276 (66%), Gaps = 4/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
               + +G     V F ++  FVL++GPC +E  D    IAE L  +   L I  V+K+S
Sbjct: 1   MVTEVKIGD----VAFGDQHPFVLVSGPCVLEDLDMTLHIAESLKKLTDQLGIDFVFKAS 56

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           +DKANR+S++  RG G+  G E+   +K ++  P+++DVH   Q  A +  +DI+QIPA 
Sbjct: 57  YDKANRTSVSSFRGPGIDAGLEMLAKVKSEFNVPVVSDVHDATQVAAASQVLDIIQIPAF 116

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AA  +GRV+NVKKGQF +PW+M +++ K+ + G + +L  ERG SFGYN L
Sbjct: 117 LCRQTDLLVAAGNSGRVVNVKKGQFQAPWDMKHVVGKVASTGNEQILLTERGASFGYNNL 176

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DMRS+ IM  +G PVIFDA+H+VQ PG     S G+R+Y+  L++AAVAIGI G+F E
Sbjct: 177 VVDMRSLLIMRELGKPVIFDATHAVQLPGGADGASAGQREYVAALSRAAVAIGIDGLFWE 236

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            H DP+ A  DGPN + +KDL  +L  LLA+D ++K
Sbjct: 237 VHPDPECARCDGPNSLYLKDLQPILESLLAVDAVVK 272


>gi|254486746|ref|ZP_05099951.1| 3-deoxy-8-phosphooctulonate synthase [Roseobacter sp. GAI101]
 gi|214043615|gb|EEB84253.1| 3-deoxy-8-phosphooctulonate synthase [Roseobacter sp. GAI101]
          Length = 277

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 144/271 (53%), Positives = 195/271 (71%)

Query: 30  LGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR 89
           +      V    ++   +IAGPCQ+ES  HA MIA ++   C +     V+K+S+DKANR
Sbjct: 2   IQVAVGNVVIGIDRPLTVIAGPCQLESETHAQMIAGQMKEACDAAGAQFVFKASYDKANR 61

Query: 90  SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTD 149
           +SL+GKRG+G+ +G  + + + K  G P+LTDVHTE QC   A++VDILQIPA LCRQTD
Sbjct: 62  TSLSGKRGLGIDEGLAVLQSVGKSIGVPVLTDVHTEAQCAIAAEAVDILQIPAFLCRQTD 121

Query: 150 LLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRS 209
           +L AA  TG+V+NVKKGQFL+PW+M N++ K+ + G K +L  ERGTSFGYNTLV DMRS
Sbjct: 122 MLLAAGNTGKVVNVKKGQFLAPWDMANVVSKIESTGNKRILLTERGTSFGYNTLVADMRS 181

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           +P M   G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAVAIG+  +F+ETH+DPD
Sbjct: 182 LPQMAKTGYPVVMDATHSVQQPGGMGGSSGGQREFAPVMARAAVAIGVGAVFIETHEDPD 241

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           NAPSDGPNMI++  +P L++ L+  D + K 
Sbjct: 242 NAPSDGPNMIHLDQMPALIASLMEFDALAKK 272


>gi|28868759|ref|NP_791378.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213969137|ref|ZP_03397276.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato T1]
 gi|301383968|ref|ZP_07232386.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato Max13]
 gi|302064146|ref|ZP_07255687.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato K40]
 gi|302134073|ref|ZP_07260063.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|32171413|sp|Q886M4|KDSA_PSESM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|28851998|gb|AAO55073.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213926135|gb|EEB59691.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           tomato T1]
 gi|330872708|gb|EGH06857.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330964162|gb|EGH64422.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331016385|gb|EGH96441.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 281

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 115/267 (43%), Positives = 169/267 (63%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
              +  +N++  V+  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+ 
Sbjct: 8   TGSIEIANDKPMVVFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKASFDKANRSSVN 67

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQTDL+ A
Sbjct: 68  SYRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQTDLVVA 127

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM
Sbjct: 128 MAKTGAIINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIM 187

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
                PV+FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  
Sbjct: 188 KQFEYPVLFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPDPDNAKC 247

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGP  + +  L   L+QL ++D+++K 
Sbjct: 248 DGPCALRLDKLEPFLAQLKSLDELVKS 274


>gi|99080494|ref|YP_612648.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ruegeria sp. TM1040]
 gi|99036774|gb|ABF63386.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ruegeria sp. TM1040]
          Length = 277

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 144/266 (54%), Positives = 194/266 (72%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T  N+    +IAGPCQ+ES DHA MIA KL   C +     ++K+S+DKANR+SL+G
Sbjct: 7   NGLTIGNDCPLTVIAGPCQLESADHAQMIAGKLKEACDAAGAQFIFKASYDKANRTSLSG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G+ KG E+   ++  +G P+LTDVHTE QC    D VD+LQIPA LCRQTD+L AA
Sbjct: 67  KRGLGIDKGLEVLAGVRDTFGVPVLTDVHTEAQCIVAGDVVDVLQIPAFLCRQTDMLLAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
             TG+ +N+KKGQFL+PW+M N++ K+ + G   +L  ERGTSFGYN LV DMR +P M 
Sbjct: 127 GNTGKAVNIKKGQFLAPWDMDNVVAKVESTGNDKILLTERGTSFGYNALVADMRGLPRMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+ DA+HSVQQPG  G  +GG+R++   +A+AAV++GIA +F+ETH+DPDNAPSD
Sbjct: 187 QTGYPVVMDATHSVQQPGGQGGSTGGQREFAPVMARAAVSLGIASVFIETHEDPDNAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNMI +KD+P+L+  L+  D + K 
Sbjct: 247 GPNMIYLKDMPQLIETLMGFDALAKA 272


>gi|329123572|ref|ZP_08252134.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus aegyptius ATCC
           11116]
 gi|327470314|gb|EGF15774.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus aegyptius ATCC
           11116]
          Length = 284

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGVASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|323143929|ref|ZP_08078587.1| 3-deoxy-8-phosphooctulonate synthase [Succinatimonas hippei YIT
           12066]
 gi|322416293|gb|EFY06969.1| 3-deoxy-8-phosphooctulonate synthase [Succinatimonas hippei YIT
           12066]
          Length = 283

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 122/268 (45%), Positives = 171/268 (63%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T +N+    +I G   +ES D A  + EK   +   L++  ++K+SFDKANRSSL  
Sbjct: 9   NDITIANDLPLTVIGGINVLESRDLAMRVCEKFMEVTGKLHLPYIFKASFDKANRSSLRS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+ G +IF DLK+++   I+TDVH   QC  +A+ VD+LQ+PA L RQ+DL+ A 
Sbjct: 69  YRGPGLEAGMKIFDDLKREFNVSIITDVHETYQCALVAEHVDLLQLPAFLARQSDLVFAL 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG+ +NVKK QF+SP ++ NI++K H  G  +V+ CERGT FGY+ LV DM    +M 
Sbjct: 129 GKTGKPVNVKKPQFMSPAQVVNIVEKFHETGNDNVILCERGTQFGYDNLVVDMLGFGVMK 188

Query: 215 SM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
            +    PVIFD +HS+Q    +   SGG R  +  LAKA VAIG+AGIF+ETH DPD A 
Sbjct: 189 KVSGNAPVIFDVTHSLQCREANSQASGGRRAQVFDLAKAGVAIGLAGIFVETHPDPDKAL 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   LS L  +D ++K 
Sbjct: 249 CDGPSALPLDKLEPFLSDLKELDTLVKS 276


>gi|118595042|ref|ZP_01552389.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylophilales
           bacterium HTCC2181]
 gi|118440820|gb|EAV47447.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylophilales
           bacterium HTCC2181]
          Length = 275

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 125/267 (46%), Positives = 175/267 (65%), Gaps = 2/267 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  +   LIAGPC IES      +A +L  +   L I  ++KSSFDKANRSS    
Sbjct: 5   HFNVGLTEPLFLIAGPCVIESESMTIDVAGQLKEMTDQLGIPFIFKSSFDKANRSSNKTF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G  I +++K + G P+LTD+HT +Q E +A  VD+LQ PA LCRQTD ++A A
Sbjct: 65  RGFGVEEGLRILQEVKSQIGVPVLTDIHTAEQVEEVASVVDVLQTPAFLCRQTDFISAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHG--AKDVLFCERGTSFGYNTLVTDMRSIPIM 213
           ++G+ +N+KKGQFL+P +M  ++ K         +++ CERG SFGYNTLV+DMRS+ IM
Sbjct: 125 KSGKPVNIKKGQFLAPQDMRQVVNKAKEANGGIDNIMVCERGVSFGYNTLVSDMRSLAIM 184

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
                PV+FDA+HSVQQPG  G+ SGG+ +++  LA+AAV+ GIAGIF+ETH +P  A S
Sbjct: 185 RDTDCPVVFDATHSVQQPGGQGDRSGGQSEFVPLLARAAVSSGIAGIFMETHPNPSEALS 244

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGPN + +  +  LL  L  +D  +K 
Sbjct: 245 DGPNAVPLNQMQALLEVLKELDHTVKS 271


>gi|304391758|ref|ZP_07373700.1| 3-deoxy-8-phosphooctulonate synthase [Ahrensia sp. R2A130]
 gi|303295987|gb|EFL90345.1| 3-deoxy-8-phosphooctulonate synthase [Ahrensia sp. R2A130]
          Length = 280

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 165/281 (58%), Positives = 208/281 (74%), Gaps = 5/281 (1%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +   A++ +G     VTF+ +  F LIAGPCQ+E   HAF +A  +  IC  L IGLVYK
Sbjct: 4   VEPQASVKVGD----VTFAQDAPFSLIAGPCQMEGRQHAFDMAGGMKEICGKLGIGLVYK 59

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SSFDKANR+SL+  RG+GL+   EIF DLKK++G P +TDVHT +QC  +A  VD+LQIP
Sbjct: 60  SSFDKANRTSLSASRGIGLEASLEIFSDLKKEFGLPTVTDVHTAEQCALVAAHVDVLQIP 119

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A LCRQTDLL AAA+TG VINVKKGQFL+PW+M N+L KL   G  +VL  ERGTSFGYN
Sbjct: 120 AFLCRQTDLLVAAAETGAVINVKKGQFLAPWDMKNVLGKLTGAGNGNVLMTERGTSFGYN 179

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV D R +P M SMG PV+FDA+HSVQQPG  G  +GG+R+++  L++AAVA+G+AG+F
Sbjct: 180 TLVNDFRGLPEMASMGAPVVFDATHSVQQPGGQGGSTGGQREFVATLSRAAVAVGVAGLF 239

Query: 262 LETHQDPDN-APSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           +ETH DPDN   SDGPNM+ +  +P LL QL+A D+I K L
Sbjct: 240 IETHDDPDNTTSSDGPNMVPLDQMPALLEQLMAFDRIAKGL 280


>gi|289675288|ref|ZP_06496178.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           syringae FF5]
          Length = 281

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 115/266 (43%), Positives = 169/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++  VL  G   +ES D A  + E+   + + L +  V+K+SFDKANRSS+  
Sbjct: 9   GSIEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGMPYVFKASFDKANRSSVNS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  D
Sbjct: 189 QFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL ++D+++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKSLDELVKS 274


>gi|307257655|ref|ZP_07539414.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306863830|gb|EFM95754.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|328684723|gb|AEB33791.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Actinobacillus pleuropneumoniae serovar 10]
          Length = 284

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 178/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ F L  G   +ES D A  + E+   +   L +  V+K+
Sbjct: 1   MNNKIVKVG----NIEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +   I+TDVH   QC+ +A+ VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFSVSIITDVHEIYQCKPVAEVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+     ++V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIAECSNENVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM     G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 177 LVVDMLGFNIMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP+NA  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPDPNNAKCDGPSALPLSKLEAFVSQMKAIDDLVKS 276


>gi|163760087|ref|ZP_02167170.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hoeflea phototrophica
           DFL-43]
 gi|162282486|gb|EDQ32774.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hoeflea phototrophica
           DFL-43]
          Length = 280

 Score =  278 bits (710), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 165/277 (59%), Positives = 207/277 (74%), Gaps = 5/277 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
            N+ + +G       F N +   LIAGPCQ ES DHAF +A  L  +C  L IGLVYKSS
Sbjct: 4   ANSTVTVGDAV----FDNTRPLTLIAGPCQFESRDHAFDMAGALKELCAGLGIGLVYKSS 59

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           +DKANR+SL+  RG GL     +F DL+++ G P+LTD+HTE+ C  +A  VD+LQIPA 
Sbjct: 60  YDKANRTSLSSTRGAGLDAAMPVFDDLRQQLGLPVLTDIHTEEHCAIVAPHVDVLQIPAF 119

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TG+VINVKKGQFL+PW+M N+L K+   G  +VL  ERG SFGYNTL
Sbjct: 120 LCRQTDLLVAAAKTGKVINVKKGQFLAPWDMKNVLGKITGSGNANVLLTERGASFGYNTL 179

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMR++PIM  MG PVIFDA+HSVQQPG  G  SGGER+++  L++AAVA+GIAG+F+E
Sbjct: 180 VSDMRALPIMADMGAPVIFDATHSVQQPGGQGATSGGERRFVETLSRAAVAVGIAGVFIE 239

Query: 264 THQDPDNA-PSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           THQDPDN+  SDGPNMI +KDLP+LL  L+A D + K
Sbjct: 240 THQDPDNSTSSDGPNMIPLKDLPRLLETLMAFDSVAK 276


>gi|320329627|gb|EFW85616.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330878146|gb|EGH12295.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 281

 Score =  278 bits (710), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 119/278 (42%), Positives = 172/278 (61%), Gaps = 4/278 (1%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                I +GS    +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+
Sbjct: 1   MAQKTIRVGS----IEIANDKPMVLFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G  IF D+K+ +  P++TDVH   Q   +A+  DI+Q+PA
Sbjct: 57  SFDKANRSSVNSYRGPGLEEGMRIFEDIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN 
Sbjct: 117 FLSRQTDLVVAMAKTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNN 176

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV DM    +M     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FL
Sbjct: 177 LVVDMLGFGVMKQFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFL 236

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           E H DPDNA  DGP  + +  L   L+QL ++D+ +K 
Sbjct: 237 EAHPDPDNAKCDGPCALRLDKLEPFLAQLKSLDEFVKS 274


>gi|320157135|ref|YP_004189514.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           vulnificus MO6-24/O]
 gi|319932447|gb|ADV87311.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           vulnificus MO6-24/O]
          Length = 284

 Score =  278 bits (710), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 123/281 (43%), Positives = 175/281 (62%), Gaps = 6/281 (2%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +     + +G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K
Sbjct: 1   MMEQKIVQIGD----IQVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+P
Sbjct: 57  ASFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G   ++ CERG+  GY+
Sbjct: 117 AFLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKIILCERGSCHGYD 176

Query: 202 TLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
            LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG
Sbjct: 177 NLVVDMLGFGVMKKASKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAG 236

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +F+E H +PD A  DGP+ + +  L   L+Q+ A+D ++K 
Sbjct: 237 LFIEAHPNPDQARCDGPSALPLDKLEPFLAQMKALDDLVKS 277


>gi|330807800|ref|YP_004352262.1| 3-deoxy-8-phosphooctulonate synthase
           (2-dehydro-3-deoxyphosphooctonate aldolase) [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327375908|gb|AEA67258.1| 3-deoxy-8-phosphooctulonate synthase
           (2-dehydro-3-deoxyphosphooctonate aldolase) [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 281

 Score =  278 bits (710), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 123/266 (46%), Positives = 169/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++  VL  G   +ES D A  + E+   + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIEIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTQKLGIPYVFKASFDKANRSSVTS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF+D+K+ +G PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMRIFQDIKQAFGVPIITDVHEPAQAAVVAEVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAVINIKKAQFLAPQEMKHILSKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +H++Q PG   + +GG R  +  LAKA ++  +AG+FLE H DPDNA  D
Sbjct: 189 QFEYPVFFDVTHALQMPGGRSDSAGGRRAQVTDLAKAGISQSLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   LSQL A+D+++K 
Sbjct: 249 GPCALRLNKLEPFLSQLKALDELVKS 274


>gi|16273457|ref|NP_439706.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           Rd KW20]
 gi|260580338|ref|ZP_05848167.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus influenzae RdAW]
 gi|1170637|sp|P45251|KDSA_HAEIN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|1574401|gb|AAC23206.1| 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA) [Haemophilus
           influenzae Rd KW20]
 gi|260093015|gb|EEW76949.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus influenzae RdAW]
          Length = 284

 Score =  278 bits (710), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|144898640|emb|CAM75504.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 281

 Score =  278 bits (710), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 146/264 (55%), Positives = 195/264 (73%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +   N+   VLIAGPCQ+ES +HA   A  L  +C+   IGL+YKSSFDKANR+SL+G+R
Sbjct: 12  LVLGNDLPLVLIAGPCQMESREHALECAGALKDMCEKAGIGLIYKSSFDKANRTSLSGRR 71

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+GL+    +F ++++  G P+LTD+H E+QC  +A +VD+LQIPA LCRQTDLL AA +
Sbjct: 72  GLGLEAALPVFAEIRESLGLPVLTDIHNEEQCIPVAKAVDVLQIPAFLCRQTDLLVAAGR 131

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG VINVKKGQFL+P +M N+  K+ + G   +L  ERG  FGY  LV DMR+IPIM S 
Sbjct: 132 TGAVINVKKGQFLAPSQMANVAAKVESTGNSRILLTERGACFGYGDLVADMRAIPIMAST 191

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVI DA+H+VQ PG  G  SGG+R++   LA+AAV++G+AG+F+ETH DPD+APSDGP
Sbjct: 192 GFPVIMDATHAVQSPGGQGASSGGDRRFAPVLARAAVSLGLAGVFIETHPDPDHAPSDGP 251

Query: 277 NMINIKDLPKLLSQLLAIDKIIKP 300
           NMI + D+P L+S L+A D++ K 
Sbjct: 252 NMIRLADMPALISSLMAFDRLAKA 275


>gi|50121121|ref|YP_050288.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pectobacterium
           atrosepticum SCRI1043]
 gi|59798243|sp|Q6D547|KDSA_ERWCT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|49611647|emb|CAG75096.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pectobacterium
           atrosepticum SCRI1043]
          Length = 284

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            TN  + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MTNKVVKIGD----IPVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHDSHQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   ++ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDQIILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMT--SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M   S G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFNVMKHASNGSPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP NA  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPANAKCDGPSALPLDKLEPFLQQIKAIDDLVKS 276


>gi|146308055|ref|YP_001188520.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas mendocina
           ymp]
 gi|330504225|ref|YP_004381094.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas mendocina
           NK-01]
 gi|166987634|sp|A4XWS2|KDSA_PSEMY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|145576256|gb|ABP85788.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas mendocina
           ymp]
 gi|328918511|gb|AEB59342.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas mendocina
           NK-01]
          Length = 281

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 122/265 (46%), Positives = 169/265 (63%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +N++ FVL  G   +ES D A    E+   + + L I  V+K+SFDKANRSS+   
Sbjct: 10  DIEIANDKPFVLFGGINVLESRDLAMQACEEYVRVTEKLGIPYVFKASFDKANRSSITSF 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G +IF ++KK +G P++TDVH   Q  A+A+  DI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGLEEGMKIFEEVKKTFGVPVITDVHEPHQAAAVAEVCDIIQLPAFLSRQTDLVVAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM  
Sbjct: 130 KTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMKQ 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV FD +H++Q PG   + +GG R  +  LAKA ++ G+AG+FLE H DP+NA  DG
Sbjct: 190 FEYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGMSQGLAGLFLEAHPDPENAKCDG 249

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           P  + +  L   LSQL  +D ++K 
Sbjct: 250 PCALRLNKLEPFLSQLKQLDDLVKS 274


>gi|152995155|ref|YP_001339990.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinomonas sp. MWYL1]
 gi|150836079|gb|ABR70055.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinomonas sp. MWYL1]
          Length = 288

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 3/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
            +  I +G   N++  +N   FVL +G   +ES D A  +AE+   + ++L I  V+K S
Sbjct: 7   ESKIIKIG---NKIEVANHLPFVLFSGVNVLESRDLAMRVAEEHVKVTEALGIPYVFKGS 63

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG G+++G +I +++K  +  P++TDVH   QC  +A+  D++Q+PA 
Sbjct: 64  FDKANRSSINSFRGPGMEEGLKILQEIKDTFDVPVITDVHEAYQCAPVAEVADVIQLPAF 123

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+TG VIN+KK QFL+P EM +IL K    G  +++ CERGT  GYN L
Sbjct: 124 LSRQTDLVIAMAKTGAVINIKKAQFLAPHEMKHILTKCEEAGNNNLMLCERGTMMGYNNL 183

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM     M   G PV+FD +HS+Q+PG   + + G R  +  LA+A +++G++ +FLE
Sbjct: 184 VVDMLGFGEMKKFGYPVMFDVTHSLQRPGGREDSADGRRAQVTELARAGMSLGLSSLFLE 243

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           TH DPD+A  DGP  + +  L   L Q+  +D+++K
Sbjct: 244 THPDPDSAKCDGPCALPLGKLAPFLKQMKQLDELVK 279


>gi|68249928|ref|YP_249040.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           86-028NP]
 gi|145631799|ref|ZP_01787559.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           R3021]
 gi|81335648|sp|Q4QKR7|KDSA_HAEI8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|68058127|gb|AAX88380.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           86-028NP]
 gi|144982589|gb|EDJ90139.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           R3021]
          Length = 284

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPGQMGNIVEKIEECGNDKIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|254427740|ref|ZP_05041447.1| 3-deoxy-8-phosphooctulonate synthase [Alcanivorax sp. DG881]
 gi|196193909|gb|EDX88868.1| 3-deoxy-8-phosphooctulonate synthase [Alcanivorax sp. DG881]
          Length = 282

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 120/267 (44%), Positives = 168/267 (62%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N + F+N++   L  G   +ES D A  +AE    +   LN+  V+K+SFDKANRSSL+ 
Sbjct: 10  NGLEFANDKPMALFGGMNVLESRDMAMQVAEAYAEVTSKLNMPWVFKASFDKANRSSLSS 69

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL +G +IF ++KK +  P++TDVH   Q   +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 70  YRGPGLDEGLKIFEEVKKTFNCPVITDVHEPYQAAPVAEVVDIIQLPAFLARQTDLVVAM 129

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 130 AKTGAIINIKKPQFLAPHEMSHILHKCEDAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +H++Q+PG   + + G R  +  L +A ++ GIAG+FLE H DPDNA  D
Sbjct: 190 QFNYPVFFDVTHALQKPGGRADSADGRRAQVAELGRAGISQGIAGLFLEAHPDPDNAKCD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GP  + +  L   L+Q+  +D  +K L
Sbjct: 250 GPCALRLDRLEPFLAQMQTLDNTVKAL 276


>gi|87307745|ref|ZP_01089888.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Blastopirellula marina
           DSM 3645]
 gi|87289359|gb|EAQ81250.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Blastopirellula marina
           DSM 3645]
          Length = 275

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 131/264 (49%), Positives = 183/264 (69%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T  + Q  +++AGPC IES D    IA +L  I  +L I LV+K+SFDKANR+S   
Sbjct: 8   NNLTCGDGQPLLVVAGPCVIESLDLTLSIASRLKEIAANLPIQLVFKASFDKANRTSGGA 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG+ +G  +  +++++   P+ TD+H   Q   +A+  D+LQIPA L RQTDLL AA
Sbjct: 68  FRGVGIDEGLRVLDEVRRQLELPVTTDIHESTQAAKVAEVCDLLQIPAFLARQTDLLLAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A TG+ INVKKGQF++PW+M +++ KL   G  +V+  ERGT FGY  LV DMR++  M+
Sbjct: 128 ANTGKAINVKKGQFMAPWDMKHVVAKLKEAGNPNVMLTERGTFFGYGRLVNDMRALLEMS 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S+GVPVI+DA+HSVQ+PG  G  +GG R  + P+A+AA A+GI G+F ETH DPD +PSD
Sbjct: 188 SLGVPVIYDATHSVQEPGGLGGATGGNRAMVPPMARAAAAVGIDGLFFETHPDPDKSPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKII 298
           GPNM+ +    KLL Q+LA+ + +
Sbjct: 248 GPNMVPLDAAEKLLRQVLAVREAV 271


>gi|261821673|ref|YP_003259779.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pectobacterium wasabiae
           WPP163]
 gi|261605686|gb|ACX88172.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pectobacterium wasabiae
           WPP163]
          Length = 284

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 125/279 (44%), Positives = 175/279 (62%), Gaps = 6/279 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            TN  + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MTNKVVKIGD----IPVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEAHQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFNVMKQASNGAPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+E H DP NA  DGP+ + +  L   L Q+ AID ++K
Sbjct: 237 FIEAHPDPANAKCDGPSALPLDKLEPFLQQIKAIDDLVK 275


>gi|304397563|ref|ZP_07379440.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pantoea sp. aB]
 gi|304354735|gb|EFM19105.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pantoea sp. aB]
          Length = 284

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            T   + +G     +  +N+  FVL  G   +ES D A  I E    +   L I  V+K+
Sbjct: 1   MTQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVNVTTKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQAFGVKIITDVHEASQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFAEGGNEQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M       PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMKKVTKNSPVIFDVTHALQTRDPFGAASGGRRAQVAELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHALCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|290475218|ref|YP_003468104.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Xenorhabdus
           bovienii SS-2004]
 gi|289174537|emb|CBJ81331.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Xenorhabdus
           bovienii SS-2004]
          Length = 284

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 124/280 (44%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MQQKVVNIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIRSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VIN+KK QF+SP +M NI++K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINIKKPQFVSPGQMGNIVEKFKEGGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFGVMQQATHGAPVIFDVTHALQCRDPLGAASGGRRAQVAELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP+NA  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FLEAHPDPENAKCDGPSALPLAKLESFLMQIKAIDDVVKS 276


>gi|159043136|ref|YP_001531930.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dinoroseobacter shibae
           DFL 12]
 gi|157910896|gb|ABV92329.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dinoroseobacter shibae
           DFL 12]
          Length = 277

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 132/265 (49%), Positives = 179/265 (67%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
            ++   N+Q   LIAGPCQ+ES +    I   L   C       ++K+S+DKANR+S  G
Sbjct: 7   GELRVGNDQPLTLIAGPCQLESFEQGLEIGAALKEACDRSGAQFIFKASYDKANRTSAGG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G+  G +    L++  G P+LTDVH  + C   A++VDILQIPA LCRQTDLL AA
Sbjct: 67  VRGMGMAAGLDALGRLRETLGVPVLTDVHAAEHCAPAAEAVDILQIPAFLCRQTDLLIAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG V+NVKKGQFL+PW+M +++ K+ + G   ++  ERG SFGYNTLV DMRS+P M 
Sbjct: 127 GETGAVVNVKKGQFLAPWDMPHVIGKIESTGNTRIMLTERGASFGYNTLVADMRSLPTMM 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++GIA +F+ETH  PD APSD
Sbjct: 187 KTGYPVVMDATHSVQQPGGLGGASGGQREFAPVMARAAVSLGIAAVFIETHPAPDTAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNMI +  +  L+  L+A D + K
Sbjct: 247 GPNMIPLAQMQDLIGDLMAFDALAK 271


>gi|319776408|ref|YP_004138896.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Haemophilus
           influenzae F3047]
 gi|317450999|emb|CBY87229.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Haemophilus
           influenzae F3047]
          Length = 284

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDSFGAASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|301170294|emb|CBW29900.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Haemophilus
           influenzae 10810]
          Length = 284

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCETYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|85704155|ref|ZP_01035258.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseovarius sp. 217]
 gi|85671475|gb|EAQ26333.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseovarius sp. 217]
          Length = 277

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 143/268 (53%), Positives = 193/268 (72%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
             N     N++    IAGPCQ+ES DHA MIA  L   C +   GL++K SFDKANR+SL
Sbjct: 5   DLNGWAIGNDRPLTFIAGPCQLESADHAQMIAGTLQEACAAFGAGLIFKGSFDKANRTSL 64

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
           +GKRG+G+ +G ++ + +K   G P+LTD+HT  QC  +A+ VD+LQIPA L RQTDLL 
Sbjct: 65  SGKRGLGIDEGLKVLQSVKDAVGLPVLTDIHTADQCAPVAEVVDVLQIPAFLSRQTDLLI 124

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           AA +TG VINVKKGQFL+PW+M N++ K+ + G   ++  ERGTSFGYNTLV DMRS+P 
Sbjct: 125 AAGETGAVINVKKGQFLAPWDMPNVISKIESTGNTRIMLTERGTSFGYNTLVADMRSLPQ 184

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M + G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++G+A +F+ETH+DPDNAP
Sbjct: 185 MAATGYPVVMDATHSVQQPGGRGGSSGGQREFAPVMARAAVSLGVASVFIETHEDPDNAP 244

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           SDGPNMI +  +  L+  L+  D++ K 
Sbjct: 245 SDGPNMIPLTQMSALIDTLMQFDRLAKA 272


>gi|307249193|ref|ZP_07531190.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306858717|gb|EFM90776.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 284

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 124/280 (44%), Positives = 179/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ F L  G   +ES D A  + E+   +   L +  V+K+
Sbjct: 1   MNNKIVKVG----NIEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +A+ VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVNIITDVHEIYQCKPVAEVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G ++V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIAECGNENVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM     G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 177 LVVDMLGFNIMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP++A  DGP+ + +  L    SQ+ AID ++K 
Sbjct: 237 FLEAHPDPNSAKCDGPSALPLSKLEAFTSQMKAIDDLVKS 276


>gi|15602423|ref|NP_245495.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pasteurella multocida
           subsp. multocida str. Pm70]
 gi|13431620|sp|P57853|KDSA_PASMU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|12720824|gb|AAK02642.1| KdsA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 284

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 118/267 (44%), Positives = 174/267 (65%), Gaps = 2/267 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
            ++  SN++ FVL  G   +ES D A  + E    + + L +  V+K+SFDKANRSS+  
Sbjct: 9   GEIEISNDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF++LK  +G  ++TDVH   QC+ +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEQGLKIFQELKDTFGVKLITDVHEIYQCQPVAEVVDIIQLPAFLARQTDLVAAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFLSP +M NI++K+   G  +V+ C+RGT+FGY+ LV DM    +M 
Sbjct: 129 AKTGAIINVKKPQFLSPGQMGNIVEKIEECGNDNVILCDRGTNFGYDNLVVDMLGFSVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+FLE H +P  A 
Sbjct: 189 KVSKGCPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGLFLEAHPNPSQAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
            DGP+ + +  L   + Q+ AID ++K
Sbjct: 249 CDGPSALPLSALEGFVHQMKAIDDLVK 275


>gi|187928063|ref|YP_001898550.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia pickettii 12J]
 gi|238691795|sp|B2U9C1|KDSA_RALPJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|187724953|gb|ACD26118.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia pickettii 12J]
          Length = 284

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 127/270 (47%), Positives = 178/270 (65%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C IES   A   A  L  I  +L I  +YKSSFDKANRSS A  
Sbjct: 5   DFEVGLDKPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDASF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+++G  I  +++++ G P+LTD+H   + + +A+ VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMEEGLRILSEVRRQVGVPVLTDIHEIDEIKPVAEVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K             + + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARHAARDAGLPEDNFMACERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A+G+AG+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAIAVGVAGVFMETHPDPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + ++ +  LLS L  +D + K
Sbjct: 245 CAKSDGPNAVPLRRMKDLLSVLKELDALTK 274


>gi|124268031|ref|YP_001022035.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylibium
           petroleiphilum PM1]
 gi|158512863|sp|A2SJR1|KDSA_METPP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|124260806|gb|ABM95800.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase [Methylibium
           petroleiphilum PM1]
          Length = 285

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 128/271 (47%), Positives = 180/271 (66%), Gaps = 6/271 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LI+GPC +ES      +A +L  I  +L I  ++KSS+DKANRSS    
Sbjct: 5   GFDVGLDRPFFLISGPCVVESEQLQMDVAGRLKEITAALGIPFIFKSSYDKANRSSGTSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G++KG EI   +++    P+LTDVH+E +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGPGMEKGLEILAKVRRDLQVPVLTDVHSEAEIPVVAQHVDVLQTPAFLCRQTDFIRAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++QK               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPGDMKNVIQKARDAAREKGLPDDVFMACERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  L++AA+A+G+AG+F+ETH DP 
Sbjct: 185 LAIMRETGSPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAIAVGVAGVFMETHPDPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            A SDGPN + +K +  LL QL++ID++IK 
Sbjct: 245 KALSDGPNAVPLKHMKALLEQLVSIDRVIKA 275


>gi|320529929|ref|ZP_08031006.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas artemidis F0399]
 gi|320137947|gb|EFW29852.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas artemidis F0399]
          Length = 277

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 131/265 (49%), Positives = 173/265 (65%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  +  VL+AGPC +E  D + MI   +  I   L I  V+K+SFDKANRS+    
Sbjct: 10  NFEIGGGEPLVLLAGPCVLEGLDRSLMIGRGIKEITDRLGIPYVFKASFDKANRSAFHSF 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GLK+G ++ + +KK+ G P++TD+H   Q    A+ VDILQIPA L RQTDLL AAA
Sbjct: 70  RGPGLKEGLKLLKTIKKELGVPVVTDIHETHQARPAAEVVDILQIPAFLSRQTDLLHAAA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           QT  ++NVKKGQFLSP +M N++ K+H  G++ +L  ERG SFGYN LV DMRS PIM S
Sbjct: 130 QTNAIVNVKKGQFLSPNDMRNVVDKIHESGSEKILLTERGASFGYNNLVVDMRSFPIMRS 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFD +HSVQ PG  G  S G+R+++  L +AAV  G+ G+FLE H +P  A SDG
Sbjct: 190 FGYPVIFDGTHSVQLPGGAGTSSSGQREFVEYLVRAAVGAGVDGLFLEVHDNPPEALSDG 249

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
            NM+ +  L  LL   LAI ++++ 
Sbjct: 250 ANMVYLDKLEDLLKDALAIYEVVRK 274


>gi|83748262|ref|ZP_00945288.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia solanacearum
           UW551]
 gi|207722862|ref|YP_002253296.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-d-manno-octulosonic acid 8-phosphate
           synthetase) (kdo-8-phosphate synthetase) (kdo 8-p
           synthase) (kdops) protein [Ralstonia solanacearum MolK2]
 gi|207743533|ref|YP_002259925.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-d-manno-octulosonic acid 8-phosphate
           synthetase) (kdo-8-phosphate synthetase) (kdo 8-p
           synthase) (kdops) protein [Ralstonia solanacearum
           IPO1609]
 gi|300704503|ref|YP_003746106.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia solanacearum
           CFBP2957]
 gi|83725103|gb|EAP72255.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia solanacearum
           UW551]
 gi|206588046|emb|CAQ18626.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-d-manno-octulosonic acid 8-phosphate
           synthetase) (kdo-8-phosphate synthetase) (kdo 8-p
           synthase) (kdops) protein [Ralstonia solanacearum MolK2]
 gi|206594931|emb|CAQ61858.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-d-manno-octulosonic acid 8-phosphate
           synthetase) (kdo-8-phosphate synthetase) (kdo 8-p
           synthase) (kdops) protein [Ralstonia solanacearum
           IPO1609]
 gi|299072167|emb|CBJ43499.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia solanacearum
           CFBP2957]
          Length = 284

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 127/270 (47%), Positives = 174/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C IES   A   A  L  I  +L I  +YKSSFDKANRSS    
Sbjct: 5   DFEIGLDRPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDTSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G++ G  I  +++++ G P+LTDVH   + + +A+ VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMEAGLRILGEVRRQVGVPVLTDVHEIDEIKPVAEVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARHAARDAGLPEDSFMACERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G+AG+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAIATGVAGVFMETHPDPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + ++ +  LLS L  +D + K
Sbjct: 245 CAKSDGPNAVPLRRMKDLLSVLKELDALTK 274


>gi|261493247|ref|ZP_05989774.1| 3-deoxy-8-phosphooctulonate synthase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261496510|ref|ZP_05992890.1| 3-deoxy-8-phosphooctulonate synthase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261307713|gb|EEY09036.1| 3-deoxy-8-phosphooctulonate synthase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261311097|gb|EEY12273.1| 3-deoxy-8-phosphooctulonate synthase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 284

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 182/280 (65%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            T+  + +G     +  +N + F L  G   +ES D A  + E+   + Q LN+  V+K+
Sbjct: 1   MTDKIVKVG----NIEVANHKPFTLFGGMNVLESRDMALRVCEQYVEVTQKLNVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK+ +G  I+TDVH   QC+ +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKQTFGVNIITDVHEIYQCKPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIAECGNDKVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM     G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 177 LVVDMLGFGIMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGVAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP++A  DGP+ + +  L   +SQ+ AID+++K 
Sbjct: 237 FLEAHPDPNSAKCDGPSALPLSKLEAFVSQMKAIDELVKS 276


>gi|110834024|ref|YP_692883.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alcanivorax borkumensis
           SK2]
 gi|110647135|emb|CAL16611.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alcanivorax borkumensis
           SK2]
          Length = 282

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 120/267 (44%), Positives = 169/267 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N + F+N++   L  G   +ES D A  +AE        LN+  V+K+SFDKANRSSL+ 
Sbjct: 10  NGLEFANDKPMALFGGMNVLESRDLAMQVAEAYAEATSKLNMPWVFKASFDKANRSSLSS 69

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++KK +  P++TDVH   Q   +A+ VDI+Q+PA L RQTDL+ A 
Sbjct: 70  YRGPGMEEGLKIFEEVKKTFNCPLITDVHEPGQAGPVAEVVDIIQLPAFLARQTDLVVAM 129

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 130 AKTGAIINIKKPQFLAPHEMSHILHKCEDAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PV FD +H++Q+PG   + + G R  +  L +A ++ GIAG+FLE H DPDNA  D
Sbjct: 190 QFNYPVFFDVTHALQKPGGRADSADGRRAQVAELGRAGISQGIAGLFLEAHPDPDNAKCD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GP  + +  L   L+Q+ A+D  +K L
Sbjct: 250 GPCALRLDRLEPFLAQMQALDNTVKAL 276


>gi|241662670|ref|YP_002981030.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia pickettii 12D]
 gi|309781226|ref|ZP_07675963.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia sp. 5_7_47FAA]
 gi|240864697|gb|ACS62358.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia pickettii 12D]
 gi|308920047|gb|EFP65707.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia sp. 5_7_47FAA]
          Length = 284

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 128/270 (47%), Positives = 178/270 (65%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C IES   A   A  L  I  +L I  +YKSSFDKANRSS A  
Sbjct: 5   DFEVGLDKPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDASF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+++G  I  +++++ G P+LTD+H   + + +A+ VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMEEGLRILSEVRRQVGVPVLTDIHEIDEIKPVAEVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K             + + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARHAARDAGLPEDNFMACERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A+GIAG+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAIAVGIAGVFMETHPDPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + ++ +  LLS L  +D + K
Sbjct: 245 CAKSDGPNAVPLRRMKDLLSVLKELDALTK 274


>gi|27363730|ref|NP_759258.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio vulnificus CMCP6]
 gi|161486643|ref|NP_933728.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio vulnificus YJ016]
 gi|29611750|sp|Q8DFG3|KDSA_VIBVU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|44888082|sp|Q7MMY2|KDSA_VIBVY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|27359846|gb|AAO08785.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio vulnificus CMCP6]
          Length = 284

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 123/281 (43%), Positives = 175/281 (62%), Gaps = 6/281 (2%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +     + +G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K
Sbjct: 1   MMEQKIVQIGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+P
Sbjct: 57  ASFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G   ++ CERG+  GY+
Sbjct: 117 AFLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKIILCERGSCHGYD 176

Query: 202 TLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
            LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG
Sbjct: 177 NLVVDMLGFGVMKKASKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAG 236

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +F+E H +PD A  DGP+ + +  L   L+Q+ A+D ++K 
Sbjct: 237 LFIEAHPNPDQARCDGPSALPLDKLEPFLAQMKALDDLVKS 277


>gi|146280238|ref|YP_001170395.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145558479|gb|ABP73090.1| hypothetical protein Rsph17025_4240 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 278

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 138/278 (49%), Positives = 194/278 (69%), Gaps = 4/278 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           T + + +G    ++         LI GPCQ+ES +HA M+A ++   C       ++K+S
Sbjct: 4   TPSIVTIG----EIVLGGAHPIALITGPCQLESLEHARMMAGRISEACAPTGTKFIFKAS 59

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           +DKANRSSL   RG+G++KG EI   ++ ++G P+LTDVH   QC   A+  D+LQIPA 
Sbjct: 60  YDKANRSSLGTARGLGMEKGLEILGAIRDEFGVPVLTDVHEPWQCAKAAEVCDVLQIPAF 119

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AA +TG+ +N+KKGQFL+PW+M N+  K+ + G + +L CERGTSFGYNTL
Sbjct: 120 LCRQTDLLLAAGETGKAVNIKKGQFLAPWDMGNVAAKVASTGNRKILLCERGTSFGYNTL 179

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           VTD R +P M + G PV+FDA+HSVQQPG  G  SGG+R++   LA+AA A+G++ +F+E
Sbjct: 180 VTDFRGLPTMAATGWPVVFDATHSVQQPGGLGGSSGGQREFAPVLARAACAVGVSALFIE 239

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           TH+DPD APSDGPNMI +  + +L+++L A D + K L
Sbjct: 240 THEDPDRAPSDGPNMIPVDRMGRLIAELRAFDALAKSL 277


>gi|313895179|ref|ZP_07828736.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312976074|gb|EFR41532.1| 3-deoxy-8-phosphooctulonate synthase [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 275

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 130/265 (49%), Positives = 172/265 (64%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                  +  VL+AGPC +E  D + MI   +  I   L I  V+K+SFDKANRS+    
Sbjct: 8   NFEIGGGEPLVLLAGPCVLEGLDRSLMIGRGIKEITDRLGIPYVFKASFDKANRSAFHSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL +G ++ + +KK+ G P++TD+H   Q    A+ VDILQIPA L RQTDLL AAA
Sbjct: 68  RGPGLIEGLKLLKTIKKELGVPVVTDIHETHQARPAAEVVDILQIPAFLSRQTDLLHAAA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           QT  ++NVKKGQFLSP +M N++ K+H  G++ +L  ERG SFGYN LV DMRS PIM S
Sbjct: 128 QTNAIVNVKKGQFLSPNDMRNVVDKIHESGSEKILLTERGASFGYNNLVVDMRSFPIMRS 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFD +HSVQ PG  G  S G+R+++  L +AAV  G+ G+FLE H +P  A SDG
Sbjct: 188 FGYPVIFDGTHSVQLPGGAGTSSSGQREFVEYLVRAAVGAGVDGLFLEVHDNPPEALSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
            NM+ +  L  LL   LAI ++++ 
Sbjct: 248 ANMVYLDKLEDLLKDALAIYEVVRK 272


>gi|15892013|ref|NP_359727.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia conorii str.
           Malish 7]
 gi|20532118|sp|Q92JH7|KDSA_RICCN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|15619129|gb|AAL02628.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia conorii str.
           Malish 7]
          Length = 274

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 156/266 (58%), Positives = 196/266 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLI GPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG++KG EI   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGVGIEKGLEILSKVKSEFDCPIVTDVHSESQCTETAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  +GGER+Y+  LAKAA ++GIAGI++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLAKAATSVGIAGIYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP M+ + +L  +L +L   DKI K 
Sbjct: 248 GPCMMKLDNLESILIKLKKYDKITKE 273


>gi|330959217|gb|EGH59477.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 281

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 116/266 (43%), Positives = 169/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEVANDKPMVLFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKASFDKANRSSVTS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEKGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +IN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN LV DM    IM 
Sbjct: 129 AKTGAIINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNNLVVDMLGFGIMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FLE H DPDNA  D
Sbjct: 189 QFEYPILFDVTHALQMPGGRADSAGGRRAQVLDLAKAGISQNLAGLFLEAHPDPDNAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL ++D+++K 
Sbjct: 249 GPCALRLDKLEPFLAQLKSLDELVKS 274


>gi|209694376|ref|YP_002262304.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aliivibrio salmonicida
           LFI1238]
 gi|226761652|sp|B6EHH9|KDSA_ALISL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|208008327|emb|CAQ78479.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aliivibrio salmonicida
           LFI1238]
          Length = 284

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 121/281 (43%), Positives = 172/281 (61%), Gaps = 6/281 (2%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +     + +G     +  +N++ F L AG   +ES D A  + E    I   L I  V+K
Sbjct: 1   MQNQKTVKIG----NIDVANDKPFTLFAGMNVLESRDLAMRMCETYVEITDRLGIPYVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS+   RG G+++G +IF++LK  +G  I+TD+HTE Q + +AD VD++Q+P
Sbjct: 57  ASFDKANRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDIHTEAQAQPVADVVDVIQLP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+   A+TG VINVKK QF+SP ++ NI+ K    G ++++ CERG+  GY+
Sbjct: 117 AFLARQTDLVETMARTGAVINVKKPQFMSPDQVGNIVDKFAECGNENIILCERGSCMGYD 176

Query: 202 TLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
            LV DM    +M     G P+IFD +HS+Q     G  SGG R   V LAKA +A GIAG
Sbjct: 177 NLVVDMLGFGVMKKVSNGSPIIFDVTHSLQNRDPSGKASGGRRSQTVELAKAGLATGIAG 236

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +F+E H  PD A  DGP+ + +  L   L Q+ A+D +IK 
Sbjct: 237 LFIEAHPTPDKALCDGPSALPLDQLEPFLKQMKALDDLIKG 277


>gi|145298196|ref|YP_001141037.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142850968|gb|ABO89289.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8- phosphate synthase
           [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 284

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 119/268 (44%), Positives = 171/268 (63%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +  +N++ FVL  G   +ES D A  + EK   +   L I  V+K+S+DKANRSS+  
Sbjct: 9   NDIDVANDKPFVLFGGMNVLESRDMAMAVCEKYVEVTSKLGIPFVFKASWDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF++LK  +G P+++D+H   Q + +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMKIFQELKATFGMPVISDLHEVHQAKPVAEVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFLSP +M NI  K    G   ++ CERG +FGY+ LV DM  + +M 
Sbjct: 129 ARTGNVINIKKPQFLSPSQMKNITDKFEECGNDQLILCERGANFGYDNLVVDMLGLGVMK 188

Query: 215 SM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G PVIFD +HS+Q     G  SGG R  +  LA+A +A+G+AG+F+E+H DP  A 
Sbjct: 189 KSTGGYPVIFDVTHSLQCRDPLGAASGGRRDQVTELARAGMAVGLAGLFIESHPDPKVAR 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L Q+ AID +IK 
Sbjct: 249 CDGPSALPLDKLEGFLKQMKAIDDLIKG 276


>gi|42523712|ref|NP_969092.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Bdellovibrio
           bacteriovorus HD100]
 gi|48428281|sp|P61653|KDSA_BDEBA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|39575919|emb|CAE80085.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bdellovibrio bacteriovorus HD100]
          Length = 288

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 119/280 (42%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL AG   +ES D A  + E    +   L I  V+KS
Sbjct: 5   MQNKIVKIG----NIEVANDKPFVLFAGLNVLESRDLAMQVCEHFVKVTDKLKIPYVFKS 60

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF +LKK +G  ++TDVH   Q + +A+ VD++Q+PA
Sbjct: 61  SFDKANRSSIHSYRGPGMEEGLKIFAELKKTFGVKVITDVHEIHQAKPVAEVVDVIQLPA 120

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI+ K    G   ++ C+RGT+FGY+ 
Sbjct: 121 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVDKFAECGNDKIILCDRGTNFGYDN 180

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV D     IM     G PVI DA+H++Q     G  SGG R  +  L++A +A+G+AG+
Sbjct: 181 LVVDTLGFNIMKKVSKGSPVILDATHALQCRDPFGAASGGRRGQVAELSRAGLAVGLAGL 240

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E+H +PD A  DGP+ + +  +   L Q+ A+D ++K 
Sbjct: 241 FIESHPNPDKALCDGPSALPLSKVEPFLQQMKALDDLVKS 280


>gi|260583300|ref|ZP_05851075.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus influenzae NT127]
 gi|260093660|gb|EEW77573.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus influenzae NT127]
          Length = 284

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             +  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQSKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|146311979|ref|YP_001177053.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Enterobacter sp. 638]
 gi|166987632|sp|A4WBC2|KDSA_ENT38 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|145318855|gb|ABP61002.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Enterobacter sp. 638]
          Length = 284

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 119/280 (42%), Positives = 170/280 (60%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSINSYRGPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   ++ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDQIILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  S G R  +  LA+A +A GIAG+
Sbjct: 177 LVVDMLGFSVMKKVSNNSPVIFDVTHALQCRDPFGAASSGRRGQVTELARAGMATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP NA  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPANAKCDGPSALPLDKLEPFLKQIKAIDDLVKS 276


>gi|81301098|ref|YP_401306.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus elongatus
           PCC 7942]
 gi|123769197|sp|Q31KV0|KDSA_SYNE7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|81169979|gb|ABB58319.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus elongatus
           PCC 7942]
          Length = 284

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 131/264 (49%), Positives = 181/264 (68%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           ++ +  +     L  GPC IE  D +  +AE +  +C  L +  V+KSSFDKANR+S+  
Sbjct: 13  DRFSIGDGCPLTLFGGPCVIEGEDFSLKMAESIAKVCDRLGVQFVFKSSFDKANRTSIGS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  I   +K + G P+LTD+H  QQ   +A+ VDILQIPA LCRQTDLL AA
Sbjct: 73  FRGYGLEEGLRILERVKTELGLPVLTDIHESQQAATVAEVVDILQIPAFLCRQTDLLLAA 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A TGR +NVKK QFL+PW+M N++ KL   GA+++L  ERG+ FGYN LV D RS+P+M 
Sbjct: 133 AATGRTVNVKKAQFLAPWDMKNVVNKLRQGGAENLLLTERGSCFGYNALVVDFRSLPLMR 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            +G PV+FDA+HSVQ PG  G+ S G+R+++  LA+AA A+GI  +F+E H++PD A SD
Sbjct: 193 ELGCPVVFDATHSVQIPGGAGDRSSGQREFVPVLARAAAAVGIDALFMEIHENPDQALSD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKII 298
           GPNMI + DL   L Q+L + + +
Sbjct: 253 GPNMIRLADLEATLRQILRVREAV 276


>gi|168701695|ref|ZP_02733972.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gemmata obscuriglobus
           UQM 2246]
          Length = 282

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 130/276 (47%), Positives = 172/276 (62%), Gaps = 4/276 (1%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +    A+ +G              + I GPC IESHD    IAE L +    L + LV+K
Sbjct: 1   MEPQRAVTVGPY----RVGGGGPLLWICGPCVIESHDLTLRIAETLKSYADRLGLQLVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS    RG GL++G +    +K   G P+ TD+H   Q    A+  DILQ+P
Sbjct: 57  ASFDKANRSSGKSFRGPGLQEGLKTLAAVKDATGLPVTTDIHECAQAATAAEVCDILQVP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDLL A  +TGRV+NVKKGQF++PW+M N++ KL   G  +VL  ERGT+FGY 
Sbjct: 117 AFLARQTDLLEACGRTGRVVNVKKGQFMAPWDMKNVVAKLSEFGTGNVLLTERGTTFGYG 176

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
            LV DMRS+P M   G PVIFD +HSVQ+PG  G+ +GG+R  +  + +AAVA G  G+F
Sbjct: 177 MLVNDMRSVPWMQETGAPVIFDGTHSVQKPGALGDRTGGDRAMVPVVTRAAVAAGCDGVF 236

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKI 297
           LETH  PD A SDGPNMI +  LP+++++ + I   
Sbjct: 237 LETHPRPDEAKSDGPNMIPLDVLPRVIAECVRIRAA 272


>gi|320103578|ref|YP_004179169.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Isosphaera pallida ATCC
           43644]
 gi|319750860|gb|ADV62620.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Isosphaera pallida ATCC
           43644]
          Length = 303

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 135/280 (48%), Positives = 186/280 (66%)

Query: 18  KNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIG 77
             H+    A +    G + V     +  VLIAGPC +E  D +  IA +L  I  +L + 
Sbjct: 22  PPHVPRDPARVGGFGGSSIVEIGRGRGLVLIAGPCVMEPGDLSRRIAGRLAEIGDALKVP 81

Query: 78  LVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDI 137
           L++K+SFDKANR+S +  RG+G+ +G +IF  +K + G P+ TD+H   Q   +A  VD+
Sbjct: 82  LIFKASFDKANRTSRSSYRGIGIDEGLKIFERIKAQTGLPVTTDIHESHQAATVAQVVDL 141

Query: 138 LQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTS 197
           LQIPA L RQTDLL AAA TGR +NVKKGQF++PW+M +++ KL A GA+D+L  ERGT+
Sbjct: 142 LQIPAFLARQTDLLEAAAATGRAVNVKKGQFMAPWDMTHVVGKLTAAGARDLLLTERGTT 201

Query: 198 FGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGI 257
           FGY  LV D R++PIM + G PV+FDA+HSVQ P      + GER+ + PLA+AAVA+G+
Sbjct: 202 FGYGRLVNDFRALPIMRATGAPVVFDATHSVQLPSAGAGVTQGEREMVPPLARAAVAVGV 261

Query: 258 AGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKI 297
             +FLE H DPD+A SDGPN + + DLP+LL   LA+   
Sbjct: 262 DALFLEVHPDPDHALSDGPNALKLDDLPELLKVCLALRAA 301


>gi|331006067|ref|ZP_08329403.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [gamma
           proteobacterium IMCC1989]
 gi|330420104|gb|EGG94434.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [gamma
           proteobacterium IMCC1989]
          Length = 286

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 116/280 (41%), Positives = 168/280 (60%), Gaps = 2/280 (0%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
            + +  +    N +  SN+  F L  G   +ES D A  +AE      + L+I  V+K+S
Sbjct: 1   MSTSASVVLSVNDIYVSNDLPFTLFGGMNVLESRDLAMTVAEAYVKATEKLHIPYVFKAS 60

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG GL +G +IF ++K  +  P++TDVH   Q + +A+  DI+Q+PA 
Sbjct: 61  FDKANRSSIHSYRGPGLDEGLKIFEEVKATFNVPVITDVHEVDQAKPVAEVCDIIQLPAF 120

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A A+T  +IN+KK QFLS  +M NI+ K    G + ++ CERG+ FGY+ L
Sbjct: 121 LARQTDLVEAMAKTNAIINIKKPQFLSAAQMKNIVDKFRECGNEKIMLCERGSCFGYDNL 180

Query: 204 VTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           V D      M     G P+IFD +H++Q     G  SGG R  +  L +A +A+G+AG+F
Sbjct: 181 VVDTLGFRTMKEVSNGAPLIFDVTHALQCRDPMGAASGGRRHQVAELGRAGLAVGLAGLF 240

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           LE H DPDNA  DGP+ + +  L   L+Q+ A+D +IK L
Sbjct: 241 LEAHPDPDNAKCDGPSALPLDKLEPFLAQMKAVDDVIKSL 280


>gi|304312486|ref|YP_003812084.1| 2-dehydro-3-deoxyphosphooctonate aldolase [gamma proteobacterium
           HdN1]
 gi|301798219|emb|CBL46441.1| 2-dehydro-3-deoxyphosphooctonate aldolase [gamma proteobacterium
           HdN1]
          Length = 283

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 117/265 (44%), Positives = 161/265 (60%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +   NE  FVL  G   +ES D A  + E    + + L I  V+K+SFDKANRSS+  
Sbjct: 11  GNIRIGNELPFVLFGGMNVLESRDLAMQVCEHYVRVTEKLGIPYVFKASFDKANRSSMHS 70

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL  G +IF ++KK +  P++TDVH   Q  A+A+  DI+Q+PA L RQTDL+ A 
Sbjct: 71  FRGPGLDAGLKIFEEIKKTFKVPVITDVHEPHQAAAVAEVADIIQLPAFLSRQTDLVVAM 130

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KK QFL+P EM +I+ K    G   ++ CERG+ FGYN LV DM    IM 
Sbjct: 131 ARTNAIINIKKAQFLAPQEMKHIINKCEEAGNHKLILCERGSCFGYNNLVVDMLGFGIMK 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV FD +H++Q PG   + +GG R  +  LA+A ++ G+AG+FLE H DPD A  D
Sbjct: 191 QFGYPVFFDVTHALQMPGGRADSAGGRRAQVTELARAGISQGLAGLFLEAHPDPDKAMCD 250

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GP  + +  L   L QL  +D ++K
Sbjct: 251 GPCALRLDRLEPFLDQLKQMDTLVK 275


>gi|238028003|ref|YP_002912234.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia glumae
           BGR1]
 gi|237877197|gb|ACR29530.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia glumae
           BGR1]
          Length = 284

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 124/271 (45%), Positives = 173/271 (63%), Gaps = 6/271 (2%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
                  ++   LIAG C +ES       A +L  IC  L +  +YKSS+DKANRSS   
Sbjct: 4   GDFEVGLDRPLFLIAGTCVVESEQMTIDTAGRLKEICAKLKVPFIYKSSYDKANRSSGKS 63

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG+G+ +G  I  ++K++ G P+LTDVH  ++ +A+A  VD+LQ PA LCRQTD + A 
Sbjct: 64  FRGLGMDQGLRILSEVKRQLGLPVLTDVHAIEEIDAVASVVDVLQTPAFLCRQTDFIQAC 123

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMR 208
           A++G+ +N+KKGQFL+P +M N++ K               L CERG SFGYN LV+DMR
Sbjct: 124 ARSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFLACERGVSFGYNNLVSDMR 183

Query: 209 SIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP 268
           S+ IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P
Sbjct: 184 SLAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNP 243

Query: 269 DNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
             A SDGPN + +  +  LL  L+ +D  +K
Sbjct: 244 AEAKSDGPNAVPLNRMAALLETLVMLDAAVK 274


>gi|301156078|emb|CBW15549.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Haemophilus
           parainfluenzae T3T1]
          Length = 284

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 118/280 (42%), Positives = 178/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  ++K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYIFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF+++K+ +G  ++TDVH   QC+ +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQEIKETFGVKVITDVHEIYQCQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI+ K    G   ++ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPGQMGNIVDKFEECGNDKIILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +HS+Q     G  SGG R+ +  LA++ +AIGIAG+
Sbjct: 177 LVVDMLGFGVMKKVSKGSPIIFDVTHSLQCRDPFGAASGGRREQVTELARSGLAIGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|117620000|ref|YP_857645.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561407|gb|ABK38355.1| 3-deoxy-8-phosphooctulonate synthase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 284

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 119/268 (44%), Positives = 173/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +  +N++ FVL  G   +ES D A  + EK   +   L I  V+K+S+DKANRSS+  
Sbjct: 9   NGIDVANDKPFVLFGGMNVLESRDMAMAVCEKYVEVTSKLGIPFVFKASWDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF++LK  +G P+++D+H   Q + +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMKIFQELKATFGMPVISDLHEPHQAKPVAEVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFLSP +M NI  K    G   ++ CERG +FGY+ LV DM  + +M 
Sbjct: 129 ARTGNVINIKKPQFLSPSQMKNITDKFEECGNDRLILCERGANFGYDNLVVDMLGLGVMK 188

Query: 215 SM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G PVIFD +HS+Q     G  SGG R+ +  LA+A +A+G+AG+F+E+H DP  A 
Sbjct: 189 KSTGGYPVIFDVTHSLQCRDPMGAASGGRREQVTELARAGMAVGLAGLFIESHPDPKIAR 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + ++ L   L Q+ AID +IK 
Sbjct: 249 CDGPSALPLEKLEGFLKQMKAIDDLIKG 276


>gi|254476972|ref|ZP_05090358.1| 3-deoxy-8-phosphooctulonate synthase [Ruegeria sp. R11]
 gi|214031215|gb|EEB72050.1| 3-deoxy-8-phosphooctulonate synthase [Ruegeria sp. R11]
          Length = 277

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 140/265 (52%), Positives = 183/265 (69%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T  N+    LIAGPCQ+ES DHA M+A KL   C       V+K SFDKANR+SL  K
Sbjct: 8   DLTIGNDCPLTLIAGPCQLESADHAQMVAGKLKEACDKAGAQFVFKGSFDKANRTSLNAK 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
             +GL +G ++   +KK+ G P++TD+H ++QCE +A  VDI+QIPA LCRQT LL AA 
Sbjct: 68  PALGLDEGLKVLDSVKKQIGVPVITDIHEKEQCEPVAAVVDIMQIPAFLCRQTALLLAAG 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG  INVKKGQFL+PW+M N++ K+ + G   +L  ERG SFGYN LV DM+S+P M  
Sbjct: 128 KTGAAINVKKGQFLAPWDMPNVVTKIESTGNDRILLTERGVSFGYNRLVVDMQSLPEMAR 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+ DA+H+V QPG  G  SGG+R++   LA+AAVA GIA +F ETH+DPDNAP DG
Sbjct: 188 TGYPVVMDATHAVAQPGGLGGASGGQREFAPVLARAAVATGIAAVFTETHEDPDNAPCDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNMI +  +PKL+  L+  D + K 
Sbjct: 248 PNMIYLDQMPKLIETLMRFDALAKA 272


>gi|315179420|gb|ADT86334.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) (KDOPS) [Vibrio furnissii NCTC 11218]
          Length = 283

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 124/280 (44%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +H+G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+
Sbjct: 1   MEQKIVHVGD----IPVANDKPFTLFAGMNVLESRDMAMQICEHYVKVTDKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG V+NVKK QF+SP ++ NI++K    G + V+ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVVNVKKPQFMSPGQVGNIVEKFAECGNEKVILCERGSCHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L+Q+ A+D ++K 
Sbjct: 237 FIEAHPNPDQARCDGPSALPLDKLEPFLAQMKALDDLVKS 276


>gi|271500561|ref|YP_003333586.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dickeya dadantii Ech586]
 gi|270344116|gb|ACZ76881.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dickeya dadantii Ech586]
          Length = 284

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 120/279 (43%), Positives = 176/279 (63%), Gaps = 6/279 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  +++GS    +   N   FVL  G   +ES + A  I E    + Q L I  V+K+
Sbjct: 1   MNNKVVNIGS----IPVGNHLPFVLFGGMNVLESRELAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVH  QQ + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKDTFGVKIITDVHEPQQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VIN+KK QF+SP ++ NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINIKKPQFISPGQVGNIVDKFREGGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMKQVSHGAPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+E H +P++A  DGP+ + +  L   L Q+ AID+++K
Sbjct: 237 FIEAHPEPNSARCDGPSALPLDKLEPFLQQMKAIDELVK 275


>gi|329890013|ref|ZP_08268356.1| 3-deoxy-8-phosphooctulonate synthase [Brevundimonas diminuta ATCC
           11568]
 gi|328845314|gb|EGF94878.1| 3-deoxy-8-phosphooctulonate synthase [Brevundimonas diminuta ATCC
           11568]
          Length = 300

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 147/287 (51%), Positives = 201/287 (70%), Gaps = 1/287 (0%)

Query: 16  IDKNHMIHTNAAIHLGSG-KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSL 74
           ++   +   NA I L  G K  V      R V IAGPCQ++S  HA   A  L  I + L
Sbjct: 4   VESAAVTSPNAVITLSEGLKTPVVIGGGARIVFIAGPCQMQSRQHALETAHALKEIGERL 63

Query: 75  NIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADS 134
           N+G++YK+SFDKANR+S +  RG+GLK    IF ++++  G P LTDVH+E QC  + + 
Sbjct: 64  NLGIIYKTSFDKANRTSASAARGIGLKDALPIFAEIREVTGLPTLTDVHSEAQCGPVGEY 123

Query: 135 VDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCER 194
           VD+LQIPA L RQTDLL AAA TG+ IN+KKGQFL+PW+M N++ K+   G  +V+ CER
Sbjct: 124 VDVLQIPAFLSRQTDLLLAAAATGKAINIKKGQFLAPWDMKNVIAKVTGAGNPNVMACER 183

Query: 195 GTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVA 254
           G SFGYNTLV+DMR++PI+  +G PV+FDA+HSVQQPG  G  SGG+R+++  LA+AAV+
Sbjct: 184 GASFGYNTLVSDMRALPILREIGCPVVFDATHSVQQPGGQGTSSGGQREFVPVLARAAVS 243

Query: 255 IGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           +G+  +F+ETH+DPDNAPSDGPNM+ +     L ++L+A D +   L
Sbjct: 244 VGVDAVFMETHEDPDNAPSDGPNMVPLSQFEALAAELIAFDDLAIKL 290


>gi|253688496|ref|YP_003017686.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|259494405|sp|C6DHX7|KDSA_PECCP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|251755074|gb|ACT13150.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 284

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 125/279 (44%), Positives = 175/279 (62%), Gaps = 6/279 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            TN  + +G     +  +N+  FVL  G   +ES D A  I E    I Q L+I  V+K+
Sbjct: 1   MTNKVVKIGD----IPVANDLPFVLFGGMNVLESRDLAMRICEHYVTITQKLSIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEAHQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +H++Q     G  S G R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFNVMKQVSKGSPVIFDVTHALQCRDPFGAASSGRRGQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+E H DP NA  DGP+ + +  L   L Q+ AID ++K
Sbjct: 237 FIEAHPDPANAKCDGPSALPLDKLEPFLQQIKAIDDLVK 275


>gi|145589129|ref|YP_001155726.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047535|gb|ABP34162.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 287

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 137/270 (50%), Positives = 180/270 (66%), Gaps = 5/270 (1%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 + RF LIAGPC IES   A  IA +L  I  +L I  +YKSSFDKANRSS    
Sbjct: 8   GFDVGLDHRFFLIAGPCVIESEQSAIDIAGELKEITSALKIPFIYKSSFDKANRSSGTSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G++KG EI   +KK+ G P+LTDVH   +  A+A  VD+LQ PA LCRQTD + A A
Sbjct: 68  RGLGMEKGLEILAKVKKEVGVPVLTDVHDIGEIAAVAKVVDVLQTPAFLCRQTDFIRACA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHG-----AKDVLFCERGTSFGYNTLVTDMRSI 210
           Q+G+ +N KKGQFLSP EM N+++K          +   + CERG SFGYN LV+DMRS+
Sbjct: 128 QSGKPVNFKKGQFLSPHEMLNVIEKARGAAAEMGLSDQFMVCERGASFGYNNLVSDMRSL 187

Query: 211 PIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDN 270
            I+     PV+FDA+HSVQ PG  GN SGG+R+++  LA+AAVA+GI+G+F+ETH DP  
Sbjct: 188 AILRESKAPVVFDATHSVQLPGGQGNSSGGQREFVPVLARAAVAVGISGLFMETHPDPAK 247

Query: 271 APSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           A SDGPN + +  + +LL  L+ ID ++K 
Sbjct: 248 ALSDGPNAVPLNRMKELLQSLVDIDSVVKA 277


>gi|330828706|ref|YP_004391658.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aeromonas veronii B565]
 gi|328803842|gb|AEB49041.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aeromonas veronii B565]
          Length = 284

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 120/268 (44%), Positives = 174/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           NQ+  +N++ FVL  G   +ES D A  + EK   +   L I  V+K+S+DKANRSS+  
Sbjct: 9   NQIDVANDKPFVLFGGMNVLESRDMAMAVCEKYVEVTSKLGIPFVFKASWDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF++LK  +G P+++D+H   Q + +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMKIFQELKATFGMPVISDLHEPHQAKPVAEVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFLSP +M NI  K    G   ++ CERG +FGY+ LV DM  + +M 
Sbjct: 129 ARTGNVINIKKPQFLSPSQMKNITDKFEECGNDQLILCERGANFGYDNLVVDMLGLGVMK 188

Query: 215 SM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G PVIFD +HS+Q     G  SGG R+ +  LA+A +A+G+AG+F+E+H DP  A 
Sbjct: 189 KSTGGYPVIFDVTHSLQCRDPLGAASGGRREQVTELARAGMAVGLAGLFIESHPDPKIAR 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + ++ L   L Q+ AID +IK 
Sbjct: 249 CDGPSALPLEKLEGFLKQMKAIDDLIKG 276


>gi|325578171|ref|ZP_08148306.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159907|gb|EGC72036.1| 3-deoxy-8-phosphooctulonate synthase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 284

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 178/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF+++K+ +G  ++TDVH   QC+ +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQEIKETFGVKVITDVHEIYQCQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI+ K    G   ++ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPGQMGNIVDKFEECGNDKIILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +HS+Q     G  SGG R+ +  LA++ +AIGIAG+
Sbjct: 177 LVVDMLGFGVMKKVSKGSPVIFDVTHSLQCRDPFGAASGGRREQVTELARSGLAIGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|149192363|ref|ZP_01870566.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio shilonii AK1]
 gi|148833802|gb|EDL50836.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio shilonii AK1]
          Length = 283

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 122/270 (45%), Positives = 171/270 (63%), Gaps = 2/270 (0%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
               +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKANRSS+
Sbjct: 7   DVGDIPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKANRSSV 66

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG GL++G +IF++LK  +G  I+TDVHTE+Q + +AD VD++Q+PA L RQTDL+ 
Sbjct: 67  HSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEEQAQPVADVVDVIQLPAFLARQTDLVE 126

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           A A+T  VINVKK QF+SP ++ NI+ K    G   ++ CERG+  GY+ LV DM    +
Sbjct: 127 AMAKTNAVINVKKPQFMSPGQVGNIVDKFAECGNDKIILCERGSCHGYDNLVVDMLGFGV 186

Query: 213 MTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDN 270
           M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H +PD 
Sbjct: 187 MKKASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAHPNPDK 246

Query: 271 APSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           A  DGP+ + +  L   L+Q+ A+D +IK 
Sbjct: 247 ALCDGPSALPLDKLEPFLAQMKALDDLIKG 276


>gi|160900538|ref|YP_001566120.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Delftia acidovorans
           SPH-1]
 gi|238687163|sp|A9BN40|KDSA_DELAS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|160366122|gb|ABX37735.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Delftia acidovorans
           SPH-1]
          Length = 285

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 134/271 (49%), Positives = 177/271 (65%), Gaps = 6/271 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++RF LIAGPC +ES      +A  L  I  +L I  ++KSS+DKANRSS A  
Sbjct: 5   GFDVGLDRRFFLIAGPCVVESEQLQMDVAGHLKEITAALGIHFIFKSSYDKANRSSGASF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+ KG EI   +KK    PILTDVHTE +  A++  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGPGMDKGLEILAKVKKDLQVPILTDVHTESEIPAVSQVVDVLQTPAFLCRQTDFIRAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+GR +N+KKGQFL+P +M N++ K  A            + CERG SFGYN LV+DMRS
Sbjct: 125 QSGRPVNIKKGQFLAPHDMKNVIDKARAAAKEAGLPEDSFMACERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG +G  SGG R+ +  L++AAVA+G+AG+F+ETH +P 
Sbjct: 185 LSIMRETGAPVVFDATHSVQLPGGNGTSSGGMREMVPVLSRAAVAVGVAGLFMETHPNPP 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            A SDGPN + +K +  LL  L+A+D + K 
Sbjct: 245 CALSDGPNAVPLKHMKALLETLVALDDVTKK 275


>gi|251789680|ref|YP_003004401.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dickeya zeae Ech1591]
 gi|247538301|gb|ACT06922.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dickeya zeae Ech1591]
          Length = 284

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 119/280 (42%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  +++G+    +  +N   FVL  G   +ES + A  I E    + Q L I  V+K+
Sbjct: 1   MNNKVVNIGT----IPVANHLPFVLFGGMNVLESREMAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH  QQ +++++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQSFGVKIITDVHEPQQAQSVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VIN+KK QF+SP ++ NI+ K    G + V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINIKKPQFISPGQVGNIVDKFREGGNEQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMKQVSHGAPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID+++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLQQMKAIDELVKS 276


>gi|170768308|ref|ZP_02902761.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia albertii TW07627]
 gi|170123074|gb|EDS92005.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia albertii TW07627]
          Length = 284

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQVGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSVMKKVSGNAPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DPD+A  DGP+ + +  L   L Q+ AID+++K 
Sbjct: 237 FIEAHPDPDHAKCDGPSALPLAKLEPFLKQMKAIDELVKG 276


>gi|300691893|ref|YP_003752888.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia solanacearum PSI07]
 gi|299078953|emb|CBJ51613.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia solanacearum PSI07]
          Length = 284

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 127/270 (47%), Positives = 174/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C IES   A   A  L  I  +L I  +YKSSFDKANRSS A  
Sbjct: 5   DFEIGLDRPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDASF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  +++++ G P+LTDVH   + + +A+ VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILGEVRRQVGVPVLTDVHEIDEIKPVAEVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARHAARDAGLPEDSFMACERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G++G+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAIATGVSGVFMETHPDPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LLS L  +D + K
Sbjct: 245 CAKSDGPNAVPLHRMKDLLSVLKELDALTK 274


>gi|167563334|ref|ZP_02356250.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           oklahomensis EO147]
          Length = 284

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 123/270 (45%), Positives = 172/270 (63%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC  L +  +YKSS+DKANRSS    
Sbjct: 5   GFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLGVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  +++++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILAEVRRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               L CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAARDAGLSEDRFLACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 DARSDGPNAVPLGRMAALLETLVTLDRAVK 274


>gi|53719881|ref|YP_108867.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei K96243]
 gi|53723785|ref|YP_103310.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia mallei ATCC
           23344]
 gi|67642982|ref|ZP_00441732.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei GB8 horse
           4]
 gi|76808886|ref|YP_334098.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 1710b]
 gi|121600604|ref|YP_993506.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia mallei
           SAVP1]
 gi|124384399|ref|YP_001029065.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia mallei NCTC
           10229]
 gi|126450864|ref|YP_001081014.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia mallei NCTC
           10247]
 gi|126453670|ref|YP_001066885.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 1106a]
 gi|167001758|ref|ZP_02267550.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei PRL-20]
 gi|167816536|ref|ZP_02448216.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 91]
 gi|167824932|ref|ZP_02456403.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 9]
 gi|167846448|ref|ZP_02471956.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei B7210]
 gi|167895026|ref|ZP_02482428.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 7894]
 gi|167903410|ref|ZP_02490615.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei NCTC 13177]
 gi|167911663|ref|ZP_02498754.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 112]
 gi|167919662|ref|ZP_02506753.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei BCC215]
 gi|217420970|ref|ZP_03452475.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           576]
 gi|226198911|ref|ZP_03794474.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           Pakistan 9]
 gi|242315483|ref|ZP_04814499.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1106b]
 gi|254178580|ref|ZP_04885235.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei ATCC
           10399]
 gi|254184385|ref|ZP_04890975.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1655]
 gi|254191418|ref|ZP_04897922.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254195748|ref|ZP_04902174.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           S13]
 gi|254200265|ref|ZP_04906631.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei FMH]
 gi|254209343|ref|ZP_04915689.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei JHU]
 gi|254260587|ref|ZP_04951641.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1710a]
 gi|254297050|ref|ZP_04964503.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           406e]
 gi|254357987|ref|ZP_04974260.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei
           2002721280]
 gi|59798164|sp|Q62J09|KDSA_BURMA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|59798455|sp|Q63SP9|KDSA1_BURPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase 1; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase 1; AltName: Full=KDO-8-phosphate synthase 1;
           Short=KDO 8-P synthase 1; Short=KDOPS 1; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase 1
 gi|166199027|sp|A3ML78|KDSA_BURM7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166199028|sp|A2SAU6|KDSA_BURM9 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166199029|sp|A1V5K3|KDSA_BURMS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|52210295|emb|CAH36274.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei K96243]
 gi|52427208|gb|AAU47801.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei ATCC
           23344]
 gi|76578339|gb|ABA47814.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1710b]
 gi|121229414|gb|ABM51932.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei SAVP1]
 gi|124292419|gb|ABN01688.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei NCTC
           10229]
 gi|126227312|gb|ABN90852.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1106a]
 gi|126243734|gb|ABO06827.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei NCTC
           10247]
 gi|147749861|gb|EDK56935.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei FMH]
 gi|147750116|gb|EDK57187.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei JHU]
 gi|148027114|gb|EDK85135.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei
           2002721280]
 gi|157807474|gb|EDO84644.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           406e]
 gi|157939090|gb|EDO94760.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160699619|gb|EDP89589.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei ATCC
           10399]
 gi|169652493|gb|EDS85186.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           S13]
 gi|184214916|gb|EDU11959.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1655]
 gi|217396382|gb|EEC36399.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           576]
 gi|225929011|gb|EEH25035.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           Pakistan 9]
 gi|238524214|gb|EEP87648.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei GB8 horse
           4]
 gi|242138722|gb|EES25124.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1106b]
 gi|243062452|gb|EES44638.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia mallei PRL-20]
 gi|254219276|gb|EET08660.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1710a]
          Length = 284

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 122/270 (45%), Positives = 172/270 (63%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC +L +  +YKSS+DKANRSS    
Sbjct: 5   GFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAARDAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G+AG+F+ETH +P 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAALATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLGRMAALLETLVTLDRAVK 274


>gi|229844229|ref|ZP_04464370.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           6P18H1]
 gi|229813223|gb|EEP48911.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           6P18H1]
          Length = 284

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 119/280 (42%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDMIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI+ K    G   ++ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVDKFEECGNDKIILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|167720326|ref|ZP_02403562.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei DM98]
          Length = 284

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 122/270 (45%), Positives = 172/270 (63%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC +L +  +YKSS+DKANRSS    
Sbjct: 5   GFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAARDVGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G+AG+F+ETH +P 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAALATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLGRMAALLETLVTLDRAVK 274


>gi|268589774|ref|ZP_06123995.1| 3-deoxy-8-phosphooctulonate synthase [Providencia rettgeri DSM
           1131]
 gi|291314929|gb|EFE55382.1| 3-deoxy-8-phosphooctulonate synthase [Providencia rettgeri DSM
           1131]
          Length = 284

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N+  FVL  G   +ES D A  + E    + Q L I  V+K+
Sbjct: 1   MQQKVVNIGD----INVANDLPFVLFGGMNVLESRDMAMKVCEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q   +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPAQAAPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+T  VIN+KK QF+SP +M NI++K    G   ++ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVAAMAKTDAVINIKKPQFISPGQMGNIVEKFIEGGNDKIILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMVQASKGCPVIFDVTHALQCRDPFGAASGGRRGQVAELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DPDNA  DGP+ + +  L   L Q+ AID+++K 
Sbjct: 237 FLEAHPDPDNARCDGPSALPLDKLEPFLKQMKAIDEVVKS 276


>gi|319897175|ref|YP_004135370.1| 3-deoxy-d-manno-octulosonate 8-phosphate synthase [Haemophilus
           influenzae F3031]
 gi|317432679|emb|CBY81042.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Haemophilus
           influenzae F3031]
          Length = 284

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   + Q+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVFQMKAIDDLVKS 276


>gi|289651468|ref|ZP_06482811.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas syringae pv.
           aesculi str. 2250]
          Length = 281

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 118/278 (42%), Positives = 173/278 (62%), Gaps = 4/278 (1%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                I +GS    +  +N++  VL  G   +ES D A  + E+   + + L I  V+K+
Sbjct: 1   MAQKTIRVGS----IEIANDKPMVLFGGMNLLESRDMAMQVCEEYVRVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G  IF ++K+ +  P++TDVH   Q   +A+  DI+Q+PA
Sbjct: 57  SFDKANRSSVNSYRGPGLEEGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN 
Sbjct: 117 FLSRQTDLVVAMAKTGAVINIKKAQFLAPQEMKHILTKCEEAGNDQLILCERGSSFGYNN 176

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV DM    +M     P++FD +H++Q PG   + +GG R  ++ LAKA ++  +AG+FL
Sbjct: 177 LVVDMLGFGVMKQFEYPILFDVTHALQMPGGRSDSAGGRRAQVLDLAKAGISQNLAGLFL 236

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           E H DPDNA  DGP  + +  L   L+QL ++D+++K 
Sbjct: 237 EAHPDPDNAKCDGPCALRLDKLEPFLAQLKSLDELVKS 274


>gi|254362304|ref|ZP_04978416.1| 3-deoxy-8-phosphooctulonate synthase [Mannheimia haemolytica
           PHL213]
 gi|153093884|gb|EDN74812.1| 3-deoxy-8-phosphooctulonate synthase [Mannheimia haemolytica
           PHL213]
          Length = 284

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 182/280 (65%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            T+  + +G     +  +N + F L  G   +ES D A  + E+   + Q LN+  V+K+
Sbjct: 1   MTDKIVKVG----NIEVANHKPFTLFGGMNVLESRDMALRVCEQYVEVTQKLNVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK+ +G  I+TDVH   QC+ +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKQTFGVNIITDVHEIYQCKPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIAECGNDQVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM     G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 177 LVVDMLGFGIMKKVSKGCPVIFDVTHSLQCRDPFGAASGGRRDQVTELARSGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP++A  DGP+ + +  L   +SQ+ AID+++K 
Sbjct: 237 FLEAHPDPNSAKCDGPSALPLSKLEAFVSQMKAIDELVKS 276


>gi|83310921|ref|YP_421185.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Magnetospirillum
           magneticum AMB-1]
 gi|82945762|dbj|BAE50626.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthase
           [Magnetospirillum magneticum AMB-1]
          Length = 283

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 159/267 (59%), Positives = 193/267 (72%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
            + V   N+   VLIAGPCQ+ES DHA   AE L  +     I L+YKSSFDKANR+SLA
Sbjct: 11  NDDVILGNDLPLVLIAGPCQMESRDHAMECAEALKIMAAEAGIALIYKSSFDKANRTSLA 70

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
           G+RGVGL K   IF ++K K G P+LTDVHTE+QC   A   D+LQIPA LCRQTDLL A
Sbjct: 71  GQRGVGLDKALPIFAEIKAKLGLPVLTDVHTEEQCVIAAKVADVLQIPAFLCRQTDLLVA 130

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
           A +TG VINVKKGQFL+PW+M N+  K+ + G   VL  ERG SFGYNTLVTDMR +PIM
Sbjct: 131 AGRTGAVINVKKGQFLAPWDMANVAAKIESTGNSRVLLTERGASFGYNTLVTDMRGLPIM 190

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
              G PVI DA+H+VQ PG  GN SGG+R++   LA+AAVAIG+AG+F+E H DPD+APS
Sbjct: 191 ARTGWPVIMDATHAVQAPGGQGNSSGGDRRFAPVLARAAVAIGVAGVFVECHPDPDHAPS 250

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGPNMI +KD+P L+  L+ +D   K 
Sbjct: 251 DGPNMIAMKDMPALVEVLMKLDATAKS 277


>gi|296101963|ref|YP_003612109.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295056422|gb|ADF61160.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 284

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 173/280 (61%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDKVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M ++    PVIFD +HS+Q     G  SGG R  +  LA+A +A G+AG+
Sbjct: 177 LVVDMLGFTVMKNVSNQSPVIFDVTHSLQCRDPFGAASGGRRAQVTELARAGMATGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP NA  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPANAKCDGPSALPLDKLEPFLKQIKAIDDLVKS 276


>gi|145629731|ref|ZP_01785527.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           22.1-21]
 gi|145639099|ref|ZP_01794707.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittII]
 gi|144978068|gb|EDJ87847.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           22.1-21]
 gi|145272071|gb|EDK11980.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittII]
 gi|309751050|gb|ADO81034.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           R2866]
          Length = 284

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 179/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVIEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK+ +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKETFGVKIITDVHEIYQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPGQMGNIVEKIEECGNDKIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  SGG R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|260767749|ref|ZP_05876684.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           furnissii CIP 102972]
 gi|260617258|gb|EEX42442.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           furnissii CIP 102972]
          Length = 283

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +H+G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+
Sbjct: 1   MEQKIVHVGD----IPVANDKPFTLFAGMNVLESRDMAMQICEHYVKVTDKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G + V+ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNEKVILCERGSCHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L+Q+ A+D ++K 
Sbjct: 237 FIEAHPNPDQARCDGPSALPLDKLEPFLAQMKALDDLVKS 276


>gi|170699285|ref|ZP_02890334.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           IOP40-10]
 gi|170135777|gb|EDT04056.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia ambifaria
           IOP40-10]
          Length = 284

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 126/270 (46%), Positives = 176/270 (65%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q F LIAG C +ES       A +L  IC+ LN+  +YKSS+DKANRSS    
Sbjct: 5   DFEVGLDQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++ G P+LTDVH+  + E +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           ++G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 RSGKPVNIKKGQFLAPHDMKNVIDKAREAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETHQ+P 
Sbjct: 185 LAIMRETSAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHQNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLNRMGALLETLVTLDQAVK 274


>gi|148981995|ref|ZP_01816583.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrionales bacterium
           SWAT-3]
 gi|145960683|gb|EDK26027.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrionales bacterium
           SWAT-3]
          Length = 283

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 124/280 (44%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+
Sbjct: 1   MEQKTVHIGD----MPIANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G   ++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPNQVGNIVDKFAECGNDKIILCERGSCMGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKSSNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L Q+ A+D +IK 
Sbjct: 237 FIEAHPNPDQARCDGPSALPLDKLEPFLKQMKALDDLIKG 276


>gi|332705741|ref|ZP_08425817.1| 3-deoxy-8-phosphooctulonate synthase [Lyngbya majuscula 3L]
 gi|332355533|gb|EGJ34997.1| 3-deoxy-8-phosphooctulonate synthase [Lyngbya majuscula 3L]
          Length = 280

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 138/260 (53%), Positives = 186/260 (71%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           ++  +     LI GPC IES D    +AE++  +C  LNI L++KSSFDKANR+S+   R
Sbjct: 10  LSIGDRCPLTLIGGPCVIESEDFTLKMAEEIRKVCDRLNIPLIFKSSFDKANRTSINSFR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G  L +G EI + +K+K G P+LTD+H   Q   +A+ VD+LQIPA LCRQTDLL AAA 
Sbjct: 70  GQTLDRGLEILQKVKQKVGVPVLTDIHGSHQAATVAEVVDVLQIPAFLCRQTDLLIAAAA 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG+ INVKKGQFL+PW+M +++ KL A GAK++L  ERGTSFGYNTLV D RS+P M  +
Sbjct: 130 TGKAINVKKGQFLAPWDMKHVVSKLEAGGAKNILLTERGTSFGYNTLVVDFRSLPQMREL 189

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQ PG  G+ SGG+R ++  LA+AA A+GI  +F+E H++PD APSDGP
Sbjct: 190 GYPVVFDATHSVQMPGGKGDKSGGQRHFVPYLARAAAAVGIDALFMEIHENPDIAPSDGP 249

Query: 277 NMINIKDLPKLLSQLLAIDK 296
           NM+ + +L  +L  +L +  
Sbjct: 250 NMVPLAELENVLKGILNVRA 269


>gi|86148708|ref|ZP_01066985.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio sp. MED222]
 gi|85833501|gb|EAQ51682.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio sp. MED222]
          Length = 283

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+
Sbjct: 1   MEQKTVHIG----NMPIANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TD+HTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDIHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G  +++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPDQVGNIVDKFAECGNDNIILCERGSCMGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +H++Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKSSNGSPIIFDVTHALQMRDPSGAASGGRREQTVELAKAGIATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +PD A  DGP+ + +  L   L Q+ A+D +IK 
Sbjct: 237 FLEAHPNPDQARCDGPSALPLDKLEPFLKQMKALDDLIKG 276


>gi|124024245|ref|YP_001018552.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Prochlorococcus marinus
           str. MIT 9303]
 gi|123964531|gb|ABM79287.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Prochlorococcus marinus str. MIT 9303]
          Length = 300

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 123/301 (40%), Positives = 180/301 (59%), Gaps = 10/301 (3%)

Query: 3   ILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFM 62
           +         Q RI K  +  T+ ++ +      +  +N+Q FVLI G   +ES D A  
Sbjct: 2   VQASY----TQYRISKRIIKMTSPSVSIDG----IRVANDQPFVLIGGVNVLESLDFAIN 53

Query: 63  IAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDV 122
           +A     +CQ L+I  V+K+S+DKANRSS+   RG G+  G  I R +K+ Y  P+LTDV
Sbjct: 54  VAGHYVEVCQRLDIPFVFKASYDKANRSSIHSYRGPGITTGLNILRAVKETYKIPVLTDV 113

Query: 123 HTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLH 182
           H+ ++    A   D++Q+PA L RQTDL+ A A+T  VIN+KK QFLSP +M NI +K  
Sbjct: 114 HSPEEASEAAAICDVIQLPAFLARQTDLVRAMAETNAVINIKKPQFLSPEQMKNITEKFR 173

Query: 183 AHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGV--PVIFDASHSVQQPGIHGNCSGG 240
             G   +L CERG++FGY+ LV DM    +M  +    P+IFD +H++Q     G  SGG
Sbjct: 174 ECGNTKLLLCERGSNFGYDNLVVDMLGFGVMKHICNDLPLIFDVTHALQCRDAGGAASGG 233

Query: 241 ERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            R  ++ LA+A +A+G+AG+FLE H +PD A  DGP+ + +  L   L+Q+ AID ++K 
Sbjct: 234 RRAQVLELARAGMAVGLAGLFLEAHPNPDEAFCDGPSALPLAKLEPFLTQIKAIDDLVKS 293

Query: 301 L 301
           L
Sbjct: 294 L 294


>gi|148826079|ref|YP_001290832.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittEE]
 gi|229847127|ref|ZP_04467232.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           7P49H1]
 gi|166199034|sp|A5UCE8|KDSA_HAEIE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|148716239|gb|ABQ98449.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittEE]
 gi|229809956|gb|EEP45677.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           7P49H1]
 gi|309973230|gb|ADO96431.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           R2846]
          Length = 284

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCESYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   + Q+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVFQMKAIDDLVKS 276


>gi|167739320|ref|ZP_02412094.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 14]
          Length = 284

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 122/270 (45%), Positives = 171/270 (63%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC  L +  +YKSS+DKANRSS    
Sbjct: 5   GFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICAMLGVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAARDAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G+AG+F+ETH +P 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAALATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLGRMAALLETLVTLDRAVK 274


>gi|218708759|ref|YP_002416380.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio splendidus LGP32]
 gi|254807755|sp|B7VKH7|KDSA_VIBSL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|218321778|emb|CAV17734.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio splendidus LGP32]
          Length = 284

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 123/281 (43%), Positives = 177/281 (62%), Gaps = 6/281 (2%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +     +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K
Sbjct: 1   MMEQKTVHIG----NMPIANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS+   RG G+++G +IF++LK  +G  I+TD+HTE Q + +AD VD++Q+P
Sbjct: 57  ASFDKANRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDIHTEAQAQPVADVVDVIQLP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G ++++ CERG+  GY+
Sbjct: 117 AFLARQTDLVEAMAKTGAVINVKKPQFMSPDQVGNIVDKFAECGNENIILCERGSCMGYD 176

Query: 202 TLVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
            LV DM    +M     G P+IFD +H++Q     G  SGG R+  V LAKA +A GIAG
Sbjct: 177 NLVVDMLGFGVMKKSSNGSPIIFDVTHALQMRDPSGAASGGRREQTVELAKAGIATGIAG 236

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +FLE H +PD A  DGP+ + +  L   L Q+ A+D +IK 
Sbjct: 237 LFLEAHPNPDQARCDGPSALPLDKLEPFLKQMKALDDLIKG 277


>gi|157145536|ref|YP_001452855.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Citrobacter koseri ATCC
           BAA-895]
 gi|166199032|sp|A8AG06|KDSA_CITK8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|157082741|gb|ABV12419.1| hypothetical protein CKO_01279 [Citrobacter koseri ATCC BAA-895]
          Length = 284

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K H  G   V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFHEGGNDKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSVMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQIKAIDDLVKS 276


>gi|94496641|ref|ZP_01303217.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingomonas sp. SKA58]
 gi|94424001|gb|EAT09026.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingomonas sp. SKA58]
          Length = 275

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 148/266 (55%), Positives = 189/266 (71%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +T  N+  FVLI+GPCQIES DHA  +A+ L    +   +  ++KSSFDKANR+S++G
Sbjct: 10  GPITIGNDLPFVLISGPCQIESRDHALFMADALARAAEQAGVPFIFKSSFDKANRTSVSG 69

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRGVG+  G  I  ++K   G P+LTD+H   Q EA A +VDILQIPA LCRQTDLL AA
Sbjct: 70  KRGVGIDAGLAILAEVKASLGCPVLTDIHGPDQVEAAAQAVDILQIPAFLCRQTDLLLAA 129

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            ++G VINVKKGQFL+PW+M  + QK+ + G   +L  ERG SFGYNTLV+DMR++P+M 
Sbjct: 130 GRSGAVINVKKGQFLAPWDMAAVAQKVASTGNDRILLTERGASFGYNTLVSDMRALPVMA 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+HSVQQPG  G+ SGG+R Y   LA++AVA G+A IF E H DPDNAPSD
Sbjct: 190 QTGYPVIFDATHSVQQPGGLGSASGGQRDYAPLLARSAVAAGVAAIFAEAHDDPDNAPSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP M+ +  +  +L +L AID I K 
Sbjct: 250 GPVMLPLDWVGPMLDKLKAIDAIAKA 275


>gi|300716409|ref|YP_003741212.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erwinia billingiae
           Eb661]
 gi|299062245|emb|CAX59362.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erwinia billingiae
           Eb661]
          Length = 284

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 172/280 (61%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVNIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G  IF+D+K  +G  ++TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMRIFQDIKAAFGVKVITDVHEASQAQTVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFAEGGNDKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +H++Q     G+ S G R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFNVMKQVSNGSPVIFDVTHALQCRDPFGSASSGRRGQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP NA  DGP+ + +  L   L+Q+ AID ++K 
Sbjct: 237 FIEAHPDPANAKCDGPSALPLDKLEPFLAQIKAIDDLVKS 276


>gi|260914188|ref|ZP_05920661.1| 3-deoxy-8-phosphooctulonate synthase [Pasteurella dagmatis ATCC
           43325]
 gi|260631821|gb|EEX49999.1| 3-deoxy-8-phosphooctulonate synthase [Pasteurella dagmatis ATCC
           43325]
          Length = 284

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 121/268 (45%), Positives = 173/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+SFDKANRSS+  
Sbjct: 9   GDIEIANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G++KG +IF++LK  +G  I+TDVH   QC+ +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEKGLKIFQELKDTFGVKIITDVHEIYQCQPVAEVADIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ LV DM    IM 
Sbjct: 129 AKTGAIINVKKPQFLSPSQMGNIVEKIEECGNDKVILCDRGTNFGYDNLVVDMLGFSIMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+FLE H +P+ A 
Sbjct: 189 KVSKGCPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGLAIGLAGLFLEAHPNPNQAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 249 CDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|229586302|ref|YP_002844803.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia africae
           ESF-5]
 gi|259494407|sp|C3PMA0|KDSA_RICAE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|228021352|gb|ACP53060.1| 3-deoxy-8-phosphooctulonate synthase [Rickettsia africae ESF-5]
          Length = 274

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 155/266 (58%), Positives = 196/266 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLI GPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG++KG EI   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGVGIEKGLEILSKVKSEFDCPIVTDVHSESQCTETAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL A G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  +GGER+Y+  LAKAA ++GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLAKAATSVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP M+ + +L  +L +L   DKI K 
Sbjct: 248 GPCMMKLDNLESILIKLKKYDKITKE 273


>gi|333007548|gb|EGK27026.1| 3-deoxy-8-phosphooctulonate synthase [Shigella flexneri K-272]
 gi|333019928|gb|EGK39200.1| 3-deoxy-8-phosphooctulonate synthase [Shigella flexneri K-227]
          Length = 284

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +   +PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNLPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKG 276


>gi|260598211|ref|YP_003210782.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cronobacter turicensis
           z3032]
 gi|260217388|emb|CBA31441.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cronobacter turicensis
           z3032]
          Length = 284

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVHT +Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHTAEQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G   V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFISPGQIGNIVDKFKEGGNDQVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  S G R  +  LA+A +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKVSGNAPVIFDVTHALQCRDPFGAASSGRRAQVTELARAGMATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L+Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEAFLTQIKAIDDLVKS 276


>gi|37728652|gb|AAO63016.1| KdsA [Moraxella catarrhalis O35E]
          Length = 290

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 129/268 (48%), Positives = 173/268 (64%), Gaps = 3/268 (1%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +   N++ FVL  G   +ES + AF IAE+   ICQ LNIG V+K+SFDKANRSSL   
Sbjct: 16  GIEIGNDKPFVLFGGMNVLESRELAFEIAEQYIDICQRLNIGYVFKASFDKANRSSLHSF 75

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG  L+ G     D+K+ Y  PI+TDVH   Q   +A   DILQ+PA L RQTDL++A A
Sbjct: 76  RGPSLENGLTWLNDIKETYNVPIITDVHEPYQAAPVAKVADILQLPAFLSRQTDLVSAIA 135

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMR---SIPI 212
           +TG++INVKK QFL+P EM +I+ K    G   V+ CERG++FGYN LV DM    ++  
Sbjct: 136 RTGKIINVKKAQFLAPHEMRHIINKCLEAGNDQVILCERGSAFGYNNLVVDMLGFDTMKT 195

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M SM VPV FD +H++Q+PG  G+ +GG R  I  LA+A +A G+AG+FLE H DPD A 
Sbjct: 196 MKSMNVPVFFDVTHALQEPGARGDSAGGRRHQITTLARAGMATGLAGLFLEAHPDPDKAK 255

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L Q+  +D ++K 
Sbjct: 256 CDGPSALRLNQLEPFLIQIKQLDDLVKG 283


>gi|145632948|ref|ZP_01788681.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           3655]
 gi|144986604|gb|EDJ93170.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           3655]
          Length = 284

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 119/280 (42%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI+ K    G   ++ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVDKFEECGNDKIILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   +SQ+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKS 276


>gi|237812997|ref|YP_002897448.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           MSHR346]
 gi|237506610|gb|ACQ98928.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           MSHR346]
          Length = 284

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 122/270 (45%), Positives = 172/270 (63%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC +L +  +YKSS+DKANRSS    
Sbjct: 5   GFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMENVIDKARDAARDAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G+AG+F+ETH +P 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAALATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLGRMAALLETLVTLDRAVK 274


>gi|188534011|ref|YP_001907808.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erwinia tasmaniensis
           Et1/99]
 gi|238689734|sp|B2VEI7|KDSA_ERWT9 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|188029053|emb|CAO96921.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erwinia tasmaniensis
           Et1/99]
          Length = 284

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 173/280 (61%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF+++K+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQEIKQAFGVKIITDVHEASQAQTVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G ++V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFAEGGNENVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  S G R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMKQVSNNSPVIFDVTHALQCRDPMGAASSGRRGQVSELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP NA  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPANAKCDGPSALPLDKLEPFLLQMKAIDDLVKS 276


>gi|332092255|gb|EGI97332.1| 3-deoxy-8-phosphooctulonate synthase [Shigella boydii 5216-82]
          Length = 284

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH + Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEQSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKG 276


>gi|258621069|ref|ZP_05716103.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio mimicus VM573]
 gi|258626142|ref|ZP_05720990.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio mimicus VM603]
 gi|262166262|ref|ZP_06033999.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           mimicus VM223]
 gi|262170846|ref|ZP_06038524.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           mimicus MB-451]
 gi|258581497|gb|EEW06398.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio mimicus VM603]
 gi|258586457|gb|EEW11172.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio mimicus VM573]
 gi|261891922|gb|EEY37908.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           mimicus MB-451]
 gi|262025978|gb|EEY44646.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           mimicus VM223]
          Length = 283

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 123/268 (45%), Positives = 173/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKANRSSVHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF++LK+ +G  I+TDVHT +Q + +AD VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMKIFQELKQTFGVKIITDVHTAEQAQPVADVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM    +M 
Sbjct: 129 AKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDMLGFGVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G P+IFD +HS+Q     G  SGG RQ  V LAKA +A GIAG+F+E H +P+ A 
Sbjct: 189 QASNGSPIIFDVTHSLQMRDPSGAASGGRRQQTVELAKAGLATGIAGLFIEAHPNPEKAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L+Q+ A+D +IK 
Sbjct: 249 CDGPSALPLDKLEPFLAQMKALDDLIKS 276


>gi|16129178|ref|NP_415733.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           str. K-12 substr. MG1655]
 gi|24112614|ref|NP_707124.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shigella flexneri 2a
           str. 301]
 gi|30062739|ref|NP_836910.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shigella flexneri 2a
           str. 2457T]
 gi|74312446|ref|YP_310865.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shigella sonnei Ss046]
 gi|82544331|ref|YP_408278.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shigella boydii Sb227]
 gi|82776555|ref|YP_402904.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shigella dysenteriae
           Sd197]
 gi|89108060|ref|AP_001840.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           str. K-12 substr. W3110]
 gi|91210436|ref|YP_540422.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli UTI89]
 gi|110805220|ref|YP_688740.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shigella flexneri 5 str.
           8401]
 gi|117623433|ref|YP_852346.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli APEC
           O1]
 gi|157158072|ref|YP_001462468.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli
           E24377A]
 gi|157160720|ref|YP_001458038.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli HS]
 gi|170020418|ref|YP_001725372.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli ATCC
           8739]
 gi|170080843|ref|YP_001730163.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170684298|ref|YP_001743979.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli
           SMS-3-5]
 gi|187731748|ref|YP_001879998.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shigella boydii CDC
           3083-94]
 gi|188493579|ref|ZP_03000849.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli 53638]
 gi|191166676|ref|ZP_03028504.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli B7A]
 gi|193070001|ref|ZP_03050949.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli E110019]
 gi|194425823|ref|ZP_03058379.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli B171]
 gi|194434254|ref|ZP_03066520.1| 3-deoxy-8-phosphooctulonate synthase [Shigella dysenteriae 1012]
 gi|194437152|ref|ZP_03069251.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli 101-1]
 gi|209918456|ref|YP_002292540.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli SE11]
 gi|215486447|ref|YP_002328878.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O127:H6
           str. E2348/69]
 gi|218553769|ref|YP_002386682.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli IAI1]
 gi|218558144|ref|YP_002391057.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli S88]
 gi|218689162|ref|YP_002397374.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli ED1a]
 gi|218694729|ref|YP_002402396.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli 55989]
 gi|218699922|ref|YP_002407551.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli IAI39]
 gi|218704737|ref|YP_002412256.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli UMN026]
 gi|227886363|ref|ZP_04004168.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli 83972]
 gi|237705177|ref|ZP_04535658.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia sp. 3_2_53FAA]
 gi|238900446|ref|YP_002926242.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           BW2952]
 gi|253773786|ref|YP_003036617.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161297|ref|YP_003044405.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli B str.
           REL606]
 gi|256018535|ref|ZP_05432400.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shigella sp. D9]
 gi|256023108|ref|ZP_05436973.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia sp. 4_1_40B]
 gi|260843507|ref|YP_003221285.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           O103:H2 str. 12009]
 gi|260854876|ref|YP_003228767.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           O26:H11 str. 11368]
 gi|260867620|ref|YP_003234022.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           O111:H- str. 11128]
 gi|291282240|ref|YP_003499058.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O55:H7
           str. CB9615]
 gi|293404758|ref|ZP_06648750.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli
           FVEC1412]
 gi|293409602|ref|ZP_06653178.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli B354]
 gi|293414492|ref|ZP_06657141.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli B185]
 gi|293433531|ref|ZP_06661959.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli B088]
 gi|298380401|ref|ZP_06990000.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli
           FVEC1302]
 gi|300816906|ref|ZP_07097126.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 107-1]
 gi|300821015|ref|ZP_07101164.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 119-7]
 gi|300896603|ref|ZP_07115122.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 198-1]
 gi|300906878|ref|ZP_07124552.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 84-1]
 gi|300920413|ref|ZP_07136847.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 115-1]
 gi|300921819|ref|ZP_07137976.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 182-1]
 gi|300928239|ref|ZP_07143776.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 187-1]
 gi|300939549|ref|ZP_07154206.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 21-1]
 gi|300951682|ref|ZP_07165506.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 116-1]
 gi|300955615|ref|ZP_07167972.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 175-1]
 gi|300971916|ref|ZP_07171704.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 45-1]
 gi|301017247|ref|ZP_07182028.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 69-1]
 gi|301046864|ref|ZP_07193981.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 185-1]
 gi|301305585|ref|ZP_07211676.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 124-1]
 gi|301648132|ref|ZP_07247885.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 146-1]
 gi|306813887|ref|ZP_07448060.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli NC101]
 gi|307137830|ref|ZP_07497186.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli H736]
 gi|307310030|ref|ZP_07589680.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli W]
 gi|309789157|ref|ZP_07683750.1| 3-deoxy-8-phosphooctulonate synthase [Shigella dysenteriae 1617]
 gi|309794306|ref|ZP_07688730.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 145-7]
 gi|312966455|ref|ZP_07780677.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli 2362-75]
 gi|312971402|ref|ZP_07785577.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli 1827-70]
 gi|331641745|ref|ZP_08342880.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli H736]
 gi|331646533|ref|ZP_08347636.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli M605]
 gi|331652253|ref|ZP_08353272.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli M718]
 gi|331657266|ref|ZP_08358228.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli TA206]
 gi|331662618|ref|ZP_08363541.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli TA143]
 gi|331667599|ref|ZP_08368463.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli TA271]
 gi|331672747|ref|ZP_08373533.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli TA280]
 gi|331676995|ref|ZP_08377691.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli H591]
 gi|331682704|ref|ZP_08383323.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli H299]
 gi|332279595|ref|ZP_08392008.1| 3-deoxy-8-phosphooctulonate synthase [Shigella sp. D9]
 gi|67466688|sp|P0A715|KDSA_ECOLI RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|67466689|sp|P0A716|KDSA_SHIFL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|123266099|sp|Q1RCM3|KDSA_ECOUT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|123342940|sp|Q0T5I0|KDSA_SHIF8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|123728379|sp|Q31ZQ8|KDSA_SHIBS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|123742153|sp|Q32GZ2|KDSA_SHIDS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|123745986|sp|Q3Z0T2|KDSA_SHISS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|158512542|sp|A1AAE2|KDSA_ECOK1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166987630|sp|A7ZKY9|KDSA_ECO24 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166987631|sp|A7ZZF1|KDSA_ECOHS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|189028409|sp|B1ITN8|KDSA_ECOLC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226722931|sp|B7MKB7|KDSA_ECO45 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226722932|sp|B7NUY1|KDSA_ECO7I RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226722933|sp|B7LXX2|KDSA_ECO8A RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226722934|sp|B7N426|KDSA_ECOLU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226722935|sp|B1LH85|KDSA_ECOSM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761658|sp|B6I9T0|KDSA_ECOSE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|229830620|sp|B1XAQ6|KDSA_ECODH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238691758|sp|B2TZW3|KDSA_SHIB3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|254807741|sp|B7UQA3|KDSA_ECO27 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|254807742|sp|B7LGX6|KDSA_ECO55 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|254807743|sp|B7MTZ9|KDSA_ECO81 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|259494402|sp|C4ZTQ6|KDSA_ECOBW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|8569593|pdb|1D9E|A Chain A, Structure Of E. Coli Kdo8p Synthase
 gi|8569594|pdb|1D9E|B Chain B, Structure Of E. Coli Kdo8p Synthase
 gi|8569595|pdb|1D9E|C Chain C, Structure Of E. Coli Kdo8p Synthase
 gi|8569596|pdb|1D9E|D Chain D, Structure Of E. Coli Kdo8p Synthase
 gi|10835454|pdb|1GG0|A Chain A, Crystal Structure Analysis Of Kdop Synthase At 3.0 A
 gi|14277733|pdb|1G7V|A Chain A, Crystal Structures Of Kdo8p Synthase In Its Binary
           Complexes With The Mechanism-Based Inhibitor
 gi|51247143|pdb|1PHQ|A Chain A, Crystal Structure Of Kdo8p Synthase In Its Binary Complex
           With Substrate Analog E-Fpep
 gi|51247144|pdb|1PHW|A Chain A, Crystal Structure Of Kdo8p Synthase In Its Binary Complex
           With Substrate Analog 1-Deoxy-A5p
 gi|51247148|pdb|1PL9|A Chain A, Crystal Structure Of Kdo8p Synthase In Its Binary Complex
           With Substrate Analog Z-Fpep
 gi|56553622|pdb|1Q3N|A Chain A, Crystal Structure Of Kdo8p Synthase In Its Binary Complex
           With Substrate Pep
 gi|73535520|pdb|1X6U|A Chain A, Kdo8p Synthase In It's Binary Complex With The Product
           Kdo8p
 gi|73535525|pdb|1X8F|A Chain A, Crystal Structure Of Apo-Kdo8p Synthase
 gi|968934|gb|AAC43441.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase
           [Escherichia coli]
 gi|1651603|dbj|BAA36073.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           str. K12 substr. W3110]
 gi|1787466|gb|AAC74299.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           str. K-12 substr. MG1655]
 gi|24051519|gb|AAN42831.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Shigella flexneri 2a
           str. 301]
 gi|30040987|gb|AAP16717.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Shigella flexneri 2a
           str. 2457T]
 gi|73855923|gb|AAZ88630.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Shigella sonnei Ss046]
 gi|81240703|gb|ABB61413.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Shigella dysenteriae
           Sd197]
 gi|81245742|gb|ABB66450.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Shigella boydii Sb227]
 gi|91072010|gb|ABE06891.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Escherichia coli
           UTI89]
 gi|110614768|gb|ABF03435.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Shigella flexneri 5
           str. 8401]
 gi|115512557|gb|ABJ00632.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli APEC
           O1]
 gi|157066400|gb|ABV05655.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli HS]
 gi|157080102|gb|ABV19810.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli E24377A]
 gi|169755346|gb|ACA78045.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli ATCC
           8739]
 gi|169888678|gb|ACB02385.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170522016|gb|ACB20194.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli SMS-3-5]
 gi|187428740|gb|ACD08014.1| 3-deoxy-8-phosphooctulonate synthase [Shigella boydii CDC 3083-94]
 gi|188488778|gb|EDU63881.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli 53638]
 gi|190903325|gb|EDV63046.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli B7A]
 gi|192956754|gb|EDV87209.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli E110019]
 gi|194415878|gb|EDX32144.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli B171]
 gi|194417485|gb|EDX33588.1| 3-deoxy-8-phosphooctulonate synthase [Shigella dysenteriae 1012]
 gi|194424135|gb|EDX40123.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli 101-1]
 gi|209772488|gb|ACI84556.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Escherichia coli]
 gi|209772494|gb|ACI84559.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Escherichia coli]
 gi|209911715|dbj|BAG76789.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Escherichia coli SE11]
 gi|215264519|emb|CAS08886.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218351461|emb|CAU97169.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           55989]
 gi|218360537|emb|CAQ98095.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           IAI1]
 gi|218364913|emb|CAR02609.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           S88]
 gi|218369908|emb|CAR17683.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           IAI39]
 gi|218426726|emb|CAR07563.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           ED1a]
 gi|218431834|emb|CAR12719.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           UMN026]
 gi|222033014|emb|CAP75754.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli LF82]
 gi|226899934|gb|EEH86193.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia sp. 3_2_53FAA]
 gi|227836567|gb|EEJ47033.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli 83972]
 gi|238859812|gb|ACR61810.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           BW2952]
 gi|242376994|emb|CAQ31717.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           BL21(DE3)]
 gi|253324830|gb|ACT29432.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973198|gb|ACT38869.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli B str.
           REL606]
 gi|253977412|gb|ACT43082.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli
           BL21(DE3)]
 gi|257753525|dbj|BAI25027.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           O26:H11 str. 11368]
 gi|257758654|dbj|BAI30151.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           O103:H2 str. 12009]
 gi|257763976|dbj|BAI35471.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           O111:H- str. 11128]
 gi|260449650|gb|ACX40072.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli DH1]
 gi|262092740|gb|ACY25766.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Escherichia coli
           LW1655F+]
 gi|281178401|dbj|BAI54731.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Escherichia coli SE15]
 gi|281600639|gb|ADA73623.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Shigella flexneri
           2002017]
 gi|284921027|emb|CBG34092.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli 042]
 gi|290762113|gb|ADD56074.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O55:H7
           str. CB9615]
 gi|291324350|gb|EFE63772.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli B088]
 gi|291426966|gb|EFE99992.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli
           FVEC1412]
 gi|291434550|gb|EFF07523.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli B185]
 gi|291470070|gb|EFF12554.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli B354]
 gi|294493818|gb|ADE92574.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli IHE3034]
 gi|298277843|gb|EFI19357.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli
           FVEC1302]
 gi|300301232|gb|EFJ57617.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 185-1]
 gi|300317508|gb|EFJ67292.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 175-1]
 gi|300359546|gb|EFJ75416.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 198-1]
 gi|300400378|gb|EFJ83916.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 69-1]
 gi|300401311|gb|EFJ84849.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 84-1]
 gi|300411041|gb|EFJ94579.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 45-1]
 gi|300412546|gb|EFJ95856.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 115-1]
 gi|300421745|gb|EFK05056.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 182-1]
 gi|300449128|gb|EFK12748.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 116-1]
 gi|300455553|gb|EFK19046.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 21-1]
 gi|300463708|gb|EFK27201.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 187-1]
 gi|300526314|gb|EFK47383.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 119-7]
 gi|300530680|gb|EFK51742.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 107-1]
 gi|300839174|gb|EFK66934.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 124-1]
 gi|301073718|gb|EFK88524.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 146-1]
 gi|305852524|gb|EFM52972.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli NC101]
 gi|306909748|gb|EFN40242.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli W]
 gi|307553270|gb|ADN46045.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli ABU 83972]
 gi|307627262|gb|ADN71566.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli UM146]
 gi|308122211|gb|EFO59473.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 145-7]
 gi|308922911|gb|EFP68425.1| 3-deoxy-8-phosphooctulonate synthase [Shigella dysenteriae 1617]
 gi|309701514|emb|CBJ00821.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli ETEC
           H10407]
 gi|310335999|gb|EFQ01199.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli 1827-70]
 gi|312288908|gb|EFR16806.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli 2362-75]
 gi|312945845|gb|ADR26672.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O83:H1
           str. NRG 857C]
 gi|313649404|gb|EFS13835.1| 3-deoxy-8-phosphooctulonate synthase [Shigella flexneri 2a str.
           2457T]
 gi|315060466|gb|ADT74793.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           W]
 gi|315135851|dbj|BAJ43010.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli DH1]
 gi|315254825|gb|EFU34793.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 85-1]
 gi|315288564|gb|EFU47962.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 110-3]
 gi|315290793|gb|EFU50165.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 153-1]
 gi|315297349|gb|EFU56629.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 16-3]
 gi|315615943|gb|EFU96569.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli 3431]
 gi|320174905|gb|EFW50024.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Shigella
           dysenteriae CDC 74-1112]
 gi|320181778|gb|EFW56688.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Shigella
           boydii ATCC 9905]
 gi|320185618|gb|EFW60380.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Shigella
           flexneri CDC 796-83]
 gi|320195775|gb|EFW70400.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Escherichia coli WV_060327]
 gi|320199254|gb|EFW73845.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Escherichia coli EC4100B]
 gi|320637367|gb|EFX07174.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O157:H7
           str. G5101]
 gi|320643229|gb|EFX12430.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O157:H-
           str. 493-89]
 gi|320648166|gb|EFX16842.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O157:H-
           str. H 2687]
 gi|320654000|gb|EFX22074.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320659479|gb|EFX27048.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320664616|gb|EFX31767.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O157:H7
           str. LSU-61]
 gi|323153186|gb|EFZ39448.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli EPECa14]
 gi|323162260|gb|EFZ48118.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli E128010]
 gi|323172431|gb|EFZ58068.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli LT-68]
 gi|323179270|gb|EFZ64840.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli 1180]
 gi|323185623|gb|EFZ70984.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli 1357]
 gi|323187445|gb|EFZ72754.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli RN587/1]
 gi|323378970|gb|ADX51238.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli KO11]
 gi|323937936|gb|EGB34200.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli E1520]
 gi|323942494|gb|EGB38662.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli E482]
 gi|323947502|gb|EGB43506.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli H120]
 gi|323949668|gb|EGB45554.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli H252]
 gi|323953930|gb|EGB49729.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli H263]
 gi|323962793|gb|EGB58371.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli H489]
 gi|323964714|gb|EGB60185.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli M863]
 gi|323973387|gb|EGB68574.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli TA007]
 gi|323977214|gb|EGB72301.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli TW10509]
 gi|324005996|gb|EGB75215.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 57-2]
 gi|324017535|gb|EGB86754.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 117-3]
 gi|324117237|gb|EGC11144.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli E1167]
 gi|327253905|gb|EGE65534.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli STEC_7v]
 gi|330911080|gb|EGH39590.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Escherichia coli AA86]
 gi|331038543|gb|EGI10763.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli H736]
 gi|331045285|gb|EGI17412.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli M605]
 gi|331050531|gb|EGI22589.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli M718]
 gi|331055514|gb|EGI27523.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli TA206]
 gi|331061040|gb|EGI33004.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli TA143]
 gi|331065184|gb|EGI37079.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli TA271]
 gi|331069968|gb|EGI41337.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli TA280]
 gi|331075684|gb|EGI46982.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli H591]
 gi|331080335|gb|EGI51514.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli H299]
 gi|332094749|gb|EGI99793.1| 3-deoxy-8-phosphooctulonate synthase [Shigella boydii 3594-74]
 gi|332098209|gb|EGJ03182.1| 3-deoxy-8-phosphooctulonate synthase [Shigella dysenteriae 155-74]
 gi|332101947|gb|EGJ05293.1| 3-deoxy-8-phosphooctulonate synthase [Shigella sp. D9]
 gi|332342797|gb|AEE56131.1| 3-deoxy-8-phosphooctulonate synthase KdsA [Escherichia coli UMNK88]
 gi|332757868|gb|EGJ88195.1| 3-deoxy-8-phosphooctulonate synthase [Shigella flexneri 4343-70]
 gi|332759538|gb|EGJ89846.1| 3-deoxy-8-phosphooctulonate synthase [Shigella flexneri 2747-71]
 gi|332760309|gb|EGJ90599.1| 3-deoxy-8-phosphooctulonate synthase [Shigella flexneri K-671]
 gi|332767449|gb|EGJ97643.1| 3-deoxy-8-phosphooctulonate synthase [Shigella flexneri 2930-71]
 gi|333005054|gb|EGK24574.1| 3-deoxy-8-phosphooctulonate synthase [Shigella flexneri VA-6]
 gi|333005756|gb|EGK25274.1| 3-deoxy-8-phosphooctulonate synthase [Shigella flexneri K-218]
 gi|333019234|gb|EGK38521.1| 3-deoxy-8-phosphooctulonate synthase [Shigella flexneri K-304]
          Length = 284

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKG 276


>gi|14277732|pdb|1G7U|A Chain A, Crystal Structures Of Kdo8p Synthase In Its Binary Complex
           With Substrate Phosphoenol Pyruvate
          Length = 284

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 173/280 (61%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +    PVIFD +H++Q        SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNSPVIFDVTHALQCRDPFVAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKG 276


>gi|167837145|ref|ZP_02464028.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           thailandensis MSMB43]
          Length = 284

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 122/270 (45%), Positives = 169/270 (62%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC  L +  +YKSS+DKANRSS    
Sbjct: 5   GFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLGVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+  G  I  ++K++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDAGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAAREAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM     PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETLAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLGRMAALLETLVTLDQAVK 274


>gi|163803581|ref|ZP_02197448.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio sp. AND4]
 gi|159172623|gb|EDP57480.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio sp. AND4]
          Length = 283

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+
Sbjct: 1   MEQKIVNIGD----IQVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G ++++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNENIILCERGSCMGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKATQGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L+Q+ ++D +IK 
Sbjct: 237 FIEAHPNPDQARCDGPSALPLDKLEPFLAQMKSLDDLIKS 276


>gi|148244893|ref|YP_001219587.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Vesicomyosocius okutanii HA]
 gi|254807753|sp|A5CW13|KDSA_VESOH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|146326720|dbj|BAF61863.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Vesicomyosocius okutanii HA]
          Length = 277

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 118/265 (44%), Positives = 171/265 (64%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                    F LIAGPC IES   A   A  L  + + L I  +YKSS+DKANR+S    
Sbjct: 5   DFEVGINHPFFLIAGPCVIESEALALETATYLKRVTEDLGINFIYKSSYDKANRTSTNSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+K+G  I + +K + G P+LTDVH +     +A  VD++Q PA L RQT+ +    
Sbjct: 65  RGLGVKEGLRILQKVKDEVGVPVLTDVHEDTPLSEVASVVDMMQTPAFLVRQTNFIQNVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G  +N+KKGQF +PW++ N++ K +  G + +  CERGTSFGYNTL++DMR +  M S
Sbjct: 125 KQGIPVNIKKGQFQAPWDIGNVVNKAYETGNRLITICERGTSFGYNTLISDMRGLSTMRS 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G P++FDA+HSVQQPG +G  SGG+R+ +  +A+AA+ +G++G F+ETH +P+ A SDG
Sbjct: 185 TGCPIVFDATHSVQQPGGNGLTSGGQREMVPVVARAAIGVGVSGFFMETHPNPNEAFSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNM+ I  + +LL  L  +D + K 
Sbjct: 245 PNMVPIDKIDELLKTLQELDAVTKK 269


>gi|148260242|ref|YP_001234369.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidiphilium cryptum
           JF-5]
 gi|326403428|ref|YP_004283509.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidiphilium multivorum
           AIU301]
 gi|146401923|gb|ABQ30450.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidiphilium cryptum
           JF-5]
 gi|325050289|dbj|BAJ80627.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidiphilium multivorum
           AIU301]
          Length = 275

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 148/275 (53%), Positives = 200/275 (72%), Gaps = 4/275 (1%)

Query: 26  AAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFD 85
             + +G    ++   N+  F LIAGPCQIES +HA  +A  L A+ + L IGL++KSS+D
Sbjct: 4   KTVEIG----ELRVGNDLPFTLIAGPCQIESAEHAGEVAGALAAMTRELGIGLIFKSSYD 59

Query: 86  KANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLC 145
           KANR+SL   RGVG+ +G +I  D++ K+G P+LTDVH   QC   A++VD+LQIPA LC
Sbjct: 60  KANRTSLTAGRGVGMAQGLQILADIRAKFGIPVLTDVHDAAQCAPAAEAVDVLQIPAFLC 119

Query: 146 RQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVT 205
           RQTDLL AA  TGR INVKKGQFL+PW+M N+  K+ + G + +L  ERG SFGYNTLV+
Sbjct: 120 RQTDLLLAAGHTGRAINVKKGQFLAPWDMRNVAAKIASTGNERILLTERGASFGYNTLVS 179

Query: 206 DMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
           D+R++PIM   G PV+FDA+HSVQQPG  G  SGG+R++   LA+AA+A+G A +F+E H
Sbjct: 180 DLRALPIMAQTGYPVVFDATHSVQQPGGQGTASGGQREFAPILARAALAVGCAAVFIECH 239

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DPD+APSDGPNMI + ++P LL++L   D++ K 
Sbjct: 240 PDPDHAPSDGPNMIRLAEMPALLARLQQFDRLAKS 274


>gi|134277621|ref|ZP_01764336.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           305]
 gi|134251271|gb|EBA51350.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           305]
          Length = 284

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 120/270 (44%), Positives = 171/270 (63%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC +L +  +YKSS+DKANRSS    
Sbjct: 5   GFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++   P+LTDVH   +   +   VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILAEVKRQLNVPVLTDVHEIDEIAPVVAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAARDAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + +M   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G+AG+F+ETH +P 
Sbjct: 185 LAVMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAALATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLGRMAALLETLVTLDRAVK 274


>gi|33152005|ref|NP_873358.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus ducreyi
           35000HP]
 gi|44888089|sp|Q7VMV6|KDSA_HAEDU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|33148227|gb|AAP95747.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus ducreyi
           35000HP]
          Length = 286

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 185/280 (66%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N ++ +G    Q+  +N++ F L  G   +ES D A  + EK  A+   LN+  ++K+
Sbjct: 1   MANKSVTVG----QLEIANDRPFTLFGGMNVLESRDMAMRVCEKYVAVTNKLNVPYIFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK+ +G  I+TDVH   QC+ +A+ VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKQTFGVNIITDVHEIYQCQPVAEVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G + ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIVECGNQQIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM S  IM  +  G PVIFD +H++Q     G+ SGG R  +  LA+A +A G+AG+
Sbjct: 177 LVVDMLSFNIMKKVSDGCPVIFDVTHALQCRDPFGSASGGRRDQVTELARAGLATGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP+ A  DGP+ + +  L   ++Q+ AID ++K 
Sbjct: 237 FLEAHPDPNTAKCDGPSALPLDKLEAFVAQMKAIDNLVKS 276


>gi|157827964|ref|YP_001494206.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165932652|ref|YP_001649441.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia rickettsii
           str. Iowa]
 gi|166220457|sp|A8GQM3|KDSA_RICRS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|189028413|sp|B0BW09|KDSA_RICRO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|157800445|gb|ABV75698.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165907739|gb|ABY72035.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia rickettsii
           str. Iowa]
          Length = 274

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 155/266 (58%), Positives = 196/266 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLI GPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG++KG EI   +K ++  PI+TDVH+E QC A A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGVGIEKGLEILSKVKSEFDCPIVTDVHSESQCTATAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL   G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLETFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  +GGER+Y+  LAKAA ++GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLAKAATSVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP M+ + +L  +L +L   DKI K 
Sbjct: 248 GPCMMKLDNLESILIKLKKYDKITKE 273


>gi|328473481|gb|EGF44329.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio parahaemolyticus
           10329]
          Length = 283

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+
Sbjct: 1   MEQKIVNIGD----IKVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G   ++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKIILCERGSCHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M +   G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKNASKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L+Q+ ++D +IK 
Sbjct: 237 FIEAHPNPDQARCDGPSALPLDKLEPFLAQMKSLDDLIKS 276


>gi|315634083|ref|ZP_07889372.1| 3-deoxy-8-phosphooctulonate synthase [Aggregatibacter segnis ATCC
           33393]
 gi|315477333|gb|EFU68076.1| 3-deoxy-8-phosphooctulonate synthase [Aggregatibacter segnis ATCC
           33393]
          Length = 284

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 119/268 (44%), Positives = 174/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  + EK   + Q L +  V+K+SFDKANRSS+  
Sbjct: 9   GDIQIANDKPFVLFGGMNVLESRDMAMQVCEKYVEVTQKLGVPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF +LK+ +G  I+TDVH   QC+ +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEQGLKIFAELKQTFGVKIITDVHEIYQCQPVAEVADIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFLSP +M NI++K+   G   V+ C+RGT+FGY+ L+ DM    +M 
Sbjct: 129 ARTGAIINVKKPQFLSPGQMGNIVEKIAECGNDKVILCDRGTNFGYDNLIVDMLGFSVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           +   G PVIFD +HS+Q     G  SGG R  +  LA+A +AIG+AG+FLE H +P  A 
Sbjct: 189 NVSKGCPVIFDVTHSLQCRDPFGAASGGRRAQVTELARAGLAIGLAGLFLEAHPEPSKAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   ++Q+ A+D ++K 
Sbjct: 249 CDGPSALPLDKLEAFVAQMKAVDDLVKS 276


>gi|218549094|ref|YP_002382885.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia fergusonii
           ATCC 35469]
 gi|226722936|sp|B7LSH5|KDSA_ESCF3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|218356635|emb|CAQ89261.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia
           fergusonii ATCC 35469]
 gi|324113974|gb|EGC07948.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia fergusonii B253]
 gi|325497510|gb|EGC95369.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia fergusonii
           ECD227]
          Length = 284

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNDKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSVMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID+++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDELVKG 276


>gi|261340146|ref|ZP_05968004.1| 3-deoxy-8-phosphooctulonate synthase [Enterobacter cancerogenus
           ATCC 35316]
 gi|288317661|gb|EFC56599.1| 3-deoxy-8-phosphooctulonate synthase [Enterobacter cancerogenus
           ATCC 35316]
          Length = 284

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 172/280 (61%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSINSYRGPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVAAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M ++    PVIFD +H++Q     G  SGG R  +  LA+A +A G+AG+
Sbjct: 177 LVVDMLGFSVMKNVSNQSPVIFDVTHALQCRDPFGAASGGRRAQVTELARAGMATGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP NA  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPANAKCDGPSALPLDKLEPFLKQIKAIDDLVKS 276


>gi|254509169|ref|ZP_05121268.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus 16]
 gi|219547920|gb|EED24946.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus 16]
          Length = 283

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 126/280 (45%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+
Sbjct: 1   MEQKIVHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G  +++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVDKFSECGNDNIILCERGSCHGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKTSNGSPIIFDVTHSLQMRDPSGAASGGCREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   LSQ+ A+D +IK 
Sbjct: 237 FIEAHPNPDQARCDGPSALPLDKLEPFLSQMKALDDLIKG 276


>gi|26247539|ref|NP_753579.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli CFT073]
 gi|29336707|sp|Q8FHZ8|KDSA_ECOL6 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|26107940|gb|AAN80139.1|AE016759_413 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli CFT073]
          Length = 284

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKG 276


>gi|291617199|ref|YP_003519941.1| KdsA [Pantoea ananatis LMG 20103]
 gi|291152229|gb|ADD76813.1| KdsA [Pantoea ananatis LMG 20103]
 gi|327393654|dbj|BAK11076.1| 2-dehydro-3-deoxyphosphooctonate aldolase KdsA [Pantoea ananatis
           AJ13355]
          Length = 284

 Score =  275 bits (703), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            T   + +G     +  +N+  FVL  G   +ES+D A  I E    +   L I  V+K+
Sbjct: 1   MTQKVVSIGD----IKVANDLPFVLFGGMNVLESYDLAMRICEHYVKVTDKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF+ LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQALKQAFGVKIITDVHEASQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFAEGGNDKVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMKKVTNNSPVIFDVTHALQTRDPFGAASGGRRAQVAELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|84394469|ref|ZP_00993183.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio splendidus 12B01]
 gi|84374910|gb|EAP91843.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio splendidus 12B01]
          Length = 283

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+
Sbjct: 1   MEQKTVHIGD----MPIANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TD+HTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDIHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG V+NVKK QF+SP ++ NI+ K    G  +++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVVNVKKPQFMSPDQVGNIVDKFAECGNDNIILCERGSCMGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +H++Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKSSNGSPIIFDVTHALQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +PD A  DGP+ + +  L   L Q+ A+D +IK 
Sbjct: 237 FLEAHPNPDQARCDGPSALPLDKLEPFLKQMKALDDLIKG 276


>gi|170720608|ref|YP_001748296.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida W619]
 gi|229830621|sp|B1J5Q5|KDSA_PSEPW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|169758611|gb|ACA71927.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida W619]
          Length = 280

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 115/267 (43%), Positives = 166/267 (62%), Gaps = 2/267 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  SN   FVL  G   +ES D A     +   + + L I  V+K+SFDKANRSS+   
Sbjct: 7   NIECSNAAPFVLFGGINVLESEDLALTACAEYVRVTEKLGIPYVFKASFDKANRSSIHSY 66

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG G+++G  IF  +K ++G PI+TDVH   QC  +A+ VD+LQ+PA L RQTDL+ A A
Sbjct: 67  RGPGMEEGLRIFEKVKAEFGVPIITDVHEIYQCAPVAEVVDVLQLPAFLARQTDLVVALA 126

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ +N+KK QFLSP +M NI+QK    G   ++ C+RGT  GY+ LV DM    +M  
Sbjct: 127 KTGKPVNIKKPQFLSPSQMQNIVQKFKEAGNDQLILCDRGTCMGYDNLVVDMLGFGVMKR 186

Query: 216 MGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
                P+IFD +H++Q     G  SGG R+ +V LA+A + +G+AG+FLE H +PD A  
Sbjct: 187 TCDDLPIIFDVTHALQNRDPSGAASGGRREQVVDLARAGMGVGLAGLFLEAHPNPDQAKC 246

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGP+ + +  L   L+Q+ A+D ++K 
Sbjct: 247 DGPSALPLDKLEPFLAQIKALDDLVKS 273


>gi|15801444|ref|NP_287461.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O157:H7
           EDL933]
 gi|15830974|ref|NP_309747.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O157:H7
           str. Sakai]
 gi|187776334|ref|ZP_02801899.2| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188025066|ref|ZP_02775797.2| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4113]
 gi|189010490|ref|ZP_02807578.2| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189402551|ref|ZP_02783147.2| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189403542|ref|ZP_02796111.2| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189404429|ref|ZP_02789385.2| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189405006|ref|ZP_02812726.2| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC869]
 gi|189406126|ref|ZP_02826535.2| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC508]
 gi|195939103|ref|ZP_03084485.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O157:H7
           str. EC4024]
 gi|208807032|ref|ZP_03249369.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208815393|ref|ZP_03256572.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208822325|ref|ZP_03262644.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396605|ref|YP_002270149.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4115]
 gi|217328537|ref|ZP_03444619.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254792685|ref|YP_003077522.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli O157:H7
           str. TW14359]
 gi|261224947|ref|ZP_05939228.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261257196|ref|ZP_05949729.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           O157:H7 str. FRIK966]
 gi|20532097|sp|Q8XDE7|KDSA_ECO57 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761657|sp|B5YXN3|KDSA_ECO5E RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|12514928|gb|AAG56073.1|AE005338_13 2-dehydro-3-deoxyphosphooctulonate aldolase [Escherichia coli
           O157:H7 str. EDL933]
 gi|13361185|dbj|BAB35143.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Escherichia coli
           O157:H7 str. Sakai]
 gi|187767806|gb|EDU31650.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188015104|gb|EDU53226.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4113]
 gi|189000029|gb|EDU69015.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355000|gb|EDU73419.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189360044|gb|EDU78463.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365621|gb|EDU84037.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189372471|gb|EDU90887.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC869]
 gi|189376306|gb|EDU94722.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC508]
 gi|208726833|gb|EDZ76434.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208732041|gb|EDZ80729.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208737810|gb|EDZ85493.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209158005|gb|ACI35438.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209772490|gb|ACI84557.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Escherichia coli]
 gi|209772492|gb|ACI84558.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Escherichia coli]
 gi|209772496|gb|ACI84560.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Escherichia coli]
 gi|217318964|gb|EEC27390.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254592085|gb|ACT71446.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli
           O157:H7 str. TW14359]
 gi|320188007|gb|EFW62674.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Escherichia coli O157:H7 str. EC1212]
 gi|326342763|gb|EGD66533.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Escherichia coli O157:H7 str. 1044]
 gi|326346384|gb|EGD70121.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Escherichia coli O157:H7 str. 1125]
          Length = 284

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLRQMKAIDDLVKG 276


>gi|226945922|ref|YP_002800995.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Azotobacter vinelandii
           DJ]
 gi|259494401|sp|C1DSS7|KDSA_AZOVD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226720849|gb|ACO80020.1| 3-deoxy-8-phosphooctulonate synthase [Azotobacter vinelandii DJ]
          Length = 281

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 124/278 (44%), Positives = 169/278 (60%), Gaps = 4/278 (1%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            T   I +G     +  +N++   L  G   +ES D A  + E+   +   L I  V+K+
Sbjct: 1   MTQKTIRVGD----IEIANDRPMALFGGMNVLESRDLALRVCEEYVRVTGKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G  IF ++KK +G P+LTDVH   Q   +A+  DILQ+PA
Sbjct: 57  SFDKANRSSITSFRGPGLEEGMRIFEEVKKAFGVPVLTDVHEPWQAAPVAEVCDILQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+T  VIN+KK QFL+P EM +IL+K    G   ++ CERGTSFGYN 
Sbjct: 117 FLSRQTDLVVAMAKTSAVINIKKAQFLAPQEMQHILRKCEEAGNDQLILCERGTSFGYNN 176

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV DM    IM     PV FD +H++Q PG   + +GG R  +  LAKA ++ G+AG+FL
Sbjct: 177 LVVDMLGFGIMKQFEYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGISQGLAGLFL 236

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           E H DPDNA  DGP  + +  L   L+QL  +D ++K 
Sbjct: 237 EAHPDPDNAKCDGPCALRLDKLEPFLAQLAQLDALVKK 274


>gi|229524171|ref|ZP_04413576.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae bv. albensis VL426]
 gi|229337752|gb|EEO02769.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae bv. albensis VL426]
          Length = 283

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 124/268 (46%), Positives = 172/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ F L AG   +ES D A  I E    +   L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF++LK+ +G  I+TDVHTE Q + +AD VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMKIFQELKETFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM    +M 
Sbjct: 129 AKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDMLGFGVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H +PD A 
Sbjct: 189 QASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAHPNPDKAR 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L+Q+ A+D +IK 
Sbjct: 249 CDGPSALPLDKLEPFLAQMKALDDLIKS 276


>gi|299067178|emb|CBJ38374.1| 3-deoxy-8-phosphooctulonate synthase [Ralstonia solanacearum CMR15]
          Length = 284

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 128/270 (47%), Positives = 174/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C IES   A   A  L  I  +L I  +YKSSFDKANRSS A  
Sbjct: 5   DFEIGLDRPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDASF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  +++++ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILAEVRRQVGVPVLTDIHEIDEIKPVASVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARHAARDAGLPEDSFMACERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGVFMETHPDPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + ++ +  LLS L  +D + K
Sbjct: 245 CAKSDGPNAVPLRRMKDLLSVLKELDALTK 274


>gi|262404520|ref|ZP_06081075.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           sp. RC586]
 gi|262349552|gb|EEY98690.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           sp. RC586]
          Length = 283

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 123/268 (45%), Positives = 172/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ F L AG   +ES D A  I E    +   L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF++LK+ +G  I+TDVHT +Q + +AD VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMKIFQELKQTFGVKIITDVHTAEQAQPVADVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM    +M 
Sbjct: 129 AKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDMLGFGVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G P+IFD +HS+Q     G  SGG RQ  V LAKA +A GIAG+F+E H +P+ A 
Sbjct: 189 QASNGSPIIFDVTHSLQMRDPSGAASGGRRQQTVELAKAGLATGIAGLFIEAHPNPEKAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L+Q+ A+D +IK 
Sbjct: 249 CDGPSALPLDKLEPFLAQMKALDDLIKS 276


>gi|145637547|ref|ZP_01793204.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittHH]
 gi|145269233|gb|EDK09179.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittHH]
          Length = 284

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDVANDKPFVLFGGMNVLESRDMAMQVCESYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   + Q+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVFQMRAIDDLVKS 276


>gi|238650528|ref|YP_002916380.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia peacockii
           str. Rustic]
 gi|259494408|sp|C4K181|KDSA_RICPU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238624626|gb|ACR47332.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia peacockii
           str. Rustic]
          Length = 274

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 153/266 (57%), Positives = 195/266 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +   N+  FVLI GPCQIE  DHA  +AEKL  +   L I  +YKSSFDKANR+S+ G
Sbjct: 8   NNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG++KG +I   +K ++  PI+TDVH+E QC   A+  DILQIPA LCRQTDLL AA
Sbjct: 68  IRGVGIEKGLDILSKVKSEFDCPIVTDVHSESQCIETAEVADILQIPAFLCRQTDLLQAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+++ VKKGQFL+PW+M N+  KL   G KD+LF ERG  FGYN LV+DMRS+ IM 
Sbjct: 128 AKTGKIVKVKKGQFLAPWDMKNVQTKLETFGVKDILFTERGACFGYNNLVSDMRSLAIMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            + VPV+FDA+HSVQQPG  G  +GGER+Y+  LAKAA ++GIAG+++E HQDPDNAPSD
Sbjct: 188 ELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLAKAATSVGIAGMYMEVHQDPDNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP M+ + +L  +L +L   DKI K 
Sbjct: 248 GPCMMKLDNLESILIKLKKYDKITKE 273


>gi|262274704|ref|ZP_06052515.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Grimontia
           hollisae CIP 101886]
 gi|262221267|gb|EEY72581.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Grimontia
           hollisae CIP 101886]
          Length = 284

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 121/281 (43%), Positives = 176/281 (62%), Gaps = 6/281 (2%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           + T   + +G     +  +N++ FVL AG   +ES D A  I E    + Q L I  V+K
Sbjct: 1   MTTQKTVQIGD----IQVANDKPFVLFAGMNVLESRDLAMQICEHYVEVTQKLGIPYVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS+   RG G+++G +IF++LK+ +G  I+TDVHTE Q + +++ VD++Q+P
Sbjct: 57  ASFDKANRSSVHSYRGPGMEEGMKIFQELKETFGVKIITDVHTEAQAQPVSEVVDVIQLP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G   V+ CERG+  GY+
Sbjct: 117 AFLARQTDLVEAMAKTGSVINVKKPQFMSPGQVGNIVDKFAECGNDKVILCERGSCMGYD 176

Query: 202 TLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
            LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LA+A +   IAG
Sbjct: 177 NLVVDMLGFDVMKKASNGSPIIFDVTHSLQCRDPMGAASGGRREQTVDLARAGLGTKIAG 236

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +F+E H +PD A  DGP+ + +  L   L+Q+ A+D ++K 
Sbjct: 237 LFIEAHPEPDKARCDGPSALPLDKLEPFLTQMKALDDLVKS 277


>gi|323492373|ref|ZP_08097526.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio brasiliensis LMG
           20546]
 gi|323313420|gb|EGA66531.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio brasiliensis LMG
           20546]
          Length = 283

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+
Sbjct: 1   MEQKIVHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G ++++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVDKFSECGNENIILCERGSCHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L+Q+ A+D +IK 
Sbjct: 237 FIEAHPNPDQALCDGPSALPLDKLEPFLAQMKALDDLIKG 276


>gi|89092736|ref|ZP_01165689.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanospirillum sp.
           MED92]
 gi|89083248|gb|EAR62467.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanospirillum sp.
           MED92]
          Length = 282

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 119/265 (44%), Positives = 165/265 (62%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +N++  VL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSSL   
Sbjct: 10  GIEIANDKPMVLFGGMNVLESRDLALKIAEYYVEVTQKLGIPYVFKASFDKANRSSLTSF 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL +G +I +++K  +  P++TDVH   Q    A+  DI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGLDEGLKILQEIKDTFKVPLITDVHEPDQAAPAAEVCDIIQLPAFLSRQTDLVQAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           QT  VIN+KK QFL+P EM +IL K    G  D++ CERG+ +GYN L+ DM    IM  
Sbjct: 130 QTDAVINIKKAQFLAPQEMKHILHKCEEAGNSDLILCERGSCYGYNNLIVDMLGFSIMKE 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+H++Q PG   + +GG R     L++A ++ GIAG+FLE H DP+ A  DG
Sbjct: 190 FGYPVMFDATHALQMPGGRTDSAGGRRALAAQLSRAGLSQGIAGLFLEAHPDPEQAKCDG 249

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           P  + +  L   LSQ+ A+D ++K 
Sbjct: 250 PCALPLHTLEAYLSQMKAVDDLVKS 274


>gi|319898759|ref|YP_004158852.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella clarridgeiae 73]
 gi|319402723|emb|CBI76270.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella clarridgeiae 73]
          Length = 278

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 173/279 (62%), Positives = 216/279 (77%), Gaps = 4/279 (1%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M   NA + +G     V FSNE    LIAGPCQ+ES DHAF +A ++  I     IG VY
Sbjct: 1   MFKPNATVKVG----NVFFSNEAPLSLIAGPCQMESRDHAFEMAGRIKTIADQFGIGFVY 56

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSS+DKANR+SL+  RG+GL+K   IF DLK+++G P+LTDVHTE+QC A+A +VDILQI
Sbjct: 57  KSSYDKANRTSLSAIRGIGLEKAIAIFSDLKEEFGCPVLTDVHTEEQCMAVASAVDILQI 116

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAA+TGRVIN+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGY
Sbjct: 117 PAFLCRQTDLLIAAAKTGRVINIKKGQFLAPWDMENVLKKVTQSGNPNVMLCERGTSFGY 176

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LV+DMRS+PIM S G P+IFDA+HSVQ+PG  G+ SGG+RQ++  LA+AAV+IG+AGI
Sbjct: 177 NRLVSDMRSLPIMRSFGAPIIFDATHSVQEPGGRGSSSGGQRQFVEILARAAVSIGVAGI 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           FLETHQDPDNAPSDG NMI I +L +LL  L+  D + K
Sbjct: 237 FLETHQDPDNAPSDGLNMIKIDNLYRLLETLIDFDCLAK 275


>gi|311279356|ref|YP_003941587.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Enterobacter cloacae
           SCF1]
 gi|308748551|gb|ADO48303.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Enterobacter cloacae
           SCF1]
          Length = 284

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 121/279 (43%), Positives = 172/279 (61%), Gaps = 6/279 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH  QQ + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIKSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPQQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RGT FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFAEGGNDKVILCDRGTQFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M  +    PVIFD +H++Q     G  S G R  +  LA+A +A G+AG+
Sbjct: 177 LIVDMLGFSVMKQVSGNAPVIFDVTHALQCRDPFGAASSGRRAQVTELARAGMATGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLNKLEPFLKQIKAIDDLVK 275


>gi|28897521|ref|NP_797126.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|153840194|ref|ZP_01992861.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus
           AQ3810]
 gi|260364108|ref|ZP_05776828.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus
           K5030]
 gi|260879263|ref|ZP_05891618.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus
           AN-5034]
 gi|260897561|ref|ZP_05906057.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus
           Peru-466]
 gi|260903531|ref|ZP_05911926.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus
           AQ4037]
 gi|31076729|sp|Q87RN0|KDSA_VIBPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|28805733|dbj|BAC59010.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149746143|gb|EDM57273.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus
           AQ3810]
 gi|308086347|gb|EFO36042.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus
           Peru-466]
 gi|308089657|gb|EFO39352.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus
           AN-5034]
 gi|308110857|gb|EFO48397.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus
           AQ4037]
 gi|308114220|gb|EFO51760.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio parahaemolyticus
           K5030]
          Length = 283

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+
Sbjct: 1   MEQKIVNIGD----IQVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G   ++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKIILCERGSCHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M +   G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKNASKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L+Q+ ++D +IK 
Sbjct: 237 FIEAHPNPDQARCDGPSALPLDKLEPFLAQMKSLDDLIKS 276


>gi|17545846|ref|NP_519248.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ralstonia solanacearum
           GMI1000]
 gi|20532102|sp|Q8Y0B7|KDSA_RALSO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|17428140|emb|CAD14829.1| probable 2-dehydro-3-deoxyphosphooctonate aldolase
           (phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-d-manno-octulosonic acid 8-phosphate
           synthetase) (kdo-8-phosphate synthetase) (kdo 8-p
           synthase) (kdops) protein [Ralstonia solanacearum
           GMI1000]
          Length = 284

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 128/270 (47%), Positives = 175/270 (64%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C IES   A   A  L  I  +L I  +YKSSFDKANRSS A  
Sbjct: 5   DFEIGLDRPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDASF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+++G  I  +++++ G P+LTD+H   + + +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMEEGLRILAEVRRQVGVPVLTDIHEIDEIKPVASVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARHAARDAGLPEDSFMACERGASFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH DP 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGVFMETHPDPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + ++ +  LLS L  +D + K
Sbjct: 245 CAKSDGPNAVPLRRMKDLLSVLKELDTLTK 274


>gi|193064802|ref|ZP_03045879.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli E22]
 gi|192927487|gb|EDV82104.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli E22]
          Length = 284

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNSPVIFDVTHALQCRDPFGADSGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKG 276


>gi|145634876|ref|ZP_01790583.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittAA]
 gi|145267742|gb|EDK07739.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haemophilus influenzae
           PittAA]
          Length = 284

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 119/280 (42%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  + +G     +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+
Sbjct: 1   MQNKIVKIG----NIDIANDKPFVLFGGMNVLESRDMAMQVCESYVKVTEKLGVPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPGQMGNIMEKIEECGNDKIILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           L+ DM    +M     G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+
Sbjct: 177 LIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H +P+ A  DGP+ + +  L   + Q+ AID ++K 
Sbjct: 237 FLEAHPNPNQAKCDGPSALPLSALEGFVFQMRAIDDLVKS 276


>gi|203282532|pdb|3E9A|A Chain A, Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctonate
           Aldolase From Vibrio Cholerae O1 Biovar Eltor Str.
           N16961
          Length = 286

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 124/268 (46%), Positives = 172/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ F L AG   +ES D A  I E    +   L I  V+K+SFDKANRSS+  
Sbjct: 12  GDIPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHS 71

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF++LK+ +G  I+TDVHTE Q + +AD VD++Q+PA L RQTDL+ A 
Sbjct: 72  YRGPGLEEGMKIFQELKETFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQTDLVEAM 131

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM    +M 
Sbjct: 132 AKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDMLGFGVMK 191

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H +PD A 
Sbjct: 192 QASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAHPNPDKAR 251

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L+Q+ A+D +IK 
Sbjct: 252 CDGPSALPLDKLEPFLAQMKALDDLIKS 279


>gi|15642174|ref|NP_231806.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121586782|ref|ZP_01676564.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae 2740-80]
 gi|121727215|ref|ZP_01680382.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae V52]
 gi|147674359|ref|YP_001217691.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae O395]
 gi|153213284|ref|ZP_01948696.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae 1587]
 gi|153801646|ref|ZP_01956232.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MZO-3]
 gi|153818804|ref|ZP_01971471.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae NCTC
           8457]
 gi|153823570|ref|ZP_01976237.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae B33]
 gi|153825577|ref|ZP_01978244.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MZO-2]
 gi|153828651|ref|ZP_01981318.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae 623-39]
 gi|227082300|ref|YP_002810851.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae M66-2]
 gi|229507747|ref|ZP_04397252.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae BX 330286]
 gi|229512017|ref|ZP_04401496.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae B33]
 gi|229519153|ref|ZP_04408596.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae RC9]
 gi|229522126|ref|ZP_04411543.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae TM 11079-80]
 gi|229528818|ref|ZP_04418208.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae 12129(1)]
 gi|229607292|ref|YP_002877940.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MJ-1236]
 gi|254291406|ref|ZP_04962199.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae
           AM-19226]
 gi|254849254|ref|ZP_05238604.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MO10]
 gi|255745096|ref|ZP_05419045.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholera CIRS 101]
 gi|262167524|ref|ZP_06035230.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae RC27]
 gi|298497810|ref|ZP_07007617.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio cholerae MAK 757]
 gi|20532143|sp|Q9KQ29|KDSA_VIBCH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|172047627|sp|A5F692|KDSA_VIBC3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|254807754|sp|C3LPI0|KDSA_VIBCM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|9656729|gb|AAF95320.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121548949|gb|EAX58988.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae 2740-80]
 gi|121630460|gb|EAX62853.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae V52]
 gi|124116084|gb|EAY34904.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae 1587]
 gi|124122823|gb|EAY41566.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MZO-3]
 gi|126510647|gb|EAZ73241.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae NCTC
           8457]
 gi|126518905|gb|EAZ76128.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae B33]
 gi|146316242|gb|ABQ20781.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae O395]
 gi|148875922|gb|EDL74057.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae 623-39]
 gi|149740728|gb|EDM54827.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MZO-2]
 gi|150422736|gb|EDN14690.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae
           AM-19226]
 gi|227010188|gb|ACP06400.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae M66-2]
 gi|227014071|gb|ACP10281.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae O395]
 gi|229332592|gb|EEN98078.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae 12129(1)]
 gi|229341051|gb|EEO06056.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae TM 11079-80]
 gi|229343842|gb|EEO08817.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae RC9]
 gi|229351982|gb|EEO16923.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae B33]
 gi|229355252|gb|EEO20173.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae BX 330286]
 gi|229369947|gb|ACQ60370.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae MJ-1236]
 gi|254844959|gb|EET23373.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae MO10]
 gi|255736926|gb|EET92322.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholera CIRS 101]
 gi|262024096|gb|EEY42791.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae RC27]
 gi|297542143|gb|EFH78193.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio cholerae MAK 757]
 gi|327484697|gb|AEA79104.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae LMA3894-4]
          Length = 283

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 124/268 (46%), Positives = 172/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ F L AG   +ES D A  I E    +   L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF++LK+ +G  I+TDVHTE Q + +AD VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMKIFQELKETFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM    +M 
Sbjct: 129 AKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDMLGFGVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H +PD A 
Sbjct: 189 QASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAHPNPDKAR 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L+Q+ A+D +IK 
Sbjct: 249 CDGPSALPLDKLEPFLAQMKALDDLIKS 276


>gi|269961573|ref|ZP_06175935.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio harveyi 1DA3]
 gi|269833614|gb|EEZ87711.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio harveyi 1DA3]
          Length = 283

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 178/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+
Sbjct: 1   MEQKIVNIGD----IQVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G ++++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNENIILCERGSCHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M +   G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKNASKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L+Q+ ++D +IK 
Sbjct: 237 FIEAHPNPDQARCDGPSALPLDKLEPFLAQMKSLDDLIKS 276


>gi|213157542|ref|YP_002319587.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AB0057]
 gi|213056702|gb|ACJ41604.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AB0057]
          Length = 297

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 127/266 (47%), Positives = 169/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL  
Sbjct: 13  GDIQMANHLPFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLHS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG E   D+KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 73  FRGPGLEKGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAM 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM 
Sbjct: 133 AKTQAIINIKKAQFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMK 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE+H DPD A  D
Sbjct: 193 EMNVPVFFDVTHALQTPGGRSDSAGGRRAQITTLARAGMATGLAGLFLESHPDPDKAKCD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP+ + +  L   L+QL  +D ++K 
Sbjct: 253 GPSALRLSQLEPFLAQLKELDTLVKG 278


>gi|262394968|ref|YP_003286822.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           sp. Ex25]
 gi|269965451|ref|ZP_06179570.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio alginolyticus
           40B]
 gi|262338562|gb|ACY52357.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           sp. Ex25]
 gi|269829930|gb|EEZ84160.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio alginolyticus
           40B]
          Length = 283

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+
Sbjct: 1   MEQKIVNIGD----IQVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G   ++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKIILCERGSCHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M +   G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKNASKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L+Q+ ++D +IK 
Sbjct: 237 FIEAHPNPDQARCDGPSALPLDKLEPFLAQMKSLDDLIKS 276


>gi|309388532|gb|ADO76412.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Halanaerobium praevalens
           DSM 2228]
          Length = 281

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 134/267 (50%), Positives = 185/267 (69%), Gaps = 1/267 (0%)

Query: 34  KNQVTFSN-EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
             +V F + E+ FVL+AGPC IE  D    IAE +  I   L I  V+K+SFDKANRSS+
Sbjct: 8   NEEVIFGDQEKPFVLLAGPCAIEEEDRVLRIAEGIKEITSKLGIPYVFKASFDKANRSSI 67

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG GL+KG EI   +KK++  P+++D+H  +Q  A AD +DI+QIPA L RQTD+LT
Sbjct: 68  ESYRGPGLEKGLEILAKVKKEFDLPVISDIHLPEQAAAAADVLDIMQIPAFLSRQTDMLT 127

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           AA +TG +INVKKGQFL+PW++  ++ K+ + G + ++  ERG SFGYN LV DMRS+P 
Sbjct: 128 AAGKTGSIINVKKGQFLAPWDIDQVVAKIESTGNEKIILTERGVSFGYNNLVVDMRSLPR 187

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M   G PV+FDA+H+VQ PG  G+ S GE++Y+  L +AA+A GI  +F+E H +P  A 
Sbjct: 188 MRKTGYPVVFDATHAVQLPGGAGDSSDGEKEYVPYLMRAALAAGIDSLFMEVHDNPAVAK 247

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
           SDG NMI + +L ++L Q LAID+ +K
Sbjct: 248 SDGANMIPLVNLEEILKQGLAIDQAVK 274


>gi|261209902|ref|ZP_05924203.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           sp. RC341]
 gi|260841088|gb|EEX67613.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           sp. RC341]
          Length = 283

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 122/268 (45%), Positives = 172/268 (64%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ F L AG   +ES D A  I E    + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIPVANDKPFTLFAGMNVLESRDLAMQICEYYVKVTEKLGIPYVFKASFDKANRSSVHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF++LK+ +G  I+TDVHT +Q + +AD VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMKIFQELKQTFGVKIITDVHTAEQAQPVADVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM    +M 
Sbjct: 129 AKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDMLGFGVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H +P+ A 
Sbjct: 189 QASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAHPNPEKAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L Q+ A+D +IK 
Sbjct: 249 CDGPSALPLDKLEPFLVQMKALDDLIKS 276


>gi|171463597|ref|YP_001797710.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171193135|gb|ACB44096.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 287

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 138/265 (52%), Positives = 179/265 (67%), Gaps = 5/265 (1%)

Query: 39  FSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGV 98
              ++RF LIAGPC IES   A  IA +L  I  SL I  +YKSSFDKANRSS    RG+
Sbjct: 11  VGLDRRFFLIAGPCVIESEQSAIDIAGQLKEITASLKIPFIYKSSFDKANRSSGTSFRGL 70

Query: 99  GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTG 158
           G++KG EI   +KK+    +LTDVH   +  A+A  VD+LQ PA LCRQTD + A AQ+G
Sbjct: 71  GMEKGLEILSKVKKQIDVLVLTDVHDISEIAAVASVVDVLQTPAFLCRQTDFIRACAQSG 130

Query: 159 RVINVKKGQFLSPWEMHNILQKLHAHG-----AKDVLFCERGTSFGYNTLVTDMRSIPIM 213
           + +N KKGQFLSP EM N+++K  A           + CERG SFGYN LV+DMRS+ I+
Sbjct: 131 KPVNFKKGQFLSPHEMLNVIEKARAAALEIGLPDQFMVCERGASFGYNNLVSDMRSLAIL 190

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
                PV+FDA+HSVQ PG  GN SGG+R+++  LA+AAVA+GI+G+F+ETH DP  A S
Sbjct: 191 RESEAPVVFDATHSVQLPGGQGNSSGGQREFVPVLARAAVAVGISGLFMETHPDPAKALS 250

Query: 274 DGPNMINIKDLPKLLSQLLAIDKII 298
           DGPN + +  +  LL+ L+AID I+
Sbjct: 251 DGPNAVPLNRMKDLLASLVAIDDIV 275


>gi|294635787|ref|ZP_06714247.1| 3-deoxy-8-phosphooctulonate synthase [Edwardsiella tarda ATCC
           23685]
 gi|291090887|gb|EFE23448.1| 3-deoxy-8-phosphooctulonate synthase [Edwardsiella tarda ATCC
           23685]
          Length = 284

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 123/279 (44%), Positives = 176/279 (63%), Gaps = 6/279 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----IQVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVHT +Q + +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHTPEQAQPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPGQMGNIVDKFQEGGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M +   G PVIFD +H++Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 177 LVVDMLGFGVMKNVSHGAPVIFDVTHALQCRDPFGAASGGRRAQVAELARSGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+E H DP +A  DGP+ + +  L   L Q+ AID ++K
Sbjct: 237 FIEAHPDPAHALCDGPSALPLDKLEPFLVQMKAIDDLVK 275


>gi|261343906|ref|ZP_05971551.1| 3-deoxy-8-phosphooctulonate synthase [Providencia rustigianii DSM
           4541]
 gi|282568292|gb|EFB73827.1| 3-deoxy-8-phosphooctulonate synthase [Providencia rustigianii DSM
           4541]
          Length = 284

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  + E    + Q L I  V+K+
Sbjct: 1   MQQKVVSIGD----IKVANDLPFVLFGGMNVLESRDMAMKVCEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF+++K+ +G  I+TDVHT +Q +  A+ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGLKIFQEIKQTFGVKIITDVHTPEQAQPAAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+T  VIN+KK QF+SP ++ NI++K    G   ++ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVAAMAKTDAVINIKKPQFISPGQIGNIVEKFIEGGNDQIILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +HS+Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFNVMMQASKGCPVIFDVTHSLQCRDPFGAASGGRRGQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE+H DPDNA  DGP+ + +  L   L Q+ AID+++K 
Sbjct: 237 FLESHPDPDNARCDGPSALPLDKLEPFLKQVQAIDELVKS 276


>gi|126727430|ref|ZP_01743264.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacterales
           bacterium HTCC2150]
 gi|126703210|gb|EBA02309.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacterales
           bacterium HTCC2150]
          Length = 277

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 141/264 (53%), Positives = 190/264 (71%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            V   N+   + I+GPCQ+ES DHA MIA ++  IC       V+K+S+DKANRSSL G 
Sbjct: 8   GVQVGNDLPLLFISGPCQLESADHAQMIAGRMKEICAEFGASYVFKASYDKANRSSLGGV 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+  G +  + ++   G P++TDVH   QC  +A+ VDILQIPA LCRQTDLL AA 
Sbjct: 68  RGMGMAAGLKALQSVRDTIGVPVITDVHGPDQCAEVAEVVDILQIPAFLCRQTDLLLAAG 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
            TG+ +NVKKGQFL+PWEM N++ K+ + G +++L  ERGTSFGYNTLV DMRS+P M  
Sbjct: 128 NTGKAVNVKKGQFLAPWEMPNVVDKVASTGNQNILLTERGTSFGYNTLVADMRSLPQMMK 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PVI DA+HSVQQPG  G  SGG+R++   +A+ AV++G+AG+F+ETH+DPDNAPSDG
Sbjct: 188 TEYPVIMDATHSVQQPGGLGGSSGGQREFAPVMARCAVSMGLAGLFIETHEDPDNAPSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
           PN I +  +P+L+  L+A D++ K
Sbjct: 248 PNTIALDQMPRLVESLMAFDRLAK 271


>gi|162286730|ref|YP_001084928.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           ATCC 17978]
 gi|169795767|ref|YP_001713560.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AYE]
 gi|184158328|ref|YP_001846667.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           ACICU]
 gi|215483252|ref|YP_002325459.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           AB307-0294]
 gi|239503987|ref|ZP_04663297.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AB900]
 gi|260550310|ref|ZP_05824522.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp.
           RUH2624]
 gi|260554830|ref|ZP_05827051.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii ATCC
           19606]
 gi|301347093|ref|ZP_07227834.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AB056]
 gi|301511878|ref|ZP_07237115.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AB058]
 gi|301596844|ref|ZP_07241852.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AB059]
 gi|332853322|ref|ZP_08434701.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           6013150]
 gi|332871180|ref|ZP_08439757.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           6013113]
 gi|332873444|ref|ZP_08441396.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           6014059]
 gi|226722927|sp|B7H226|KDSA_ACIB3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238685516|sp|A3M5Y2|KDSA_ACIBT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238688035|sp|B0V676|KDSA_ACIBY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238691017|sp|B2I2A6|KDSA_ACIBC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|169148694|emb|CAM86560.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           AYE]
 gi|183209922|gb|ACC57320.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Acinetobacter baumannii ACICU]
 gi|193077499|gb|ABO12326.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           ATCC 17978]
 gi|213988473|gb|ACJ58772.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           AB307-0294]
 gi|260406622|gb|EEX00103.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp.
           RUH2624]
 gi|260411372|gb|EEX04669.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii ATCC
           19606]
 gi|322508655|gb|ADX04109.1| kdsA [Acinetobacter baumannii 1656-2]
 gi|323518263|gb|ADX92644.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332728721|gb|EGJ60084.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           6013150]
 gi|332731665|gb|EGJ62948.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           6013113]
 gi|332738332|gb|EGJ69207.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter baumannii
           6014059]
          Length = 285

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 127/266 (47%), Positives = 169/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL  
Sbjct: 13  GDIQMANHLPFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLHS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG E   D+KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 73  FRGPGLEKGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAM 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM 
Sbjct: 133 AKTQAIINIKKAQFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMK 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE+H DPD A  D
Sbjct: 193 EMNVPVFFDVTHALQTPGGRSDSAGGRRAQITTLARAGMATGLAGLFLESHPDPDKAKCD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP+ + +  L   L+QL  +D ++K 
Sbjct: 253 GPSALRLSQLEPFLAQLKELDTLVKG 278


>gi|126438977|ref|YP_001059604.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 668]
 gi|126218470|gb|ABN81976.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           668]
          Length = 284

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 122/270 (45%), Positives = 172/270 (63%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC +L +  +YKSS+DKANRSS    
Sbjct: 5   GFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLQEICATLGVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  ++K++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               + CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAARDAGLSEDRFMACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AA+A G+AG+F+ETH +P 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAALATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 EAKSDGPNAVPLGRMAALLETLVTLDRAVK 274


>gi|226954260|ref|ZP_03824724.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp. ATCC
           27244]
 gi|294650464|ref|ZP_06727823.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter haemolyticus
           ATCC 19194]
 gi|226834988|gb|EEH67371.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp. ATCC
           27244]
 gi|292823607|gb|EFF82451.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 285

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 126/266 (47%), Positives = 168/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL  
Sbjct: 13  GDIQMANHLPFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLNS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG E   D+KK++  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 73  FRGPGLEKGIEWLADIKKQFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAM 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM 
Sbjct: 133 AKTQAIINIKKAQFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMK 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP+ A  D
Sbjct: 193 EMNVPVFFDVTHALQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEAHPDPEKAKCD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL  +D ++K 
Sbjct: 253 GPCALRLSQLEPFLAQLKELDTLVKG 278


>gi|237731776|ref|ZP_04562257.1| KDO-8-phosphate synthetase [Citrobacter sp. 30_2]
 gi|226907315|gb|EEH93233.1| KDO-8-phosphate synthetase [Citrobacter sp. 30_2]
          Length = 284

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K H  G   V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFHEGGNDKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSVMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP NA  DGP+ + +  L + L+Q+ AID ++K 
Sbjct: 237 FIEAHPDPANAKCDGPSALPLAKLEQFLTQIKAIDDLVKS 276


>gi|56751820|ref|YP_172521.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus elongatus
           PCC 6301]
 gi|81561716|sp|Q5N119|KDSA_SYNP6 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|56686779|dbj|BAD80001.1| carboxysome formation protein CcmA [Synechococcus elongatus PCC
           6301]
          Length = 284

 Score =  275 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 130/264 (49%), Positives = 180/264 (68%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           ++ +  +     L  GPC IE  D +  +AE +  +C  L +  V+KSSFDKANR+S+  
Sbjct: 13  DRFSIGDGCPLTLFGGPCVIEGEDFSLKMAESIAKVCDRLGVQFVFKSSFDKANRTSIGS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  I   +K + G P+LTD+H  QQ   +A+ VDILQIPA LCRQTDLL AA
Sbjct: 73  FRGYGLEEGLRILERVKTELGLPVLTDIHESQQAATVAEVVDILQIPAFLCRQTDLLLAA 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A TGR +NVKK QFL+PW+M N++ KL   GA+++L  ERG+ FGYN LV D RS+P+M 
Sbjct: 133 AATGRTVNVKKAQFLAPWDMKNVVNKLRQGGAENLLLTERGSCFGYNALVVDFRSLPLMR 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            +G PV+FDA+HSVQ PG  G+ S G+R+++  LA+AA A+GI  +F+E H++PD A SD
Sbjct: 193 ELGCPVVFDATHSVQIPGGAGDRSSGQREFVPVLARAAAAVGIDALFMEIHENPDQALSD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKII 298
           GPNMI + DL   L  +L + + +
Sbjct: 253 GPNMIRLADLEATLRHILRVREAV 276


>gi|156973553|ref|YP_001444460.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio harveyi ATCC
           BAA-1116]
 gi|166220461|sp|A7MY69|KDSA_VIBHB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|156525147|gb|ABU70233.1| hypothetical protein VIBHAR_01254 [Vibrio harveyi ATCC BAA-1116]
          Length = 283

 Score =  275 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 178/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N++ F L AG   +ES D A  I E    +   L I  V+K+
Sbjct: 1   MEQKIVNIGD----IQVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G ++++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNENIILCERGSCMGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M +   G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKNASKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L+Q+ ++D +IK 
Sbjct: 237 FIEAHPNPDQARCDGPSALPLDKLEPFLAQMKSLDDLIKS 276


>gi|254786813|ref|YP_003074242.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Teredinibacter turnerae
           T7901]
 gi|237685653|gb|ACR12917.1| 3-deoxy-8-phosphooctulonate synthase [Teredinibacter turnerae
           T7901]
          Length = 283

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 122/269 (45%), Positives = 171/269 (63%), Gaps = 2/269 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ F L  G   +ES D A  IAEK   + Q L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIDVANDKPFTLFGGMNVLESQDLALKIAEKYVQVTQKLGIPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G++KG  IF  +KK++G P++TDVH  QQ   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEKGLRIFEAVKKEFGIPVITDVHEPQQAAPVAEVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  VINVKK QFLSP +M NI++K    G ++V+ CERG   GY+ LV DM     M 
Sbjct: 129 AKTDAVINVKKPQFLSPGQMRNIVEKFAEGGNENVILCERGACMGYDNLVVDMLGFRTMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G+PVIFD +H++Q     G  SGG RQ    LA+A +A+G+AG+F+E H +P+ A 
Sbjct: 189 EVSNGLPVIFDVTHALQCRDPLGAASGGRRQQTAELARAGLAVGLAGLFIEAHPNPNEAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
            DGP+ + +  L   L Q+ A+D ++K L
Sbjct: 249 CDGPSALPLDKLEPFLGQMKAVDNLVKVL 277


>gi|156933680|ref|YP_001437596.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cronobacter sakazakii
           ATCC BAA-894]
 gi|166199033|sp|A7MKA7|KDSA_ENTS8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|156531934|gb|ABU76760.1| hypothetical protein ESA_01502 [Cronobacter sakazakii ATCC BAA-894]
          Length = 284

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVHT +Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHTAEQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G + V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFISPGQIGNIVDKFKEGGNEQVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  S G R  +  LA+A +A G+AG+
Sbjct: 177 LVVDMLGFGVMKKVSGNAPVIFDVTHALQCRDPFGAASSGRRAQVTELARAGMATGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP+NA  DGP+ + +  L   L+Q+ AID ++K 
Sbjct: 237 FIEAHPDPENAKCDGPSALPLAKLEAFLTQIKAIDDLVKS 276


>gi|940498|emb|CAA29067.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase
           [Escherichia coli]
 gi|225957|prf||1404365B kdsA gene
          Length = 284

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL+ G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLLGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKG 276


>gi|323496833|ref|ZP_08101870.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio sinaloensis DSM
           21326]
 gi|323318092|gb|EGA71066.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio sinaloensis DSM
           21326]
          Length = 283

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 179/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+
Sbjct: 1   MEQKIVHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE+Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEEQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G ++++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVDKFAECGNENIILCERGSCHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L+Q+ A+D++IK 
Sbjct: 237 FIEAHPNPDQARCDGPSALPLDKLEPFLAQMKALDELIKG 276


>gi|260779381|ref|ZP_05888273.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260605545|gb|EEX31840.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 283

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+
Sbjct: 1   MEQKIVHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G  +++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVDKFSECGNDNIILCERGSCHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKASKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L+Q+ A+D +IK 
Sbjct: 237 FIEAHPNPDQAKCDGPSALPLDKLEPFLAQMKALDDLIKG 276


>gi|167570507|ref|ZP_02363381.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           oklahomensis C6786]
          Length = 284

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 123/270 (45%), Positives = 172/270 (63%), Gaps = 6/270 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 ++ F LIAG C +ES       A +L  IC  L +  +YKSS+DKANRSS    
Sbjct: 5   GFEAGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLGVPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I  +++++   P+LTDVH   +   +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGLGMDEGLRILAEVRRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+P +M N++ K               L CERG SFGYN LV+DMRS
Sbjct: 125 QSGKPVNIKKGQFLAPHDMKNVIDKARDAARDAGLSEDRFLACERGVSFGYNNLVSDMRS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           + IM   G PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA G+AG+F+ETH +P 
Sbjct: 185 LAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGVAGLFMETHPNPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +A SDGPN + +  +  LL  L+ +D+ +K
Sbjct: 245 DARSDGPNAVPLGRMAALLETLVTLDRAVK 274


>gi|56460028|ref|YP_155309.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Idiomarina loihiensis
           L2TR]
 gi|56179038|gb|AAV81760.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Idiomarina loihiensis L2TR]
          Length = 280

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 116/266 (43%), Positives = 171/266 (64%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +NE+ FVL  G   +ES D A  IAE    +   L I  V+K+SFDKANRSS+  
Sbjct: 8   GDIQIANEKPFVLFGGMNVLESRDLALRIAEHYVEVTSRLGIPYVFKASFDKANRSSIHS 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF ++K+++  P++TDVH   Q   +A+ VD+LQ+PA L RQTDL+ A 
Sbjct: 68  FRGPGLEEGLRIFEEVKQQFNVPLITDVHEPHQAAPVAEVVDVLQLPAFLARQTDLVVAL 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG ++N+KK QFL+P EM +I++K    G + ++ CERG+SFGYN L+ DM  +  M 
Sbjct: 128 AETGSMVNIKKPQFLAPQEMKHIIKKFGEAGNEKLMLCERGSSFGYNNLIVDMLGMDEMK 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M   VIFDA+H++Q+PG   + + G R     LA++ +++GIAG+F+E H +PD A  D
Sbjct: 188 PMAP-VIFDATHALQRPGGRADSADGRRAQAAQLARSGMSLGIAGLFIEAHPNPDEAKCD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L Q+ AID ++K 
Sbjct: 247 GPCALPLHALEPYLQQMKAIDDLVKS 272


>gi|91228931|ref|ZP_01262829.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio alginolyticus
           12G01]
 gi|91187514|gb|EAS73848.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio alginolyticus
           12G01]
          Length = 283

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+
Sbjct: 1   MEQKIVNIGD----IQVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +I ++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKILQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G   ++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKIILCERGSCHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M +   G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKNASKGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +PD A  DGP+ + +  L   L+Q+ ++D +IK 
Sbjct: 237 FIEAHPNPDQARCDGPSALPLDKLEPFLAQMKSLDDLIKS 276


>gi|191171084|ref|ZP_03032635.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli F11]
 gi|190908816|gb|EDV68404.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli F11]
 gi|324015635|gb|EGB84854.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 60-1]
          Length = 284

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYLTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKG 276


>gi|258645776|ref|ZP_05733245.1| 3-deoxy-8-phosphooctulonate synthase [Dialister invisus DSM 15470]
 gi|260403147|gb|EEW96694.1| 3-deoxy-8-phosphooctulonate synthase [Dialister invisus DSM 15470]
          Length = 273

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 125/267 (46%), Positives = 170/267 (63%), Gaps = 4/267 (1%)

Query: 37  VTFSN----EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
           +   N      R  LIAGPC IE +D   MI  ++  IC+ L +  ++K+SFDKANRSS 
Sbjct: 4   IQVGNLTIDGSRLFLIAGPCVIEGYDRTLMIGREVKRICEKLGVQYIFKASFDKANRSSY 63

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG GL++G  + + +KK+   P+L+DVH   Q E  A+ +D+LQIPA LCRQTDL+ 
Sbjct: 64  HSFRGPGLEEGLRVLKSIKKELDVPVLSDVHDVTQLEKAAEVLDMLQIPAFLCRQTDLVY 123

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
            AA TG+ +NVKKGQF++P +M N+L K+      ++   ERG SFGY+ LV DMRS PI
Sbjct: 124 GAAMTGKPVNVKKGQFMAPEDMKNVLNKMEEAHNPNLAVTERGVSFGYHNLVVDMRSFPI 183

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M   G PVI+DA+HSVQ PG  G  +GG+R  I  LA+AA A G+ G F+E H +P    
Sbjct: 184 MRKFGYPVIYDATHSVQLPGAMGTVTGGQRDMIPYLARAAAASGVDGFFMEVHDNPPEGL 243

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
           SD  NM+ +  L  LL  L+ I++I+K
Sbjct: 244 SDSTNMLYLSSLEGLLKDLIKINEIVK 270


>gi|110641445|ref|YP_669175.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli 536]
 gi|123344085|sp|Q0TIF5|KDSA_ECOL5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|110343037|gb|ABG69274.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli 536]
          Length = 284

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYLTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAPSGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKG 276


>gi|87123161|ref|ZP_01079012.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase
           [Synechococcus sp. RS9917]
 gi|86168881|gb|EAQ70137.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase
           [Synechococcus sp. RS9917]
          Length = 283

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 123/269 (45%), Positives = 178/269 (66%), Gaps = 2/269 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             ++F+N+  FVLI G   +ES D A  +A    A+C+ L+I LV+K+SFDKANRSS+  
Sbjct: 9   GTLSFANDAPFVLIGGVNVLESRDFALEVAGHYKAVCERLDIPLVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL +G  + + +K ++G P++TDVHT +Q    A   DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLNEGLAMLQAVKARHGIPVITDVHTPEQAAPAAAVCDIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFLSP +M N+++K    G + +L CERG++FGY+ LV DM    +M 
Sbjct: 129 ARTGAVINIKKPQFLSPSQMANVVEKFRECGNERLLICERGSNFGYDNLVVDMLGFGVMK 188

Query: 215 SMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
                 P+IFD +H++Q     G  SGG R  ++ LA+A +A+G+AG+FLE+H DPD A 
Sbjct: 189 RCCNDLPLIFDVTHALQCRDPGGAASGGRRSQVLELARAGMAVGLAGLFLESHPDPDQAR 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
            DGP+ + ++ L   LSQL A+D ++K L
Sbjct: 249 CDGPSALPLEQLEPFLSQLKAVDHLVKNL 277


>gi|319405525|emb|CBI79144.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Bartonella sp. AR 15-3]
          Length = 278

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 169/271 (62%), Positives = 210/271 (77%)

Query: 29  HLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKAN 88
            +      V FSNE    LIAGPCQ+ES DHAF +A ++  I   L IG VYKSS+DKAN
Sbjct: 5   DITVKVGNVVFSNEAPLSLIAGPCQMESRDHAFEMAGRIKTITDQLGIGFVYKSSYDKAN 64

Query: 89  RSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQT 148
           R+SL   RG+GL+K   IF DLKK++G P+LTDVHTE+QC  +A  VD+LQIPA LCRQT
Sbjct: 65  RTSLNATRGIGLEKAIAIFSDLKKEFGCPVLTDVHTEEQCMRVASVVDVLQIPAFLCRQT 124

Query: 149 DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMR 208
           DLL +AA+TG VIN+KKGQFL+PW+M N+L+K+   G  +V+ CERGTSFGYN LV+DMR
Sbjct: 125 DLLVSAARTGCVINIKKGQFLAPWDMENVLEKVTKSGNPNVMLCERGTSFGYNHLVSDMR 184

Query: 209 SIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP 268
           S+PIM S GVPVIFDA+HSVQ+PG  G+ SGG+RQ++  LA+AAV+IG+AGIFLETHQDP
Sbjct: 185 SLPIMRSFGVPVIFDATHSVQEPGGRGSSSGGQRQFVEVLARAAVSIGVAGIFLETHQDP 244

Query: 269 DNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           DNAPSDG NMI I +L +LL  L+  D++ K
Sbjct: 245 DNAPSDGLNMIKIDNLYRLLEILIDFDRLAK 275


>gi|229513821|ref|ZP_04403283.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae TMA 21]
 gi|297582068|ref|ZP_06943987.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae RC385]
 gi|229349002|gb|EEO13959.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           cholerae TMA 21]
 gi|297533763|gb|EFH72605.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio cholerae RC385]
          Length = 283

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 124/268 (46%), Positives = 171/268 (63%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N + F L AG   +ES D A  I E    +   L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIPVANNKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF++LK+ +G  I+TDVHTE Q + +AD VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLEEGMKIFQELKETFGVKIITDVHTEAQAQPVADVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QF+SP ++ NI++K    G   V+ CERG+  GY+ LV DM    +M 
Sbjct: 129 AKTGAVINVKKPQFMSPGQVGNIVEKFAECGNDKVILCERGSCHGYDNLVVDMLGFGVMK 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+F+E H +PD A 
Sbjct: 189 QASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGLFIEAHPNPDKAR 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L+Q+ A+D +IK 
Sbjct: 249 CDGPSALPLDKLEPFLAQMKALDDLIKS 276


>gi|90416189|ref|ZP_01224121.1| 2-dehydro-3-deoxyphosphooctonate aldolase [marine gamma
           proteobacterium HTCC2207]
 gi|90331914|gb|EAS47128.1| 2-dehydro-3-deoxyphosphooctonate aldolase [marine gamma
           proteobacterium HTCC2207]
          Length = 283

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 119/267 (44%), Positives = 166/267 (62%), Gaps = 2/267 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  SN+   VL  G   +ES D A  IAE      + L I  V+K+SFDKANRSS+   
Sbjct: 10  DIDVSNDAPMVLFGGMNVLESRDMAMQIAEAYVRATEKLGIPYVFKASFDKANRSSITSY 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL +G +IF+++K+ +  P++TDVH  +Q + +A+  D++Q+PA L RQTDL+ A A
Sbjct: 70  RGPGLDEGLKIFQEIKQTFNIPLITDVHEIEQAKPVAEVCDVIQLPAFLARQTDLVQAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG VINVKK QFLSP +M NI+ K    G   ++ CERGT  GY+ LV DM     M  
Sbjct: 130 ETGAVINVKKPQFLSPGQMGNIVDKFRECGNDQIMLCERGTCMGYDNLVVDMLGFRTMKD 189

Query: 216 M--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
           +  G+P+IFD +H++Q     G  SGG R  +  L +A +A+GIAG+FLE H DPD A  
Sbjct: 190 VSGGLPLIFDVTHALQCRDPLGAASGGRRHQVAELGRAGIAVGIAGLFLEAHPDPDQARC 249

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGP+ + +  L   L+Q+ A D +IK 
Sbjct: 250 DGPSALPLDKLEPFLAQMKAFDDLIKS 276


>gi|300723057|ref|YP_003712355.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629572|emb|CBJ90175.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Xenorhabdus
           nematophila ATCC 19061]
          Length = 284

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 124/280 (44%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N   FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MQQKVVNIGD----IKVANNLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIRSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VIN+KK QF+SP +M NI++K    G + ++ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINIKKPQFVSPGQMGNIVEKFKEGGNEQIILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +HS+Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFGVMQQATGGAPVIFDVTHSLQCRDPFGAASGGRRAQVAELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP+NA  DGP+ + +  L   L+Q+ AID ++K 
Sbjct: 237 FLEAHPDPENARCDGPSALPLAKLEPFLAQMKAIDDVVKG 276


>gi|37525990|ref|NP_929334.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|44888083|sp|Q7N583|KDSA_PHOLL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|36785420|emb|CAE14366.1| 2-dehydro-3-deoxyphosphooctonate aldolase
           (Phospho-2-dehydro-3-deoxyoctonate aldolase)
           (3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthetase) (KDO-8-phosphate synthetase) (KDO 8-P
           synthase) [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 284

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 127/280 (45%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +H+G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MQQKVVHIGD----IKVANDLPFVLFGGMNVLESRDLAMSICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHESAQAQPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFISPGQMGNIVDKFKEGGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +HS+Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMAQATGGHPVIFDVTHSLQCRDPFGAASGGRRAQVAELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP NA  DGP+ + +  L   LSQ+ AID ++K 
Sbjct: 237 FLEAHPDPANAMCDGPSALPLAKLEPFLSQMKAIDDVVKS 276


>gi|89068526|ref|ZP_01155923.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanicola granulosus
           HTCC2516]
 gi|89045945|gb|EAR52005.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanicola granulosus
           HTCC2516]
          Length = 277

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 145/265 (54%), Positives = 196/265 (73%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             VTF N++  V+IAGPCQ+ES DHA  IAE++   C +   G V+K+S+DKANR+SL G
Sbjct: 7   GGVTFGNDRPLVVIAGPCQLESRDHALRIAEEMARACAAAGAGYVFKASYDKANRTSLEG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           +RG+G+ +G  +  D++   G P+LTD+H E  C   A++VDILQIPA LCRQTDLL AA
Sbjct: 67  RRGLGMDEGLRVLADVRAALGCPVLTDIHAEAHCAPAAEAVDILQIPAFLCRQTDLLLAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG  INVKKGQFL+PW+M N+  K+ + G + +L  ERG SFGYN LVTDMR++PIM 
Sbjct: 127 GRTGAAINVKKGQFLAPWDMANVAAKVASTGNERILLTERGVSFGYNALVTDMRALPIMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+ DA+H+VQQPG  G  SGG+R++   LA+AAV++GIA +F+ETH+DPDNAPSD
Sbjct: 187 RTGYPVVMDATHAVQQPGGRGGSSGGQREFAPVLARAAVSLGIASVFIETHEDPDNAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPNMI +  +  L+++L+A D + K
Sbjct: 247 GPNMIPLGQMEALVARLMAFDALAK 271


>gi|332140934|ref|YP_004426672.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327550956|gb|AEA97674.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 284

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 120/268 (44%), Positives = 166/268 (61%), Gaps = 1/268 (0%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
               V  +N   FVL  G   +ES D A  IAE    + Q LNI  V+K+SFDKANRSS+
Sbjct: 9   NVGNVEVANHLPFVLFGGMNVLESRDLAMRIAEHYVEVTQKLNIPYVFKASFDKANRSSV 68

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG G+++G  IF ++K  +  P++TDVH   Q   +AD VD++Q+PA L RQTDL+ 
Sbjct: 69  TSYRGPGMEEGLRIFEEIKSTFNVPLITDVHEPHQAAPVADVVDVIQLPAFLARQTDLVV 128

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           A A+TG VINVKK QFL+P EM +I+ KL   G  +V+ CERG+ FGYN LV DM  +  
Sbjct: 129 AMAKTGAVINVKKPQFLAPHEMRHIIGKLGEAGNDNVILCERGSCFGYNNLVVDMLGMDA 188

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M      VIFDA+H++Q PG     + G R     LA++ +A+G+AG+F+E H +PD A 
Sbjct: 189 MKEYAP-VIFDATHALQMPGGRATSADGRRAQAAQLARSGMALGLAGLFIEAHPNPDEAL 247

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP  + +  L   L Q+ A+D+++K 
Sbjct: 248 CDGPCALPLAKLEPYLQQMKALDELVKG 275


>gi|292488092|ref|YP_003530969.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erwinia amylovora
           CFBP1430]
 gi|292899303|ref|YP_003538672.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erwinia amylovora ATCC
           49946]
 gi|291199151|emb|CBJ46265.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erwinia amylovora ATCC
           49946]
 gi|291553516|emb|CBA20561.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Erwinia amylovora CFBP1430]
 gi|312172223|emb|CBX80480.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Erwinia amylovora ATCC BAA-2158]
          Length = 284

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVNIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF+++K+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQEIKQAFGVKIITDVHEASQAQTVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFAEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMKQVSANSPVIFDVTHALQCRDPMGAASGGRRGQVTELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP NA  DGP+ + +  L   L Q+ AID +IK 
Sbjct: 237 FIEAHPDPANAKCDGPSALPLDKLEPFLLQMKAIDDLIKS 276


>gi|169633621|ref|YP_001707357.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii
           SDF]
 gi|238688226|sp|B0VQI5|KDSA_ACIBS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|169152413|emb|CAP01364.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter baumannii]
          Length = 285

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 127/266 (47%), Positives = 169/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL  
Sbjct: 13  GDIQMANHLPFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLHS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG E   D+KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 73  FRGPGLEKGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAM 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM 
Sbjct: 133 AKTQAIINIKKAQFLAPHEMRHILHKCLEVGNDKLILCERGSAFGYNNLVVDMLGFDIMK 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE+H DPD A  D
Sbjct: 193 EMNVPVFFDVTHALQTPGGRSDSAGGRRAQITTLARAGMATGLAGLFLESHPDPDKAKCD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP+ + +  L   L+QL  +D ++K 
Sbjct: 253 GPSALRLSQLEPFLAQLKELDTLVKG 278


>gi|255658895|ref|ZP_05404304.1| 3-deoxy-8-phosphooctulonate synthase [Mitsuokella multacida DSM
           20544]
 gi|260848844|gb|EEX68851.1| 3-deoxy-8-phosphooctulonate synthase [Mitsuokella multacida DSM
           20544]
          Length = 274

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 136/264 (51%), Positives = 174/264 (65%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
                   +   L+AGPC +E  D   +I   +  IC  L I  V+K+SFDKANRSS   
Sbjct: 7   GNFMIGEGEPLTLLAGPCVLEGMDRCLLIGRTIKEICGRLGINYVFKASFDKANRSSYHS 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GLKKG E+ +++K+    PI+TD+H   Q E +A   DILQIPA LCRQTDLL AA
Sbjct: 67  FRGPGLKKGLEMLQEIKETLDVPIVTDIHETTQAEPVAKVADILQIPAFLCRQTDLLHAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           AQTGRV+NVKKGQFL+P +M N++ KLH  G + +L  ERG SFGY+ LV DMRS+PIM 
Sbjct: 127 AQTGRVVNVKKGQFLAPEDMRNVVDKLHECGCEQMLLTERGASFGYHNLVVDMRSLPIMR 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S+G PV+FD +HSVQ PG +G  S G R+Y+  L +AA   GI  +FLE H +P+ A SD
Sbjct: 187 SLGYPVVFDGTHSVQLPGGNGTTSSGNREYVEYLVRAAAGAGIDALFLEVHDNPEEALSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKII 298
           G NM+ +  L  LL+  LAI KI+
Sbjct: 247 GANMVYLDKLEGLLTDALAIHKIV 270


>gi|86136540|ref|ZP_01055119.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter sp. MED193]
 gi|85827414|gb|EAQ47610.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter sp. MED193]
          Length = 277

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 137/265 (51%), Positives = 183/265 (69%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T  N++   ++AGPCQ+ES DHA MIA  L   C       V+K S+DKANR+S+  K
Sbjct: 8   NLTIGNDRPLTILAGPCQLESADHAQMIAGTLKEACDKAGAQFVFKGSYDKANRTSINAK 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
             +GL+KG E+ + +K   G P+LTD+H  + C  +A+ VDILQIPA LCRQT LL AA 
Sbjct: 68  PALGLEKGLEVLQSVKDSIGVPVLTDIHEAEHCAPVAEVVDILQIPAFLCRQTALLLAAG 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG VINVKKGQFL+PW+M N+  K+ + G + ++  ERG SFGYN LV DM+S+P M  
Sbjct: 128 RTGAVINVKKGQFLAPWDMPNVAAKIASTGNERIMLTERGVSFGYNRLVVDMQSLPEMAR 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+ DA+H+V QPG  G  SGG+R++   LA+AAVA GIA +F+ETH DPDNAP DG
Sbjct: 188 TGYPVVMDATHAVAQPGGLGGASGGQREFAPVLARAAVATGIASVFMETHHDPDNAPCDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNMI +  +P+L+  L+A D + K 
Sbjct: 248 PNMIYLDQMPQLIETLMAFDALAKA 272


>gi|89056149|ref|YP_511600.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Jannaschia sp. CCS1]
 gi|88865698|gb|ABD56575.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Jannaschia sp. CCS1]
          Length = 277

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 147/275 (53%), Positives = 196/275 (71%), Gaps = 4/275 (1%)

Query: 26  AAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFD 85
             + +G     ++ SN    ++IAGPCQ+ES DHA MIA  +  +C  +    V+K S+D
Sbjct: 2   KTVEIGG----LSVSNTAPLLVIAGPCQLESLDHARMIAGHMSQVCAQVGAQFVFKGSYD 57

Query: 86  KANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLC 145
           KANR+SL GKRG+G+  G EI   ++ + G P+LTDVHT +QC+ +A +VDILQIPA LC
Sbjct: 58  KANRTSLDGKRGLGMTAGLEILATIRDELGCPVLTDVHTPEQCDPVAGAVDILQIPAFLC 117

Query: 146 RQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVT 205
           RQTDLL AA +TG  INVKKGQFL+PW+M N+ QK+ + G + ++  ERG SFGYN LV 
Sbjct: 118 RQTDLLLAAGKTGAAINVKKGQFLAPWDMANVAQKVASTGNERLMLTERGVSFGYNALVA 177

Query: 206 DMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
           DMRS+P M   G PVI DA+H+V QPG  G  SGG+R++   LA++AVA+GI G+FLETH
Sbjct: 178 DMRSLPEMAKTGYPVIMDATHAVAQPGGLGGSSGGQREFAPVLARSAVALGIGGVFLETH 237

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +DPD APSDGPNMI + D+  +L  L+A+DK+ K 
Sbjct: 238 EDPDTAPSDGPNMIRLDDMEGVLGTLMALDKVAKA 272


>gi|218262774|ref|ZP_03477132.1| hypothetical protein PRABACTJOHN_02811 [Parabacteroides johnsonii
           DSM 18315]
 gi|218223145|gb|EEC95795.1| hypothetical protein PRABACTJOHN_02811 [Parabacteroides johnsonii
           DSM 18315]
          Length = 269

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 121/260 (46%), Positives = 167/260 (64%)

Query: 41  NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGL 100
           ++  F L+AGPC IE  D A  IAEK+  I   LNI  V+K S+ KANRS L    G+G 
Sbjct: 9   DKDNFFLMAGPCVIEGEDMALRIAEKVVGITNKLNIPYVFKGSYRKANRSRLDSFTGIGD 68

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
           +K  +I R + + +G P +TD+H   +    A+ VD+LQIPA LCRQTDLL AAA+TG++
Sbjct: 69  EKALKILRKVGETFGIPTVTDIHETTEAAMAAEYVDVLQIPAFLCRQTDLLVAAAKTGKI 128

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPV 220
           +N+KKGQFLSP  M   +QK+   G  +V+  ERGT+FGY  LV D R IP M   G PV
Sbjct: 129 VNIKKGQFLSPGAMQFAVQKVADAGNDNVMITERGTTFGYTDLVVDYRGIPQMQQFGYPV 188

Query: 221 IFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMIN 280
           I D +HS+QQP      +GG    I  +AKAA+A+G  G+F+ETH +P  A SDG NM+ 
Sbjct: 189 IMDVTHSLQQPNQTSGVTGGLPALIETIAKAAIAVGTDGLFIETHPEPSKAKSDGANMLQ 248

Query: 281 IKDLPKLLSQLLAIDKIIKP 300
           +  L ++L++L+ I + ++ 
Sbjct: 249 LDLLEEMLTKLVRIREAVRS 268


>gi|238755551|ref|ZP_04616889.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia ruckeri ATCC
           29473]
 gi|238706231|gb|EEP98610.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia ruckeri ATCC
           29473]
          Length = 284

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL +G +IF++LKK++G  ++TDVH   QC+ +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLDEGMKIFQELKKQFGVKVITDVHEISQCQPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEAGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMVQSTGGHPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|332666453|ref|YP_004449241.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haliscomenobacter
           hydrossis DSM 1100]
 gi|332335267|gb|AEE52368.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Haliscomenobacter
           hydrossis DSM 1100]
          Length = 270

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 120/255 (47%), Positives = 165/255 (64%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F LIAGPC IE  D A+ IAEK++ IC  L I  ++K S+ KANRS L    G+G ++  
Sbjct: 16  FFLIAGPCAIEGEDIAYEIAEKVHNICARLEIPYIFKGSYRKANRSRLDSFTGIGDERAL 75

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           E+ + + + YG P+ TD+HT+++    A  VD+LQIPA LCRQT LL AAA TG+V+NVK
Sbjct: 76  EVLQKIGEHYGIPVTTDIHTDEEAAYAAKYVDVLQIPAFLCRQTSLLVAAADTGKVVNVK 135

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQF+SP  M   + K+   G   +   ERG +FGY  LV D R +P+M S GVPV+ D 
Sbjct: 136 KGQFMSPEAMKYAVDKIRQSGNDKIFLTERGVTFGYQDLVIDYRGLPVMQSFGVPVVLDC 195

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HS+QQP      +GG    I  +AKAA+A+G+ G+F+ETH  P  A SDG NM+ ++ L
Sbjct: 196 THSLQQPNQASGVTGGRPALIETVAKAAIAVGVDGLFIETHPRPAEAKSDGANMLPLERL 255

Query: 285 PKLLSQLLAIDKIIK 299
             +L +L+ I + IK
Sbjct: 256 EPMLEKLVKIREAIK 270


>gi|152988109|ref|YP_001346887.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           PA7]
 gi|166987633|sp|A6V1F2|KDSA_PSEA7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|150963267|gb|ABR85292.1| 3-deoxy-8-phosphooctulonate synthase [Pseudomonas aeruginosa PA7]
          Length = 281

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 119/278 (42%), Positives = 169/278 (60%), Gaps = 4/278 (1%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +   N+  FVL  G   +ES D A  + E+   + + L I  V+K+
Sbjct: 1   MAQKIVRVGD----IQIGNDLPFVLFGGMNVLESRDLAMQVCEEYVRVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF ++KK +  P++TDVH   Q + +A+  DI+Q+PA
Sbjct: 57  SFDKANRSSIHSFRGPGLEEGMKIFEEIKKTFKVPVITDVHEPHQAQPVAEVCDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+T  VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN 
Sbjct: 117 FLSRQTDLVVAMARTNAVINIKKAQFLAPQEMKHILTKCEEAGNDRLILCERGSSFGYNN 176

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV DM    IM     PV FD +H++Q PG   + +GG R  +  LAKA ++  +AG+FL
Sbjct: 177 LVVDMLGFGIMKQFEYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGLSQKLAGLFL 236

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           E H DP++A  DGP  + +  L   LSQL  +D++IK 
Sbjct: 237 EAHPDPEHAKCDGPCALRLNKLEAFLSQLKQLDELIKS 274


>gi|109898522|ref|YP_661777.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas
           atlantica T6c]
 gi|109700803|gb|ABG40723.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas
           atlantica T6c]
          Length = 283

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 115/266 (43%), Positives = 167/266 (62%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  IAE    I   L I  V+K+SFDKANRSS+  
Sbjct: 10  GDIQVANDKPFVLFGGMNVLESRDMAMRIAEHYKEITSKLGIPYVFKASFDKANRSSVNS 69

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+ +G EIF ++K  +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 70  YRGPGMDEGLEIFAEIKATFDVPLITDVHEPAQAAPVAEVVDVIQLPAFLARQTDLVVAM 129

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +INVKK QFL+P EM +I+ K    G   ++ CERG+SFGYN LV DM  +  M 
Sbjct: 130 AKTNAIINVKKPQFLAPHEMRHIITKFMEAGNDKIILCERGSSFGYNNLVVDMLGMDEMK 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
                VIFDA+H++Q+PG   + + G R     LA++ +A+G+AG+F+E H +P+ A  D
Sbjct: 190 QYAP-VIFDATHALQKPGGRTDSADGRRAQAAQLARSGMALGLAGLFIEAHPNPNEAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  +++  L   L Q+LA+D ++K 
Sbjct: 249 GPCALSLDKLEPYLQQMLALDDLVKG 274


>gi|307131075|ref|YP_003883091.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Dickeya dadantii
           3937]
 gi|306528604|gb|ADM98534.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Dickeya dadantii
           3937]
          Length = 284

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 119/280 (42%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  +++G     +  +N   FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MNNKVVNIGD----IPVANSLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL+ G +IF++LK+ +G  I+TDVH  QQ + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEAGMKIFQELKQTFGVKIITDVHEPQQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+T  VIN+KK QF+SP ++ NI+ K    G + V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTDAVINIKKPQFISPGQVGNIVDKFREGGNEQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMKQVSHGAPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID+++K 
Sbjct: 237 FIEAHPEPNSAMCDGPSALPLTKLEPFLQQMKAIDELVKS 276


>gi|123442663|ref|YP_001006640.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|332161455|ref|YP_004298032.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|158512896|sp|A1JRS8|KDSA_YERE8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|122089624|emb|CAL12474.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|318605432|emb|CBY26930.1| 2-keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325665685|gb|ADZ42329.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330863229|emb|CBX73355.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia enterocolitica
           W22703]
          Length = 284

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 179/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+++G  ++TDVH   QC+ +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQQFGVKVITDVHEISQCQPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI++K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFVSPGQMGNIVEKFKEAGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M     G PVIFD +H++Q     G+ SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMVKATGGHPVIFDVTHALQCRDPFGSASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLMQMKAIDDLVKS 276


>gi|50085137|ref|YP_046647.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp. ADP1]
 gi|59798253|sp|Q6FAT8|KDSA_ACIAD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|49531113|emb|CAG68825.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp. ADP1]
          Length = 285

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 127/266 (47%), Positives = 166/266 (62%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N   FVL  G   +ES D AF IAE    IC+ L I  V+K+SFDKANRSSL  
Sbjct: 13  GDIQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICKRLEIPYVFKASFDKANRSSLHS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG E   ++KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 73  FRGPGLEKGIEWLGEIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAM 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KK QFLSP EM++IL K    G   ++ CERGTSFGYN LV DM     M 
Sbjct: 133 AKTQAIINIKKAQFLSPREMNHILNKCLEAGNDKLILCERGTSFGYNNLVVDMLGFDTMK 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP+ A  D
Sbjct: 193 EMNVPVFFDVTHALQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEAHPDPEKAKCD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL  +D ++K 
Sbjct: 253 GPCALRLSQLEPFLAQLKELDALVKG 278


>gi|302879410|ref|YP_003847974.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gallionella
           capsiferriformans ES-2]
 gi|302582199|gb|ADL56210.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gallionella
           capsiferriformans ES-2]
          Length = 283

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 132/265 (49%), Positives = 177/265 (66%), Gaps = 1/265 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q   LIAGPC IES   A   A  L  IC+ LN+  +YKSS+DKANRSS    
Sbjct: 5   NFEAGLDQPLFLIAGPCVIESAQMAIDTAGALQEICRELNLPFIYKSSYDKANRSSGKSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL  G +I  D+K + G  +LTDVH+ ++  A+A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGFGLDAGLKILSDVKSQLGVNVLTDVHSIEEIGAVASVVDVLQTPAFLCRQTDFIHAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHA-HGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           + G+ +N+KKGQFLSPW+M N+++K     GA +++ CERG SFGYN LV+DMRS+ +M 
Sbjct: 125 RCGKPVNIKKGQFLSPWDMQNVVEKARDVSGADNIMVCERGASFGYNNLVSDMRSLAVMR 184

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           +   PV+FDA+HSVQ PG  G  SGG+R+++  LA+AAVA GI+G+F+ETH  P  A SD
Sbjct: 185 NTRCPVVFDATHSVQLPGGQGTVSGGQREFVPVLARAAVAAGISGLFMETHPTPSKALSD 244

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN   +  L  LL  L+ +D+ +K
Sbjct: 245 GPNAFPLGHLKALLKTLMVLDQTVK 269


>gi|163782044|ref|ZP_02177043.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159882576|gb|EDP76081.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 266

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 132/256 (51%), Positives = 183/256 (71%), Gaps = 2/256 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGLK 101
           + F +IAGPC IES      +A+KL  + +  + +  V+KSSFDKANRSS+   RG GL+
Sbjct: 2   KNFTIIAGPCVIESEAVVLPVAQKLKELSEKYDEVDFVFKSSFDKANRSSINSFRGHGLE 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G ++ R +K+++G  + TD+H   Q E + + VDI+QIPA LCRQTDLL AAA+TG+ +
Sbjct: 62  FGLKVLRSVKEEFGLKVTTDIHESWQAEPVGEVVDIVQIPAFLCRQTDLLIAAAKTGKAV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  NI++KL   GAK++   ERG SFGYN LV D RS+PIM++    VI
Sbjct: 122 NVKKGQFLAPWDTKNIVEKLKVGGAKEIFLTERGVSFGYNNLVVDFRSLPIMSNF-AKVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG  GN SGG+R+++ PL +AAVA+G  G+F+ETH +PD A SDGPN + +
Sbjct: 181 FDATHSVQLPGGMGNRSGGQREFVFPLIRAAVAVGCDGVFMETHPNPDEALSDGPNQVPL 240

Query: 282 KDLPKLLSQLLAIDKI 297
           KDL  ++  +L I ++
Sbjct: 241 KDLEFIVEAMLEIREV 256


>gi|90020891|ref|YP_526718.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Saccharophagus degradans
           2-40]
 gi|89950491|gb|ABD80506.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Saccharophagus degradans
           2-40]
          Length = 283

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 121/281 (43%), Positives = 168/281 (59%), Gaps = 6/281 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             +  I +G     +  +N + F L  G   +ES D A   AE    + Q L I  V+K+
Sbjct: 1   MQDKIIKVG----NIDVANNKPFTLFGGMNVLESKDLALRTAEAYVNVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G  IF+ +K ++G PI+TDVH   Q   +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSINSYRGPGMEEGLRIFQAVKDEFGVPIITDVHECDQAAPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A T  VINVKK QFLSP +M NI++K    G + V+ CERG   GY+ 
Sbjct: 117 FLARQTDLVKAMAATNAVINVKKPQFLSPGQMKNIVEKFAESGNEKVILCERGACMGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM     M  +  G+PVIFD +HS+Q     G  SGG R     L +A +A+GIAG+
Sbjct: 177 LVVDMLGFRTMKEVSGGLPVIFDVTHSLQCRDPLGAASGGRRHQTAELGRAGIAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           FLE H +P  A  DGP+ + ++ L   L+Q+  +D +IK L
Sbjct: 237 FLEAHPNPAEAKCDGPSALPLEQLEAFLTQMKTVDDVIKGL 277


>gi|256827970|ref|YP_003156698.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfomicrobium
           baculatum DSM 4028]
 gi|256577146|gb|ACU88282.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfomicrobium
           baculatum DSM 4028]
          Length = 268

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 128/254 (50%), Positives = 173/254 (68%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKG 103
           R  LIAGPC +ES D A  +A +L AI + LN+ L++KSS+DKANR++ A  RG GL  G
Sbjct: 11  RPFLIAGPCVLESLDLAMTVAVELQAIARDLNLPLIFKSSYDKANRTAGASFRGPGLDMG 70

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
            +    +K + G P++TD+H  +Q   +A+  D+LQIPA LCRQTDLL AAA+T R++N+
Sbjct: 71  LDWLAQIKSRTGLPVITDIHEPRQASLVAEVADVLQIPAFLCRQTDLLLAAARTERIVNI 130

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQF++PW+M   ++K+ + G   +   ERG+ FGYN LV D RS+ IM   G PV+FD
Sbjct: 131 KKGQFMAPWDMQGPVEKIRSEGFDRIWLTERGSMFGYNNLVVDFRSLIIMKQFGCPVVFD 190

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ PG  G  SGG+R+++ PLA+AAVA G  G+F+E H DPD A  DGPN   +  
Sbjct: 191 ATHSVQLPGGRGMSSGGQREFVPPLARAAVACGCQGLFMEIHPDPDKALCDGPNSWPLAK 250

Query: 284 LPKLLSQLLAIDKI 297
              LLS+L AI  I
Sbjct: 251 ARTLLSELAAIWSI 264


>gi|126733712|ref|ZP_01749459.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter sp. CCS2]
 gi|126716578|gb|EBA13442.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseobacter sp. CCS2]
          Length = 277

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 142/266 (53%), Positives = 190/266 (71%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  SN+   ++IAGPCQ+E  DHA MIA K+  IC       V+K S+DKANR+SL G
Sbjct: 7   GDLAVSNDLPLLVIAGPCQLEGADHAQMIAGKMAEICAEHGAQFVFKGSYDKANRTSLGG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G+ +G ++ + +K   G P+LTD+H   QC  +A+  DILQIPA LCRQTDLL AA
Sbjct: 67  KRGLGMDEGLKVMQSVKDSIGCPVLTDIHAPDQCATVAEVCDILQIPAFLCRQTDLLLAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG VINVKKGQFL+PW+M N++ K+ + G K +L  ERG SFGYNTLV DMRS+P M 
Sbjct: 127 GETGAVINVKKGQFLAPWDMPNVVSKIESTGNKRILLTERGASFGYNTLVADMRSLPTMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++GIA +F+ETH+DPD+APSD
Sbjct: 187 RTGYPVVMDATHSVQQPGGMGGSSGGQREFAPVMARAAVSLGIAAVFIETHEDPDHAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNMI +  +  ++  L+A D + K 
Sbjct: 247 GPNMIPLDQMHGVIKSLMAFDGLAKA 272


>gi|262375246|ref|ZP_06068479.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter lwoffii SH145]
 gi|262309500|gb|EEY90630.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter lwoffii SH145]
          Length = 285

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 126/266 (47%), Positives = 165/266 (62%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N   FVL  G   +ES D AF IAE    IC  L I  V+K+SFDKANRSSL  
Sbjct: 13  GDIQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICTRLGIPYVFKASFDKANRSSLNS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG E   D+KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 73  FRGPGLEKGLEWLADIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAM 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM 
Sbjct: 133 AKTDAIINIKKAQFLAPHEMRHILHKCLEAGNDKLIICERGSAFGYNNLVVDMLGFDIMK 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP+ A  D
Sbjct: 193 EMNVPVFFDVTHALQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEAHPDPEKAKCD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL  +D ++K 
Sbjct: 253 GPCALRMSQLEPFLAQLKELDTLVKG 278


>gi|259908614|ref|YP_002648970.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erwinia pyrifoliae
           Ep1/96]
 gi|224964236|emb|CAX55743.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erwinia pyrifoliae
           Ep1/96]
 gi|283478587|emb|CAY74503.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Erwinia pyrifoliae DSM 12163]
          Length = 284

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 122/279 (43%), Positives = 172/279 (61%), Gaps = 6/279 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF+++K+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQEIKQAFGVKIITDVHEASQAQTVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFAEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  S G R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMKQVSGNSPVIFDVTHALQCRDPMGAASSGRRGQVTELARAGIAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+E H DP NA  DGP+ + +  L   L Q+ AID +IK
Sbjct: 237 FIEAHPDPANAKCDGPSALPLDKLEPFLLQMKAIDDLIK 275


>gi|310767486|gb|ADP12436.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Erwinia sp. Ejp617]
          Length = 284

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 172/280 (61%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----MNVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF+++K+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQEIKQAFGVKIITDVHEASQAQTVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFAEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  S G R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMKQVSGNSPVIFDVTHALQCRDPMGAASSGRRGQVTELARAGIAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP NA  DGP+ + +  L   L Q+ AID +IK 
Sbjct: 237 FIEAHPDPANAKCDGPSALPLDKLEPFLLQMKAIDDLIKS 276


>gi|88798820|ref|ZP_01114403.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Reinekea sp. MED297]
 gi|88778583|gb|EAR09775.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Reinekea sp. MED297]
          Length = 281

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 118/266 (44%), Positives = 167/266 (62%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  SN++ F L  G   +ES D A   AE+   I + L+I  V+K+SFDKANRSS+   
Sbjct: 10  NIECSNDKPFTLFGGINVLESRDLAMSAAEQYVRITEELDIPYVFKASFDKANRSSINSF 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL++G +I  ++K  +  P++TDVH   Q +  A+  DI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGLEEGLKILEEVKNTFNVPVITDVHEPYQAQPAAEVADIIQLPAFLSRQTDLVMAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG  IN+KK QFL+P EM +IL K    G   ++ CERGTSFGYN LV DM    IM  
Sbjct: 130 KTGATINIKKAQFLAPHEMAHILTKFQEAGNDQLILCERGTSFGYNNLVVDMLGFGIMKE 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PVIFD +H++Q+PG   + + G R  +  LA+A ++  IAG+FLE+H DP  A  DG
Sbjct: 190 TGFPVIFDVTHALQRPGGRLDSADGRRAQVTDLARAGMSQKIAGLFLESHPDPSQAKCDG 249

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKPL 301
           P+ + +  L   L Q+ A+D ++K +
Sbjct: 250 PSALPLDKLKAFLEQMKAVDTVVKEM 275


>gi|330445234|ref|ZP_08308886.1| 3-deoxy-8-phosphooctulonate synthase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489425|dbj|GAA03383.1| 3-deoxy-8-phosphooctulonate synthase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 283

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 115/280 (41%), Positives = 170/280 (60%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N++ FVL  G   +ES D A  I E    + + L I  V+K+
Sbjct: 1   MEQKTVRIGD----IDVANDKPFVLFGGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG G+++G +IF+++K  +G  I+TD+H  +Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGMEEGLKIFQEIKDTFGVKIITDIHEREQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K       +V+ CERG   GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECDNHNVILCERGVLHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +H++Q     G  SGG R+  V LA++ +A GIAG+
Sbjct: 177 LVVDMLGFDVMKKASKGSPIIFDVTHALQCRDPLGAASGGRREQTVDLARSGIATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H  PD A  DGP+   +  L   L+Q+  +D +IK 
Sbjct: 237 FMEAHPTPDQALCDGPSAFPLDKLEPFLAQIKQLDDLIKS 276


>gi|83949991|ref|ZP_00958724.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseovarius nubinhibens
           ISM]
 gi|83837890|gb|EAP77186.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Roseovarius nubinhibens
           ISM]
          Length = 277

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 143/265 (53%), Positives = 193/265 (72%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +   N++   +IAGPCQ+ES DHA MIA ++   C +     V+K+SFDKANR+S++GK
Sbjct: 8   GLDIGNDRPLTVIAGPCQLESADHAQMIAGRMKEACAAAGAQYVFKASFDKANRTSVSGK 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+  G ++  DL +    P+LTDVHTE QC   A++VDILQIPA LCRQTDLL AA 
Sbjct: 68  RGLGIDAGLKVLSDLGRALDVPVLTDVHTEAQCAPAAEAVDILQIPAFLCRQTDLLLAAG 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
            TG V+NVKKGQFL+PW+M N++ K+ + G K +L  ERGTSFGYNTLV DMR++P M  
Sbjct: 128 NTGAVVNVKKGQFLAPWDMENVITKIESTGNKKILLTERGTSFGYNTLVADMRALPQMAR 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++G+A +F+ETH+DPD APSDG
Sbjct: 188 SGYPVVMDATHSVQQPGGQGGSSGGQREFAPVMARAAVSLGVAAVFIETHEDPDRAPSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNMI +  +P L++ L+  D + K 
Sbjct: 248 PNMIPLDQMPALVASLMRFDALAKS 272


>gi|317491756|ref|ZP_07950191.1| 3-deoxy-8-phosphooctulonate synthase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920190|gb|EFV41514.1| 3-deoxy-8-phosphooctulonate synthase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 284

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G  IF+D+K+ +G  I+TDVHT +Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMRIFQDIKQAFGVKIITDVHTPEQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI+ K    G   ++ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPGQMGNIVDKFEEGGNDKIILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M +   G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 177 LVVDMLGFGVMKNASKGSPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP NA  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPANARCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|33864191|ref|NP_895751.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Prochlorococcus marinus
           str. MIT 9313]
 gi|44888087|sp|Q7V4M4|KDSA_PROMM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|33635775|emb|CAE22100.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase
           [Prochlorococcus marinus str. MIT 9313]
          Length = 283

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 120/269 (44%), Positives = 177/269 (65%), Gaps = 2/269 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             + F+N+  FVLI G   +ES + A  +A     +C  L I LV+K+SFDKANRSS+  
Sbjct: 9   GTIRFANDAPFVLIGGINVLESREFALEVAGHYKTVCTKLGIPLVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G EI + +K  +G P++TDVH+ ++    A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLREGLEILQVVKDTHGIPVITDVHSPEEATPAAEVCDIIQLPAFLARQTDLIEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFLSP +M N+++K    G +++L CERG++FGY+ LV DM +  +M 
Sbjct: 129 AKTGAVINIKKPQFLSPSQMSNVVEKFRECGNENLLICERGSNFGYDNLVVDMLAFGVMK 188

Query: 215 SMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
                 P+IFD +H++Q     G  SGG R  +V LA++ +A+G+AG+FLE+H DPD A 
Sbjct: 189 HCCNDLPLIFDVTHALQCRDPSGAASGGRRSQVVDLARSGMAVGLAGLFLESHPDPDKAR 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
            DGP+ + +  L   L Q+ AID+++K L
Sbjct: 249 CDGPSALPLALLEPFLQQVKAIDEVVKAL 277


>gi|161503116|ref|YP_001570228.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189028414|sp|A9MPA5|KDSA_SALAR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|160864463|gb|ABX21086.1| hypothetical protein SARI_01181 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 284

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVNIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K H  G   V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFHEGGNDKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFGVMKKVSGNCPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE+H DP NA  DGP+ + +  L + L+Q+ AID ++K 
Sbjct: 237 FLESHPDPANAKCDGPSALPLAKLEQFLTQIKAIDDLVKS 276


>gi|91763326|ref|ZP_01265290.1| 2-dehydro-3-deoxy-phosphooctonate aldolase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91717739|gb|EAS84390.1| 2-dehydro-3-deoxy-phosphooctonate aldolase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 274

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 154/266 (57%), Positives = 201/266 (75%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  SN+ +  +IAGPCQ+E+  HA  +A K+  I + L +G +YK+SFDKANR+SL G
Sbjct: 9   GNIEISNDNKICIIAGPCQLETEQHAMDMAGKIQEITKKLGLGFIYKTSFDKANRTSLKG 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           +RG GL+    +F  +KK+   PILTD+H  +QC  + D VDILQIPA LCRQTDLL AA
Sbjct: 69  QRGAGLEASLPVFDKIKKELNVPILTDIHNAEQCSLLKDHVDILQIPAFLCRQTDLLIAA 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T ++INVKKGQFL+PW+M N+ +K+   G +++L  ERG SFGYNTLV+DMRS+PIM 
Sbjct: 129 AKTNKIINVKKGQFLAPWDMVNVTKKIADSGNENILVTERGASFGYNTLVSDMRSLPIMA 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETHQDPDNAPSD
Sbjct: 189 KNGYPVIFDATHSVQQPGGLGETSGGQREFVEYLARAAVAVGVAGVFIETHQDPDNAPSD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNM+ +  L KLLSQL  ID +IK 
Sbjct: 249 GPNMVPLDKLEKLLSQLFEIDNLIKK 274


>gi|88808107|ref|ZP_01123618.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus sp. WH
           7805]
 gi|88788146|gb|EAR19302.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus sp. WH
           7805]
          Length = 283

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 124/269 (46%), Positives = 175/269 (65%), Gaps = 2/269 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +TF+N+  FVLI G   +ES   A   A K   +C+ L I LV+K+SFDKANRSS+  
Sbjct: 9   GSITFANDAPFVLIGGVNVLESQQFALDAAAKYADVCRRLAIPLVFKASFDKANRSSVHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  + + +K  +G P++TDVHT +Q    A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  FRGPGLEEGLAMLQAVKDTHGMPVITDVHTPEQAAPAAEVCDIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           AQTG VIN+KK QFLSP +M N+++K    G + +L CERG++FGY+ LV DM    +M 
Sbjct: 129 AQTGAVINIKKPQFLSPSQMANVVEKFRECGNERLLICERGSNFGYDNLVVDMLGFGVMK 188

Query: 215 SMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
                 P+IFD +H++Q     G  SGG R  ++ LA+A +AIG+AG+FLE+H DP  A 
Sbjct: 189 RCCDDLPLIFDVTHALQCRDPGGAASGGRRSQVLDLARAGMAIGLAGLFLESHPDPSQAR 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
            DGP+ + ++ L   LSQL A+D ++K L
Sbjct: 249 CDGPSALPLEQLEPFLSQLKAVDDLVKSL 277


>gi|212711976|ref|ZP_03320104.1| hypothetical protein PROVALCAL_03052 [Providencia alcalifaciens DSM
           30120]
 gi|212685498|gb|EEB45026.1| hypothetical protein PROVALCAL_03052 [Providencia alcalifaciens DSM
           30120]
          Length = 289

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 117/280 (41%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  + E    + Q L I  V+K+
Sbjct: 6   MQQKVVSIGD----IKVANDLPFVLFGGMNVLESRDMAMKVCEHYVTVTQKLGIPYVFKA 61

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF+++K+ +G  I+TDVH   Q + +++ VD++Q+PA
Sbjct: 62  SFDKANRSSIHSYRGPGLEEGMKIFQEIKQTFGVKIITDVHEPDQAQPVSEVVDVIQLPA 121

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+T  VIN+KK QF+SP ++ NI++K    G   ++ C+RG +FGY+ 
Sbjct: 122 FLARQTDLVAAMAKTDAVINIKKPQFISPGQIGNIVEKFIEGGNDKIILCDRGANFGYDN 181

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +HS+Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 182 LVVDMLGFNVMMQASKGCPVIFDVTHSLQCRDPFGAASGGRRGQVAELARAGMAVGLAGL 241

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DP+NA  DGP+ + +  L   L Q+ AID+++K 
Sbjct: 242 FLEAHPDPENARCDGPSALPLHKLEPFLQQVKAIDEVVKS 281


>gi|15598832|ref|NP_252326.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           PAO1]
 gi|107103150|ref|ZP_01367068.1| hypothetical protein PaerPA_01004219 [Pseudomonas aeruginosa PACS2]
 gi|116051633|ref|YP_789528.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218890139|ref|YP_002439003.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           LESB58]
 gi|254236550|ref|ZP_04929873.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           C3719]
 gi|254242334|ref|ZP_04935656.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           2192]
 gi|296387859|ref|ZP_06877334.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           PAb1]
 gi|313109040|ref|ZP_07795013.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           39016]
 gi|6647573|sp|Q9ZFK4|KDSA_PSEAE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|122260776|sp|Q02RA8|KDSA_PSEAB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|9949795|gb|AAG07024.1|AE004783_9 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           PAO1]
 gi|4235471|gb|AAD13217.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           PAO1]
 gi|115586854|gb|ABJ12869.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168481|gb|EAZ53992.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           C3719]
 gi|126195712|gb|EAZ59775.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           2192]
 gi|218770362|emb|CAW26127.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           LESB58]
 gi|310881515|gb|EFQ40109.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas aeruginosa
           39016]
          Length = 281

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 119/278 (42%), Positives = 169/278 (60%), Gaps = 4/278 (1%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +   N+  FVL  G   +ES D A  + E+   + + L I  V+K+
Sbjct: 1   MAQKIVRVGD----IQIGNDLPFVLFGGMNVLESRDLAMQVCEEYVRVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF ++KK +  P++TDVH   Q + +A+  DI+Q+PA
Sbjct: 57  SFDKANRSSIHSFRGPGLEEGMKIFEEIKKTFKVPVITDVHEPFQAQPVAEVCDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+T  VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN 
Sbjct: 117 FLSRQTDLVVAMARTNAVINIKKAQFLAPQEMKHILTKCEEAGNDRLILCERGSSFGYNN 176

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV DM    IM     PV FD +H++Q PG   + +GG R  +  LAKA ++  +AG+FL
Sbjct: 177 LVVDMLGFGIMKQFEYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGLSQKLAGLFL 236

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           E H DP++A  DGP  + +  L   LSQL  +D++IK 
Sbjct: 237 EAHPDPEHAKCDGPCALRLNKLEAFLSQLKQLDELIKS 274


>gi|238762997|ref|ZP_04623964.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia kristensenii
           ATCC 33638]
 gi|238698755|gb|EEP91505.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia kristensenii
           ATCC 33638]
          Length = 284

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 178/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MEQKVVSIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL +G +IF++LK+ +G  ++TDVH   QC+ +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLDEGMKIFQELKQTFGVKVITDVHEISQCQPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI++K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFVSPGQMGNIVEKFKEAGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M +   G PVIFD +H++Q     G+ SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMVNATGGHPVIFDVTHALQCRDPFGSASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|188025994|ref|ZP_02960459.2| hypothetical protein PROSTU_02410 [Providencia stuartii ATCC 25827]
 gi|188021182|gb|EDU59222.1| hypothetical protein PROSTU_02410 [Providencia stuartii ATCC 25827]
          Length = 289

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 172/280 (61%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N   FVL  G   +ES D A  + E    + Q L I  V+K+
Sbjct: 6   MQQKMVSIGD----IKVANNLPFVLFGGMNVLESRDMAMQVCEHYVTVTQKLGIPYVFKA 61

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL +G +IF++LK+ +G  I+TDVH   Q + +A+ VD++Q+PA
Sbjct: 62  SFDKANRSSIHSYRGPGLDEGMKIFQELKETFGVKIITDVHEPSQAQPVAEVVDVIQLPA 121

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+T  VIN+KK QF+SP ++ NI++K    G   V+ C+RG +FGY+ 
Sbjct: 122 FLARQTDLVAAMAKTDAVINIKKPQFISPGQIGNIVEKFIEGGNDKVILCDRGANFGYDN 181

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G PVIFD +HS+Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 182 LVVDMLGFNVMMQASNGCPVIFDVTHSLQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 241

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE H DPD+A  DGP+ + +  L   L Q+ AID+++K 
Sbjct: 242 FLEAHPDPDSARCDGPSALPLAKLEPFLQQIKAIDELVKS 281


>gi|71083634|ref|YP_266354.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|71062747|gb|AAZ21750.1| 2-dehydro-3-deoxy-phosphooctonate aldolase [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 274

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 154/266 (57%), Positives = 200/266 (75%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  SN+ +  +IAGPCQ+E+  HA  +A K+  I + L +G +YK+SFDKANR+SL G
Sbjct: 9   GNIEISNDNKICIIAGPCQLETEQHAMDMAGKIQEITKKLGLGFIYKTSFDKANRTSLKG 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           +RG GL+    +F  +KK+   PILTD+H  +QC  + D VDILQIPA LCRQTDLL AA
Sbjct: 69  QRGAGLEASLPVFDKIKKELNVPILTDIHNAEQCSLLKDHVDILQIPAFLCRQTDLLIAA 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T ++INVKKGQFL+PW+M N+ +K+   G  ++L  ERG SFGYNTLV+DMRS+PIM 
Sbjct: 129 AKTNKIINVKKGQFLAPWDMVNVTKKISDSGNNNILVTERGASFGYNTLVSDMRSLPIMA 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETHQDPDNAPSD
Sbjct: 189 KNGYPVIFDATHSVQQPGGLGETSGGQREFVEYLARAAVAVGVAGVFIETHQDPDNAPSD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNM+ +  L KLLSQL  ID +IK 
Sbjct: 249 GPNMVPLDKLEKLLSQLFEIDNLIKK 274


>gi|329296268|ref|ZP_08253604.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Plautia stali symbiont]
          Length = 284

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 172/280 (61%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            T   + +G     +  +N+  FVL  G   +ES D A  I E    +   L I  V+K+
Sbjct: 1   MTQKVVSIGD----IKVANDLPFVLFGGMNVLESQDLAMRICEHYVKVTDKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL +G +IF+ LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIKSYRGPGLDEGMKIFQALKQAFGVKIITDVHESWQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFAEGGNDKVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  SGG R  +  LA+A + +GIAG+
Sbjct: 177 LVVDMLGFNVMKKVTNNSPVIFDVTHALQTRDPFGAASGGRRAQVAELARAGMTVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L+Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLAQMKAIDDLVKS 276


>gi|157370236|ref|YP_001478225.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Serratia proteamaculans
           568]
 gi|166987635|sp|A8GDA7|KDSA_SERP5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|157322000|gb|ABV41097.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Serratia proteamaculans
           568]
          Length = 284

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 119/280 (42%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF ++KK +G   +TDVH   Q + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFEEIKKTFGVKTITDVHEASQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M +   G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMKNATGGHPVIFDVTHALQTRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|254430206|ref|ZP_05043909.1| 3-deoxy-8-phosphooctulonate synthase [Cyanobium sp. PCC 7001]
 gi|197624659|gb|EDY37218.1| 3-deoxy-8-phosphooctulonate synthase [Cyanobium sp. PCC 7001]
          Length = 273

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 132/263 (50%), Positives = 180/263 (68%), Gaps = 8/263 (3%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
           F LIAGPC IES D    +AE++  +CQ L I  V+K+SFDKANRSS    RG G ++G 
Sbjct: 3   FRLIAGPCVIESRDLVLQVAEQVSGLCQELGITYVFKASFDKANRSSGKSFRGPGPEEGL 62

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLL----TAAAQTGRV 160
            I ++++++ G P+LTD+H   Q    A++VD+LQIPA LCRQTDLL     A A T +V
Sbjct: 63  RILQEVREQLGIPVLTDIHESHQAAMAAEAVDVLQIPAFLCRQTDLLEAAARAVAGTDKV 122

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAK----DVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           +NVKKGQFL+PW+M  ++ KL   G +     +   ERG+SFGYNTLV D R +P M ++
Sbjct: 123 VNVKKGQFLAPWDMAQVVNKLRESGLEAESGRLWLTERGSSFGYNTLVVDFRGLPQMQAL 182

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PVIFDA+H+VQQPG  G  SGG+R+++ PLA+ AVA+G  G+F+E H DP  A SDGP
Sbjct: 183 GCPVIFDATHAVQQPGGQGTTSGGQREFVAPLARGAVAVGADGLFMEVHPDPPQALSDGP 242

Query: 277 NMINIKDLPKLLSQLLAIDKIIK 299
           NM+ +  L  LL QL+ +  +++
Sbjct: 243 NMVPLHRLEALLRQLMELRAVVQ 265


>gi|149178993|ref|ZP_01857568.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Planctomyces maris DSM
           8797]
 gi|148842192|gb|EDL56580.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Planctomyces maris DSM
           8797]
          Length = 286

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 121/271 (44%), Positives = 158/271 (58%), Gaps = 6/271 (2%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
            QV        V I GPC IES +     A +L  I    N+ L++K SFDKANR+S+  
Sbjct: 9   GQVQCGKNLPLVFITGPCVIESEELVLTTARRLAEIASKENLSLIFKCSFDKANRTSVDS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G EI   +K++ G  + TD+H   Q    A+   ILQIPA L RQTDLL AA
Sbjct: 69  FRGPGLERGLEILAKVKQETGLEVTTDIHEPCQAAPAAEVCRILQIPAFLARQTDLLEAA 128

Query: 155 AQT----GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSI 210
           ++       V+N+KK QF++P +  + ++K  A G   +L  ERGT+FGY  LV DMR I
Sbjct: 129 SKAALQYDGVVNIKKPQFVAPEDCIHAVKKCEAFGLDRLLLTERGTTFGYGRLVNDMRCI 188

Query: 211 PIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDN 270
           PIM  MG PVIFDA+HSVQ P   G  +GG+R+ I  LA+AAVA G  GIF ETH DP  
Sbjct: 189 PIMKQMGPPVIFDATHSVQTP--GGKSTGGDREMIPFLARAAVACGCDGIFAETHPDPSQ 246

Query: 271 APSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           A SDGPNM+ +        Q+     +   +
Sbjct: 247 ALSDGPNMLPLDHFASFAIQMQRFRDLFNEI 277


>gi|317048552|ref|YP_004116200.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pantoea sp. At-9b]
 gi|316950169|gb|ADU69644.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pantoea sp. At-9b]
          Length = 284

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
            T   + +G     +  +N+  FVL  G   +ES D A  I E    +   L I  V+K+
Sbjct: 1   MTQKVVSIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTDKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQAFGVKIITDVHEPAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFAEGGNDKVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M ++    PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+
Sbjct: 177 LVVDMLGFNVMKNVTNNSPVIFDVTHALQTRDPFGAASGGRRAQVGELARAGMAVGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|323168385|gb|EFZ54066.1| 3-deoxy-8-phosphooctulonate synthase [Shigella sonnei 53G]
          Length = 284

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLSFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKG 276


>gi|239996066|ref|ZP_04716590.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alteromonas macleodii
           ATCC 27126]
          Length = 284

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 119/268 (44%), Positives = 165/268 (61%), Gaps = 1/268 (0%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
               V  +N   FVL  G   +ES D A  IAE    + Q LNI  V+K+SFDKANRSS+
Sbjct: 9   NVGNVDVANHLPFVLFGGMNVLESRDLAMRIAEHYVEVTQKLNIPYVFKASFDKANRSSV 68

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG G+++G  IF ++K  +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ 
Sbjct: 69  TSYRGPGMEEGLRIFEEIKSTFNVPLITDVHEPHQAAPVAEVVDVIQLPAFLARQTDLVV 128

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           A A+TG VINVKK QFL+P EM +I+ KL   G   V+ CERG+ FGYN LV DM  +  
Sbjct: 129 AMAKTGSVINVKKPQFLAPHEMRHIIGKLGEAGNDKVILCERGSCFGYNNLVVDMLGMDA 188

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M      VIFDA+H++Q PG     + G R     LA++ +A+G+AG+F+E H +PD A 
Sbjct: 189 MKEYAP-VIFDATHALQMPGGRATSADGRRAQAAQLARSGMALGLAGLFIEAHPNPDEAL 247

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP  + +  L   L Q+ A+D+++K 
Sbjct: 248 CDGPCALPLAKLEPYLQQMKALDELVKG 275


>gi|283832859|ref|ZP_06352600.1| 3-deoxy-8-phosphooctulonate synthase [Citrobacter youngae ATCC
           29220]
 gi|291071459|gb|EFE09568.1| 3-deoxy-8-phosphooctulonate synthase [Citrobacter youngae ATCC
           29220]
          Length = 284

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K H  G   V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFHEGGNDKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSVMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP +A  DGP+ + +  L + L+Q+ AID ++K 
Sbjct: 237 FIEAHPDPAHAKCDGPSALPLAKLEQFLTQIKAIDDLVKS 276


>gi|149377458|ref|ZP_01895200.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinobacter algicola
           DG893]
 gi|149358225|gb|EDM46705.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinobacter algicola
           DG893]
          Length = 281

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 122/265 (46%), Positives = 169/265 (63%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +N + FVL  G   +ES + A  +AE      + L I  V+K+SFDKANRSS+   
Sbjct: 10  GIEVANHKPFVLFGGMNVLESPEMAMEVAEAYVEATRKLGIPYVFKASFDKANRSSVHSF 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL+KG +I  D+K K+G PI++DVH  +Q    A+  DI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGLEKGLQILADIKSKFGVPIISDVHEPEQAAPAAEVCDIIQLPAFLSRQTDLVVAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG VIN+KK QFL+P EM +I+ K    G   V+ CERGTSFGYN LV DM    IM S
Sbjct: 130 ETGAVINIKKAQFLAPQEMKHIIAKCGEAGNDKVILCERGTSFGYNNLVVDMLGFGIMKS 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           + VPV+FD +H++Q PG   + +GG R  +  LA A ++ G+AG+FLE H DPD A  DG
Sbjct: 190 LDVPVMFDVTHALQMPGGRADSAGGRRAQVTDLALAGMSQGLAGLFLEAHPDPDQAKCDG 249

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           P  + +  L   L+++ A+D ++K 
Sbjct: 250 PCALRLSQLEPFLARVKAVDDLVKS 274


>gi|253990001|ref|YP_003041357.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253781451|emb|CAQ84614.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Photorhabdus
           asymbiotica]
          Length = 292

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 126/282 (44%), Positives = 177/282 (62%), Gaps = 6/282 (2%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +      +++G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+
Sbjct: 7   ISMQQKVVNIGD----IKVANDLPFVLFGGMNVLESRDLAMSICEHYVTVTQKLGIPYVF 62

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL++G +IF++LKK++G  I+TDVH   Q + +A+ VD++Q+
Sbjct: 63  KASFDKANRSSIHSYRGPGLEEGMKIFQELKKQFGVKIITDVHEPAQAQPVAEVVDVIQL 122

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA L RQTDL+ A A+TG VINVKK QF+SP +M NI++K    G   V+ C+RG++FGY
Sbjct: 123 PAFLARQTDLVEAMARTGAVINVKKPQFISPGQMGNIVEKFKEGGNDQVILCDRGSNFGY 182

Query: 201 NTLVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIA 258
           + LV DM    +M     G PVIFD +HS+Q     G  SGG R  +  LA+A +A+GIA
Sbjct: 183 DNLVVDMLGFNVMAQATGGHPVIFDVTHSLQCRDPFGAASGGRRAQVAELARAGMAVGIA 242

Query: 259 GIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           G+FLE H DP NA  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 243 GLFLEAHPDPANARCDGPSALPLAKLEPFLIQMKAIDDVVKG 284


>gi|254450944|ref|ZP_05064381.1| 3-deoxy-8-phosphooctulonate synthase [Octadecabacter antarcticus
           238]
 gi|198265350|gb|EDY89620.1| 3-deoxy-8-phosphooctulonate synthase [Octadecabacter antarcticus
           238]
          Length = 277

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 149/275 (54%), Positives = 199/275 (72%), Gaps = 4/275 (1%)

Query: 26  AAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFD 85
             + +GS    VT SN++   +IAGPCQ+ES  HA MIAE++  +C +     V+K S+D
Sbjct: 2   KDVQIGS----VTASNDRPLTIIAGPCQLESLAHARMIAEEMSKVCDAHGAQFVFKGSYD 57

Query: 86  KANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLC 145
           KANR+SL+GKRG+G+ +G  I   +K ++G P+LTD+HT  QC  +A+ VDILQIPA LC
Sbjct: 58  KANRTSLSGKRGLGMDEGLAIHAAIKAEFGCPVLTDIHTADQCAPVAEVVDILQIPAFLC 117

Query: 146 RQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVT 205
           RQTDLL AA +TG  +N+KKGQFL+PW+M N++ K+ + G   +L  ERG SFGYN LVT
Sbjct: 118 RQTDLLLAAGETGAAVNIKKGQFLAPWDMANVVSKVESTGNTRILLTERGVSFGYNALVT 177

Query: 206 DMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
           DMRS+P M   G PV+ DA+H+V QPG  G  SGG+R++   LA+AAVAIGI  +FLETH
Sbjct: 178 DMRSLPEMMKTGYPVVMDATHAVAQPGGLGGSSGGQREFAPVLARAAVAIGIGAVFLETH 237

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +DPDNAPSDGPNMI ++D+  +L  L+A+D I K 
Sbjct: 238 EDPDNAPSDGPNMIALRDMDGVLKTLMALDAIAKA 272


>gi|162147713|ref|YP_001602174.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542337|ref|YP_002274566.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786290|emb|CAP55872.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530014|gb|ACI49951.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 278

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 150/266 (56%), Positives = 197/266 (74%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +T  N++ FVLIAGPCQIES  HA   A+ L+ I +   +GL+YKSSFDKANR+SL  
Sbjct: 10  GSLTVGNDRPFVLIAGPCQIESEAHAMETADALHGIARETGVGLIYKSSFDKANRTSLGA 69

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVG+  G EI   +++++G P+LTDVH   QC   A +VD+LQIPA LCRQTDLL AA
Sbjct: 70  ARGVGMAAGLEILARVRERFGVPVLTDVHAADQCAPTAAAVDVLQIPAFLCRQTDLLLAA 129

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG  INVKKGQFL+PW+M N+  K+ + G + ++ CERGTSFGYNTLV DMR +PIM 
Sbjct: 130 GETGAAINVKKGQFLAPWDMTNVAAKIASTGNERIMLCERGTSFGYNTLVNDMRGLPIMA 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PV++DA+HSVQQPG  G  SGG+R++   LA+ A+AIG+A +F+ETHQDPD+APSD
Sbjct: 190 ATGYPVVYDATHSVQQPGGLGGSSGGQREFAPILARGALAIGVAAVFIETHQDPDSAPSD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNMI I+D+  L+ +L   D++ K 
Sbjct: 250 GPNMIPIRDMKALVQRLAQYDRLTKA 275


>gi|255318122|ref|ZP_05359366.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter radioresistens
           SK82]
 gi|262379827|ref|ZP_06072983.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter radioresistens
           SH164]
 gi|255304833|gb|EET84006.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter radioresistens
           SK82]
 gi|262299284|gb|EEY87197.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter radioresistens
           SH164]
          Length = 285

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 125/266 (46%), Positives = 167/266 (62%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL  
Sbjct: 13  GDIQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICKRLDIPYVFKASFDKANRSSLNS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG E   ++KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 73  FRGPGLEKGIEWLGEIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAM 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM 
Sbjct: 133 AKTQAIINIKKAQFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMK 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP+ A  D
Sbjct: 193 EMNVPVFFDVTHALQTPGGRADSAGGRRAQIATLARAGMATGLAGLFLEAHPDPELAKCD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL  +D ++K 
Sbjct: 253 GPCALRLNQLEPFLAQLKELDTLVKG 278


>gi|34498202|ref|NP_902417.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Chromobacterium
           violaceum ATCC 12472]
 gi|44888084|sp|Q7NUF2|KDSA_CHRVO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|34104056|gb|AAQ60416.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Chromobacterium
           violaceum ATCC 12472]
          Length = 282

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 114/266 (42%), Positives = 165/266 (62%), Gaps = 2/266 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           VT  NE  F L  G   +ES D A   AE+   + Q L I  V+K SFDKANRSS+   R
Sbjct: 10  VTVGNEAPFTLFGGINVLESRDLALRAAEEYVRVTQKLGIPYVFKGSFDKANRSSIHSYR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +I + +K  +G P++TDVH   Q   +A+  D++Q+PA L RQTDL+ A A+
Sbjct: 70  GPGLEEGMKILQAVKDTFGVPVITDVHEPWQAAPVAEVADVVQLPAFLARQTDLVEALAK 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TGR +N+KK QF+SP ++ N+++K    G + ++ C+RGT  GY+ LV DM    +M  +
Sbjct: 130 TGRAVNIKKPQFMSPAQIQNVVEKFVEAGNEQLILCDRGTCLGYDNLVVDMLGFGVMKKV 189

Query: 217 --GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PVIFD +HS+QQ       SGG R  +  LA+A +A+G+AG+FLE H +P  A  D
Sbjct: 190 SGNRPVIFDVTHSLQQRESGAAASGGRRAQVAELARAGMAVGLAGLFLEAHPNPAEAKCD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP+ + +  L   L+Q+ AID ++K 
Sbjct: 250 GPSALPLAQLEPFLAQVKAIDDLVKS 275


>gi|226329849|ref|ZP_03805367.1| hypothetical protein PROPEN_03761 [Proteus penneri ATCC 35198]
 gi|225200644|gb|EEG82998.1| hypothetical protein PROPEN_03761 [Proteus penneri ATCC 35198]
          Length = 292

 Score =  272 bits (696), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 125/281 (44%), Positives = 179/281 (63%), Gaps = 6/281 (2%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           +   +  +++G     +  +N   FVL  G   +ES D A  I E    + Q LNI  V+
Sbjct: 7   INMQHKVVNIGD----IKVANNLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLNIPYVF 62

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           K+SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +++ VD++Q+
Sbjct: 63  KASFDKANRSSIHSYRGPGLEEGLKIFQELKETFGVKIITDVHEAAQAQPVSEVVDVIQL 122

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY
Sbjct: 123 PAFLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNDQVILCDRGSNFGY 182

Query: 201 NTLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIA 258
           + LV DM    +M     G PVIFD +HS+Q     G  SGG R  +  LA+A +A+G+A
Sbjct: 183 DNLVVDMLGFHVMMQASQGAPVIFDVTHSLQCRDPFGAASGGRRAQVAELARAGMAVGLA 242

Query: 259 GIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           G+FLE H DPDNA  DGP+ + +  L   L+Q+ AID+++K
Sbjct: 243 GLFLEAHPDPDNALCDGPSALPLAKLEPFLAQIKAIDEVVK 283


>gi|255535442|ref|YP_003095813.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Flavobacteriaceae
           bacterium 3519-10]
 gi|255341638|gb|ACU07751.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Flavobacteriaceae bacterium 3519-10]
          Length = 269

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 114/264 (43%), Positives = 153/264 (57%), Gaps = 1/264 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           + +   N   F LIAGPC IE  D A  IAEK+  I     I  ++K SF KANRS +  
Sbjct: 6   DNIHHKNSSNFFLIAGPCIIEGEDMALRIAEKVLEITNRYQIPYIFKGSFKKANRSRVDS 65

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
              +G +K  EI + + + +  P  TD+H  +     A+ VD+LQIPA L RQTDLL AA
Sbjct: 66  FTTIGEEKSLEILKKVGETFNIPTTTDIHENEHAALAANYVDVLQIPAFLVRQTDLLIAA 125

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+ I +KKGQFLSP  M   ++K+   G +     ERG SFGY  LV D R IP M 
Sbjct: 126 AKTGKCITLKKGQFLSPESMKFAVEKVTDSGNEKTAIIERGNSFGYTDLVVDFRGIPTMR 185

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           +    VI D +HS+QQP  +   +GG  + I  +AKA +A+G  G+F+ETH DP  A SD
Sbjct: 186 NYAP-VILDVTHSLQQPNQNSGVTGGRPELIETIAKAGIAVGADGLFIETHPDPSCALSD 244

Query: 275 GPNMINIKDLPKLLSQLLAIDKII 298
           G NM+ +  L  LL +L  + + I
Sbjct: 245 GANMLRLDKLEDLLQKLTRVRQAI 268


>gi|260772294|ref|ZP_05881210.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           metschnikovii CIP 69.14]
 gi|260611433|gb|EEX36636.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           metschnikovii CIP 69.14]
          Length = 283

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 124/280 (44%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +H+G     +  +N+  F L AG   +ES D A  I E    + + L I  V+K+
Sbjct: 1   MEQKIVHIG----HIPVANDHPFTLFAGMNVLESRDLAMQICEYYVKVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVHTE Q + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKETFGVKIITDVHTEAQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K    G + V+ CERG   GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECGNEQVILCERGACHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKASQGSPIIFDVTHSLQMRDPLGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H  PD A  DGP+ + +  L   L+Q+ A+D +IK 
Sbjct: 237 FIEAHPTPDQAKCDGPSALPLDKLEPFLAQMKALDDLIKS 276


>gi|56413307|ref|YP_150382.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362232|ref|YP_002141869.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|59798121|sp|Q5PNK8|KDSA_SALPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238690760|sp|B5BI79|KDSA_SALPK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|56127564|gb|AAV77070.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093709|emb|CAR59181.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
          Length = 284

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVNIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKVITDVHEASQVQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K H  G   V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFHEGGNDKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSVMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE+H DP NA  DGP+ + +  L + L+Q+ AID ++K 
Sbjct: 237 FLESHPDPANAKCDGPSALPLAKLEQFLTQIKAIDDLVKS 276


>gi|315125562|ref|YP_004067565.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas sp.
           SM9913]
 gi|315014075|gb|ADT67413.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas sp.
           SM9913]
          Length = 284

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 120/267 (44%), Positives = 173/267 (64%), Gaps = 1/267 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           + +  SN   FVL  G   +ES D A  +AE    I   LNI  ++K+SFDKANRSS+  
Sbjct: 9   DNIELSNNAPFVLFGGVNVLESRDLAMRVAEHYVEITNKLNIPYIFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++KK +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKKTFNIPLITDVHEPYQAAPVAEIVDVIQLPAFLARQTDLVIAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  ++  CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNNNIALCERGSSFGYNNLVVDMLGMDDMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           SM   VIFDA+H++Q+PG   + + G R     LA++ +A+GIAG+F+E H +P+ A  D
Sbjct: 189 SMAP-VIFDATHALQRPGGRIDSADGRRAQAAELARSGMALGIAGLFIEAHPNPNEAKCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKPL 301
           GP  + +  L   L+Q+ A+D +IK L
Sbjct: 248 GPCALALDKLEGYLTQMKAVDDLIKNL 274


>gi|293395778|ref|ZP_06640060.1| 3-deoxy-8-phosphooctulonate synthase [Serratia odorifera DSM 4582]
 gi|291421715|gb|EFE94962.1| 3-deoxy-8-phosphooctulonate synthase [Serratia odorifera DSM 4582]
          Length = 284

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----IKVANDLPFVLFGGMNVLESRDLAMSICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G  IF ++KK +G  I+TDVH   Q + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMRIFEEIKKTFGVKIITDVHESAQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M ++  G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMKNVTGGHPVIFDVTHALQTRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|332306419|ref|YP_004434270.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173748|gb|AEE23002.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 283

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 116/266 (43%), Positives = 167/266 (62%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N + FVL  G   +ES D A  IAE    I   L I  V+K+SFDKANRSS+  
Sbjct: 10  GDIQVANNKPFVLFGGMNVLESRDMAMRIAEHYKEITTKLGIPYVFKASFDKANRSSVNS 69

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+ KG EIF ++K  +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 70  YRGPGMDKGLEIFAEIKATFDVPLITDVHEPAQAAPVAEVVDVIQLPAFLARQTDLVVAM 129

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +INVKK QFL+P EM +I+ K    G   ++ CERG+SFGYN LV DM  +  M 
Sbjct: 130 AETNAIINVKKPQFLAPHEMRHIITKFMEAGNDKIILCERGSSFGYNNLVVDMLGMDEMK 189

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
                VIFDA+H++Q+PG   + + G R     LA++ +A+G+AG+F+E H +P+ A  D
Sbjct: 190 QFAP-VIFDATHALQKPGGRTDSADGRRAQAAQLARSGMALGLAGLFIEAHPNPNEAKCD 248

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  +++  L   L Q+LA+D+++K 
Sbjct: 249 GPCALSLDKLEPYLQQMLALDELVKG 274


>gi|94501203|ref|ZP_01307725.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanobacter sp. RED65]
 gi|94426630|gb|EAT11616.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanobacter sp. RED65]
          Length = 279

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 118/264 (44%), Positives = 168/264 (63%), Gaps = 1/264 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N   F L  G   +ES D A  I E+   + + L I  V+K+SFDKANRSS+   R
Sbjct: 10  LDVANNIPFTLFGGMNVLESRDLAMSICEEYVKVTEKLGIPYVFKASFDKANRSSINSYR 69

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G G+ +G +IF+++K  +G PI+TDVH   Q   +A+ VD++Q+PA L RQTDL+ A A+
Sbjct: 70  GPGMDEGLKIFQEIKDTFGVPIITDVHEPYQAAPVAEVVDVIQLPAFLARQTDLVVAMAK 129

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG  INVKK QFL+P EM +I++K    G + V+ CERG+SFGYN LV DM  +  M   
Sbjct: 130 TGAAINVKKPQFLAPHEMRHIIKKFEEAGNQRVMLCERGSSFGYNNLVVDMLGMDEMK-T 188

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
             PVIFDA+H++Q+PG   + + G R     LA++ +A+GIAG+FLE H +PD A  DGP
Sbjct: 189 MAPVIFDATHALQRPGGRSDSADGRRAQAFELARSGMALGIAGLFLEAHPNPDEAKCDGP 248

Query: 277 NMINIKDLPKLLSQLLAIDKIIKP 300
             + +  L   L Q+ A+D ++K 
Sbjct: 249 CALPLDKLEPYLEQMKAVDDLVKS 272


>gi|270261432|ref|ZP_06189705.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Serratia odorifera
           4Rx13]
 gi|270044916|gb|EFA18007.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Serratia odorifera
           4Rx13]
          Length = 284

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMSICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G  IF ++KK +G  I+TDVH   Q + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMRIFEEIKKTFGVKIITDVHEASQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M ++  G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMKNVTGGHPVIFDVTHALQTRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|22126171|ref|NP_669594.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis KIM 10]
 gi|45441673|ref|NP_993212.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51596335|ref|YP_070526.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108807401|ref|YP_651317.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis Antiqua]
 gi|108811666|ref|YP_647433.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis
           Nepal516]
 gi|145598392|ref|YP_001162468.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis
           Pestoides F]
 gi|149366047|ref|ZP_01888082.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis
           CA88-4125]
 gi|153950173|ref|YP_001401035.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia
           pseudotuberculosis IP 31758]
 gi|162419803|ref|YP_001606874.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis Angola]
 gi|165926394|ref|ZP_02222226.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938890|ref|ZP_02227444.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166009222|ref|ZP_02230120.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|167401446|ref|ZP_02306943.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167420169|ref|ZP_02311922.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167424759|ref|ZP_02316512.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170024406|ref|YP_001720911.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia
           pseudotuberculosis YPIII]
 gi|186895378|ref|YP_001872490.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia
           pseudotuberculosis PB1/+]
 gi|218929132|ref|YP_002347007.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis CO92]
 gi|229894732|ref|ZP_04509912.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Yersinia pestis
           Pestoides A]
 gi|229897432|ref|ZP_04512588.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229898075|ref|ZP_04513226.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229901944|ref|ZP_04517065.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Yersinia pestis
           Nepal516]
 gi|270490873|ref|ZP_06207947.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis KIM D27]
 gi|294503908|ref|YP_003567970.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis Z176003]
 gi|20532110|sp|Q8ZEX4|KDSA_YERPE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|59798201|sp|Q66AX1|KDSA_YERPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|123245830|sp|Q1C850|KDSA_YERPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|123373286|sp|Q1CJJ7|KDSA_YERPN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|158514074|sp|A4TJN3|KDSA_YERPP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|166987636|sp|A7FIF7|KDSA_YERP3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761667|sp|A9QZ04|KDSA_YERPG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238688459|sp|B1JM81|KDSA_YERPY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238691367|sp|B2K2Z4|KDSA_YERPB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|21959135|gb|AAM85845.1|AE013831_8 2-dehydro-3-deoxyphosphooctulonate aldolase [Yersinia pestis KIM
           10]
 gi|45436535|gb|AAS62089.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51589617|emb|CAH21247.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108775314|gb|ABG17833.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis
           Nepal516]
 gi|108779314|gb|ABG13372.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis Antiqua]
 gi|115347743|emb|CAL20658.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis CO92]
 gi|145210088|gb|ABP39495.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis
           Pestoides F]
 gi|149292460|gb|EDM42534.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis
           CA88-4125]
 gi|152961668|gb|ABS49129.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pseudotuberculosis
           IP 31758]
 gi|162352618|gb|ABX86566.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis Angola]
 gi|165913253|gb|EDR31876.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921615|gb|EDR38812.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165991777|gb|EDR44078.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166961864|gb|EDR57885.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167049142|gb|EDR60550.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167056641|gb|EDR66410.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169750940|gb|ACA68458.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia
           pseudotuberculosis YPIII]
 gi|186698404|gb|ACC89033.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia
           pseudotuberculosis PB1/+]
 gi|229680840|gb|EEO76935.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Yersinia pestis
           Nepal516]
 gi|229689116|gb|EEO81181.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229693769|gb|EEO83818.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229702205|gb|EEO90224.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Yersinia pestis
           Pestoides A]
 gi|262361971|gb|ACY58692.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis D106004]
 gi|262365890|gb|ACY62447.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis D182038]
 gi|270339377|gb|EFA50154.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis KIM D27]
 gi|294354367|gb|ADE64708.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia pestis Z176003]
 gi|320015301|gb|ADV98872.1| 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 284

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 119/280 (42%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+++G  ++TDVH   Q + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQQFGVKVITDVHEASQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI++K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFVSPGQMGNIVEKFKEAGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMVQATGGHPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|118602804|ref|YP_904019.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|118567743|gb|ABL02548.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 277

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 124/265 (46%), Positives = 176/265 (66%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
               S +Q F LIAG C IES       A  L  +  +L +  +YKSS+DKANR+S+   
Sbjct: 5   DFEVSIDQPFFLIAGLCVIESEALVMETATYLAKVTNNLGVNFIYKSSYDKANRTSVNSF 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+GL++G  I + +K + G P+LTDVH +   + +A  VD++Q PA L RQT+ +    
Sbjct: 65  RGLGLEQGLRILQKVKDEVGVPVLTDVHEDTPLDEVASVVDMMQTPAFLVRQTNFIQNVC 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           + G  +N+KKGQF +PW+M+N+++K HA G + +  C+RGTSFGYNTL++DMR +  M +
Sbjct: 125 KQGLPVNIKKGQFQAPWDMNNVVEKAHATGNQQITVCDRGTSFGYNTLISDMRGLVSMRN 184

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
              PV+FDA+HSVQQPG  G  SGG+R+ +  LA+AAVA+GI+GIF+ETH +P NA SDG
Sbjct: 185 TNCPVVFDATHSVQQPGGQGTTSGGQREMVPVLARAAVAVGISGIFMETHPNPTNAKSDG 244

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PN I I  + +LL  L  +D + K 
Sbjct: 245 PNSIPINKMDELLKILQELDNVTKK 269


>gi|269138760|ref|YP_003295461.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Edwardsiella tarda
           EIB202]
 gi|267984421|gb|ACY84250.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Edwardsiella tarda
           EIB202]
 gi|304558753|gb|ADM41417.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Edwardsiella tarda FL6-60]
          Length = 284

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 125/279 (44%), Positives = 178/279 (63%), Gaps = 6/279 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----IQVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVHT +Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHTPEQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI+ K    G + V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPGQMGNIVDKFQEGGNEQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M +   G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 177 LVVDMLGFGVMKNVSHGAPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+E H DP +A  DGP+ + +  L   L+Q+ AID ++K
Sbjct: 237 FIEAHPDPAHAMCDGPSALPLAKLEPFLAQMKAIDDLVK 275


>gi|300995962|ref|ZP_07181324.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 200-1]
 gi|300304659|gb|EFJ59179.1| 3-deoxy-8-phosphooctulonate synthase [Escherichia coli MS 200-1]
          Length = 284

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 173/280 (61%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N   FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANALPFVLFGGMNVLESRDLAMRICEHYLTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKG 276


>gi|16760665|ref|NP_456282.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|16765113|ref|NP_460728.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29141576|ref|NP_804918.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|62180336|ref|YP_216753.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|161613732|ref|YP_001587697.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167553923|ref|ZP_02347666.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167993215|ref|ZP_02574310.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168233803|ref|ZP_02658861.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168237826|ref|ZP_02662884.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168241354|ref|ZP_02666286.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168260003|ref|ZP_02681976.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168462752|ref|ZP_02696683.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168820510|ref|ZP_02832510.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194446013|ref|YP_002041022.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194451824|ref|YP_002045815.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194472712|ref|ZP_03078696.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194737901|ref|YP_002114802.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197248417|ref|YP_002146257.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197262892|ref|ZP_03162966.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198243566|ref|YP_002215373.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200390905|ref|ZP_03217516.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204927714|ref|ZP_03218915.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205352560|ref|YP_002226361.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207856721|ref|YP_002243372.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|213028508|ref|ZP_03342955.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
 gi|213051782|ref|ZP_03344660.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213426499|ref|ZP_03359249.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213586793|ref|ZP_03368619.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213650658|ref|ZP_03380711.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213850176|ref|ZP_03381074.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|224583738|ref|YP_002637536.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|238913672|ref|ZP_04657509.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|289825250|ref|ZP_06544534.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|54037500|sp|P65216|KDSA_SALTI RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|54041401|sp|P65215|KDSA_SALTY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|75482998|sp|Q57NN9|KDSA_SALCH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|189028415|sp|A9MW08|KDSA_SALPB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761662|sp|B5F4I0|KDSA_SALA4 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761663|sp|B5FU23|KDSA_SALDC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761664|sp|B5R3K3|KDSA_SALEP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226761665|sp|B5R6I4|KDSA_SALG2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238689755|sp|B4TXT8|KDSA_SALSV RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238690682|sp|B4TKA0|KDSA_SALHS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238693510|sp|B4SUF8|KDSA_SALNS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|254807750|sp|C0Q363|KDSA_SALPC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|25291178|pir||AF0719 2-dehydro-3-deoxyphosphooctonate aldolase [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16420302|gb|AAL20687.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16502961|emb|CAD02127.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29137203|gb|AAO68767.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|62127969|gb|AAX65672.1| 3-deoxy-D-manno-octulosonic acid 8-P synthetase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161363096|gb|ABX66864.1| hypothetical protein SPAB_01457 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404676|gb|ACF64898.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194410128|gb|ACF70347.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194459076|gb|EDX47915.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194713403|gb|ACF92624.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195634236|gb|EDX52588.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197212120|gb|ACH49517.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197241147|gb|EDY23767.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289259|gb|EDY28626.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197938082|gb|ACH75415.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199603350|gb|EDZ01896.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204323056|gb|EDZ08252.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205272341|emb|CAR37221.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205321746|gb|EDZ09585.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205328652|gb|EDZ15416.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205332139|gb|EDZ18903.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205339596|gb|EDZ26360.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205342596|gb|EDZ29360.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205350758|gb|EDZ37389.1| 3-deoxy-8-phosphooctulonate synthase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708524|emb|CAR32845.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|224468265|gb|ACN46095.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|261246958|emb|CBG24775.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267993720|gb|ACY88605.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301158296|emb|CBW17795.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312912761|dbj|BAJ36735.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320085727|emb|CBY95505.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321224400|gb|EFX49463.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322616768|gb|EFY13676.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322620422|gb|EFY17288.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322625676|gb|EFY22495.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322626126|gb|EFY22936.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322633733|gb|EFY30473.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322638887|gb|EFY35580.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322640870|gb|EFY37519.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322644091|gb|EFY40636.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322649162|gb|EFY45600.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322655321|gb|EFY51629.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660921|gb|EFY57152.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322662782|gb|EFY58989.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322667966|gb|EFY64125.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674272|gb|EFY70366.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322678553|gb|EFY74611.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322683212|gb|EFY79228.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686906|gb|EFY82884.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|322714810|gb|EFZ06381.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323130042|gb|ADX17472.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323195204|gb|EFZ80384.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323200205|gb|EFZ85291.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323204533|gb|EFZ89537.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323207350|gb|EFZ92298.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323213945|gb|EFZ98714.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323217335|gb|EGA02054.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323221170|gb|EGA05598.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323228024|gb|EGA12169.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323231357|gb|EGA15470.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323235797|gb|EGA19876.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323240366|gb|EGA24409.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323245258|gb|EGA29258.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323249063|gb|EGA32983.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323252820|gb|EGA36656.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323254889|gb|EGA38683.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323260917|gb|EGA44516.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323266731|gb|EGA50217.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|326623119|gb|EGE29464.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|326627620|gb|EGE33963.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
 gi|332988659|gb|AEF07642.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 284

 Score =  272 bits (695), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 177/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVNIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K H  G   V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFHEGGNDKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSVMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           FLE+H DP NA  DGP+ + +  L + L+Q+ AID ++K 
Sbjct: 237 FLESHPDPANAKCDGPSALPLAKLEQFLTQIKAIDDLVKS 276


>gi|192362402|ref|YP_001982689.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Cellvibrio japonicus
           Ueda107]
 gi|190688567|gb|ACE86245.1| 3-deoxy-8-phosphooctulonate synthase [Cellvibrio japonicus Ueda107]
          Length = 283

 Score =  272 bits (695), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 118/267 (44%), Positives = 169/267 (63%), Gaps = 2/267 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N   FVL  G   +ES D A  +AE      Q LNI  V+K+SFDKANRSS+  
Sbjct: 9   GSLQVANNLPFVLFGGMNVLESRDMAMQVAEAYVKATQKLNIPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+ +G +IF+++K+ +  P++TD+H   QC  +A+  D++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMDEGLKIFQEIKQTFAIPVITDIHEIYQCTPVAEVCDVIQLPAFLARQTDLVIAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFLSP +M NI++K    G   ++ C+RGT+FGY+ LV DM     M 
Sbjct: 129 AKTGAVINIKKPQFLSPGQMKNIVEKFEECGNDKIILCDRGTNFGYDNLVVDMLGFRTMR 188

Query: 215 SM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
            +    PVIFD +HS+Q     G  S G R  +  LA+A +A+G+AG+FLE H DP+NA 
Sbjct: 189 DVSGNAPVIFDVTHSLQCRDPMGAASSGRRHQVTELARAGMAVGLAGLFLEAHPDPNNAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
            DGP+ + +  L   L Q+ AID+++K
Sbjct: 249 CDGPSALPLDKLEPFLHQMKAIDELVK 275


>gi|254441710|ref|ZP_05055203.1| 3-deoxy-8-phosphooctulonate synthase [Octadecabacter antarcticus
           307]
 gi|198251788|gb|EDY76103.1| 3-deoxy-8-phosphooctulonate synthase [Octadecabacter antarcticus
           307]
          Length = 277

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 144/275 (52%), Positives = 199/275 (72%), Gaps = 4/275 (1%)

Query: 26  AAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFD 85
             + +GS    +T SN++   +IAGPCQ+ES  HA MIAE++  +C +     V+K S+D
Sbjct: 2   KDVQIGS----ITASNDRPLTVIAGPCQLESLAHARMIAEQMAKVCDAHGAQFVFKGSYD 57

Query: 86  KANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLC 145
           KANR+SL+G+RG+G+ +G  I   +K ++G P+LTD+HT  QC  +A+ VDILQIPA LC
Sbjct: 58  KANRTSLSGRRGLGIDEGLAIHAAIKAEFGCPVLTDIHTANQCAPVAEVVDILQIPAFLC 117

Query: 146 RQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVT 205
           RQTDLL AA +TG  +N+KKGQFL+PW+M N++ K+ + G   +L  ERG SFGYN LVT
Sbjct: 118 RQTDLLLAAGETGAAVNIKKGQFLAPWDMANVVSKVESTGNTRILLTERGVSFGYNALVT 177

Query: 206 DMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
           DMRS+P M   G PV+ DA+H+V QPG  G  SGG+R++   LA+AAVA+GI  +FLETH
Sbjct: 178 DMRSLPEMMKTGYPVVMDATHAVAQPGGLGGSSGGQREFAPVLARAAVAVGIGAVFLETH 237

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           ++PDNAPSDGPNMI ++D+  +L  L+A+D + K 
Sbjct: 238 ENPDNAPSDGPNMIALRDMDGVLKTLMALDLVAKA 272


>gi|49083387|gb|AAT51019.1| PA3636 [synthetic construct]
          Length = 282

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 118/278 (42%), Positives = 169/278 (60%), Gaps = 4/278 (1%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +   N+  FVL  G   +ES D A  + E+   + + L I  V+K+
Sbjct: 1   MAQKIVRVGD----IQIGNDLPFVLFGGMNVLESRDLAMQVCEEYVRVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF ++KK +  P++TDVH   Q + +A+  DI+Q+PA
Sbjct: 57  SFDKANRSSIHSFRGPGLEEGMKIFEEIKKTFKVPVITDVHEPFQAQPVAEVCDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQT+L+ A A+T  VIN+KK QFL+P EM +IL K    G   ++ CERG+SFGYN 
Sbjct: 117 FLSRQTNLVVAMARTNAVINIKKAQFLAPQEMKHILTKCEEAGNDRLILCERGSSFGYNN 176

Query: 203 LVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFL 262
           LV DM    IM     PV FD +H++Q PG   + +GG R  +  LAKA ++  +AG+FL
Sbjct: 177 LVVDMLGFGIMKQFEYPVFFDVTHALQMPGGRADSAGGRRAQVTDLAKAGLSQKLAGLFL 236

Query: 263 ETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           E H DP++A  DGP  + +  L   LSQL  +D++IK 
Sbjct: 237 EAHPDPEHAKCDGPCALRLNKLEAFLSQLKQLDELIKS 274


>gi|256822075|ref|YP_003146038.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Kangiella koreensis DSM
           16069]
 gi|256795614|gb|ACV26270.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Kangiella koreensis DSM
           16069]
          Length = 286

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 117/263 (44%), Positives = 169/263 (64%)

Query: 38  TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRG 97
               ++ F LI GPC IES   A   A  +  +   L I  +YKSSFDKANRSS    RG
Sbjct: 7   EVGLDKPFFLICGPCVIESEQLAIDTAGFMKEMTDRLGIPYIYKSSFDKANRSSSKSFRG 66

Query: 98  VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQT 157
            GL++G  I + +K + G P+LTDVH +   + +AD VD++Q PA LCRQT+ +    + 
Sbjct: 67  PGLEEGLRILQKVKDQVGVPVLTDVHEDTPMQEVADVVDVMQTPAFLCRQTNFIRKVCEP 126

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           G  +N+KKGQFLSPW+M N++ K    G ++++ CERG SFGYN LV+DMRS+ IM   G
Sbjct: 127 GIPVNIKKGQFLSPWDMKNVVDKARETGNQNIMVCERGVSFGYNNLVSDMRSLSIMRETG 186

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
            P+++DA+HS Q PG  G+ SGG R  I  LA+AA+A G++G+F+E+H +P+ A  DGPN
Sbjct: 187 CPIVYDATHSAQLPGGQGSTSGGLRDVIPVLARAAIAAGVSGVFMESHPNPEVAKCDGPN 246

Query: 278 MINIKDLPKLLSQLLAIDKIIKP 300
              +  + ++L  +  +D ++K 
Sbjct: 247 SFPMYRIEEMLRVMKELDDVVKK 269


>gi|297581725|ref|ZP_06943647.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio cholerae RC385]
 gi|297534132|gb|EFH72971.1| 3-deoxy-8-phosphooctulonate synthase [Vibrio cholerae RC385]
          Length = 265

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 112/254 (44%), Positives = 159/254 (62%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             LIAGPC IES         KL  I     I  + KSSF KANRSS++   G G+ KG 
Sbjct: 1   MFLIAGPCVIESEGLVLDTFGKLQEITNKFGIEYIAKSSFTKANRSSVSAFTGPGIDKGL 60

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           +I +  K++ G  +LTDVH +   + +A  VD+LQ PA L RQT  +   A  G+ +N+K
Sbjct: 61  KILQKAKEQLGVRVLTDVHEDTPLDEVASVVDVLQTPAFLVRQTGFIQRVASQGKPVNIK 120

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQ++ P +M  +++K  A G +D+  C+RGTSFG+  LV  M  + IM   G  V+ DA
Sbjct: 121 KGQWMHPSDMAPVVEKCRAVGNEDIWLCDRGTSFGFGQLVNYMPGLTIMRETGCKVVMDA 180

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG+ G  +GG R ++  +A+AAVA+GI G+F+ETH +PD A  DGPNM+ ++ +
Sbjct: 181 THSVQMPGMLGGSTGGNRYHVPAIARAAVAVGIDGLFMETHPNPDQALCDGPNMLPLQYM 240

Query: 285 PKLLSQLLAIDKII 298
            +LL  LL ID+I+
Sbjct: 241 EELLGTLLEIDEIV 254


>gi|90581731|ref|ZP_01237518.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio angustum S14]
 gi|90437085|gb|EAS62289.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio angustum S14]
          Length = 284

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 115/281 (40%), Positives = 172/281 (61%), Gaps = 6/281 (2%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +     + +G     +  +N++ FVL  G   +ES D A  + E    + + L I  V+K
Sbjct: 1   MMEQKTVRIGD----IDVANDKPFVLFGGMNVLESRDLAMQMCEHYVKVTEKLGIPYVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS+   RG G+++G +IF++LK  +G  I+TD+H ++Q + +AD VD++Q+P
Sbjct: 57  ASFDKANRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDIHEKEQAQPVADVVDVIQLP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K       +V+ CERG   GY+
Sbjct: 117 AFLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECDNHNVILCERGVLHGYD 176

Query: 202 TLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
            LV DM    +M     G P+IFD +H++Q     G  SGG R+  V LA++ +A GIAG
Sbjct: 177 NLVVDMLGFDVMKKASKGSPIIFDVTHALQCRDPLGAASGGRREQTVDLARSGIATGIAG 236

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +F+E H  PD A  DGP+   +  L   L+Q+  +D +IK 
Sbjct: 237 LFMEAHPTPDLALCDGPSAFPLDKLEPFLAQIKQLDDLIKS 277


>gi|85711952|ref|ZP_01043006.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Idiomarina baltica
           OS145]
 gi|85694138|gb|EAQ32082.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Idiomarina baltica
           OS145]
          Length = 279

 Score =  271 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 117/266 (43%), Positives = 172/266 (64%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +TF N++ FVL  G   +ES D A   AE    + ++L I  V+K+SFDKANRSS+  
Sbjct: 7   GNITFDNQRPFVLFGGLNVLESQDLALRTAEHFMKVTEALGIPYVFKASFDKANRSSIHS 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G +IF  +K+ +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 67  FRGPGLEEGLKIFEAVKQAFNVPIITDVHEPYQASPVAEVADIIQLPAFLARQTDLVMAM 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG V+NVKK QFL+P EM +I++K +  G + +L CERG+ FGYN L+ DM  +  M 
Sbjct: 127 AKTGAVVNVKKPQFLAPHEMKHIIKKFNEAGNERILLCERGSCFGYNNLIVDMLGMDDMK 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           SM   V+FDA+H++Q+PG   + + G R     LA++ +A+G+AG+F+E H +PD A  D
Sbjct: 187 SMAP-VVFDATHALQRPGGRLDSADGRRAQAAELARSGMALGLAGLFIEAHPNPDEAKCD 245

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L Q+ A+D ++K 
Sbjct: 246 GPCALPLAKLEPYLQQMKAVDDLVKS 271


>gi|83593221|ref|YP_426973.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodospirillum rubrum
           ATCC 11170]
 gi|83576135|gb|ABC22686.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodospirillum rubrum
           ATCC 11170]
          Length = 280

 Score =  271 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 154/267 (57%), Positives = 199/267 (74%), Gaps = 1/267 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             VTF N+   VLIAGPCQ+ES +HA   A  L A+C  L +  +YK+SFDKANR+SL+G
Sbjct: 9   GPVTFGNDLPMVLIAGPCQMESREHALETASILVALCADLGVPFIYKTSFDKANRTSLSG 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           +RGVG++K   IF ++++  G P+LTDVH   QC  +A++VD+LQIPA LCRQTDLL AA
Sbjct: 69  QRGVGMEKALPIFAEIRETLGCPVLTDVHDAGQCAPVAEAVDVLQIPAFLCRQTDLLLAA 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM- 213
           A TGRVINVKKGQFL+PW+M N+  K+ + G + VL  ERG SFGYNTLVTDMRS+PIM 
Sbjct: 129 AATGRVINVKKGQFLAPWDMKNVANKVMSAGNERVLLTERGASFGYNTLVTDMRSLPIMA 188

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
              G P+I DA+HSVQQPG  G  SGG+R++   +A+AA+A+G+AG+FLETH DPD+APS
Sbjct: 189 RDTGCPIIIDATHSVQQPGGQGGSSGGQREFAPVIARAALAVGVAGVFLETHADPDHAPS 248

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGPNMI +  +P L++ L  +D   K 
Sbjct: 249 DGPNMIALDAMPALIAVLRDLDAFAKK 275


>gi|238797833|ref|ZP_04641326.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia mollaretii ATCC
           43969]
 gi|238718361|gb|EEQ10184.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia mollaretii ATCC
           43969]
          Length = 284

 Score =  271 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 178/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G  IF+DLK+++G  ++TDVH   QC+ +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMRIFQDLKQQFGVKVITDVHEISQCQPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI++K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFVSPGQMGNIVEKFKEAGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M     G PVIFD +H++Q     G+ SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMVQATGGHPVIFDVTHALQCRDPFGSASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLAKLEPFLVQMKAIDDLVKS 276


>gi|238792554|ref|ZP_04636187.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia intermedia ATCC
           29909]
 gi|238728189|gb|EEQ19710.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia intermedia ATCC
           29909]
          Length = 284

 Score =  271 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+++G  I+TDVH   Q + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQQFGVKIITDVHEASQAKPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFVSPGQMGNIVDKFKEAGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMVQATGGHPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|238751564|ref|ZP_04613055.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia rohdei ATCC
           43380]
 gi|238710282|gb|EEQ02509.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia rohdei ATCC
           43380]
          Length = 284

 Score =  271 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+++G  I+TDVH   Q + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQQFGVKIITDVHEASQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFVSPGQMGNIVDKFKEAGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMVKATGGHPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|238756938|ref|ZP_04618126.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia aldovae ATCC
           35236]
 gi|238704768|gb|EEP97297.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia aldovae ATCC
           35236]
          Length = 284

 Score =  271 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 179/280 (63%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+++G  ++TDVH   QC+ +A+ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQQFGVKVITDVHEISQCQPVAEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI++K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFVSPGQMGNIVEKFKEAGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M     G PVIFD +H++Q     G+ SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMIQATGGHPVIFDVTHALQCRDPFGSASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLAKLEPFLVQMKAIDDLVKS 276


>gi|197284961|ref|YP_002150833.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Proteus mirabilis
           HI4320]
 gi|227355363|ref|ZP_03839764.1| 3-deoxy-8-phosphooctulonate synthase [Proteus mirabilis ATCC 29906]
 gi|238693177|sp|B4EVS0|KDSA_PROMH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|194682448|emb|CAR42352.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Proteus mirabilis
           HI4320]
 gi|227164587|gb|EEI49458.1| 3-deoxy-8-phosphooctulonate synthase [Proteus mirabilis ATCC 29906]
          Length = 284

 Score =  271 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 123/277 (44%), Positives = 175/277 (63%), Gaps = 6/277 (2%)

Query: 26  AAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFD 85
             + +G     +  +N   FVL  G   +ES D A  I E    + Q L+I  V+K+SFD
Sbjct: 4   KVVSIGD----IKVANNLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLDIPYVFKASFD 59

Query: 86  KANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLC 145
           KANRSS+   RG GL +G +IF++LK+ +G  I+TDVH   Q + +++ VD++Q+PA L 
Sbjct: 60  KANRSSIHSYRGPGLDEGMKIFQELKETFGVKIITDVHEPSQAQPVSEVVDVIQLPAFLA 119

Query: 146 RQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVT 205
           RQTDL+ A A+TG VINVKK QF+SP +M NI++K    G   V+ C+RG++FGY+ LV 
Sbjct: 120 RQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVEKFKEGGNDQVILCDRGSNFGYDNLVV 179

Query: 206 DMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           DM    +M     G PVIFD +HS+Q     G  SGG R  +  LA+A +A+G+AG+FLE
Sbjct: 180 DMLGFHVMMQASEGAPVIFDVTHSLQCRDPFGAASGGRRGQVAELARAGMAVGLAGLFLE 239

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            H DPD+A  DGP+ + +  L   L+Q+ AID ++K 
Sbjct: 240 AHPDPDHARCDGPSALPLAKLEPFLAQIKAIDSLVKS 276


>gi|118580038|ref|YP_901288.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pelobacter propionicus
           DSM 2379]
 gi|158512562|sp|A1APG0|KDSA_PELPD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|118502748|gb|ABK99230.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pelobacter propionicus
           DSM 2379]
          Length = 272

 Score =  271 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 136/265 (51%), Positives = 188/265 (70%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             V    ++   L+AGPC IES       AE+L  IC +L++ L++K+S+DKANR+S+  
Sbjct: 8   GGVKIGAKRPLALVAGPCVIESELATMRQAERLMTICNALSLPLIFKASYDKANRTSIGA 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G  I R +K+  G  +L+DVH+ +Q    A+ +D+LQIPA LCRQTDLL AA
Sbjct: 68  YRGPGMREGLRILRKVKESLGLAVLSDVHSIEQVAPAAEVLDVLQIPAFLCRQTDLLIAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A TGRVINVKKGQFL+PW+M N+  K+ + G ++++  ERG SFGYN LV DMRS P+M 
Sbjct: 128 AATGRVINVKKGQFLAPWDMKNVAAKIASSGNENIILTERGASFGYNNLVVDMRSFPVMR 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           + G PVIFDA+HSVQ PG  G  SGG+R+++  L++AAVA G+ GIF+E H++P+ A  D
Sbjct: 188 ASGYPVIFDATHSVQLPGGQGESSGGQREFVEFLSRAAVAAGVDGIFMEVHEEPEKALCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIK 299
           GPN I + DLP LL+ L AID ++K
Sbjct: 248 GPNSIALNDLPALLATLKAIDAVVK 272


>gi|319790164|ref|YP_004151797.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thermovibrio
           ammonificans HB-1]
 gi|317114666|gb|ADU97156.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Thermovibrio
           ammonificans HB-1]
          Length = 269

 Score =  271 bits (694), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 121/258 (46%), Positives = 175/258 (67%), Gaps = 1/258 (0%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIG-LVYKSSFDKANRSSLAGKRGVGLKKG 103
            ++IAGPC IE     F +A  +  +         ++K+SFDKANRSSL   RG GL++G
Sbjct: 1   MIVIAGPCVIEDKGTVFEVARAVKELQSLYPEHTFIFKASFDKANRSSLDSFRGPGLERG 60

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
            E+ +++K++ G P+ TD+H   Q E +A+  D++QIPA LCRQTDLL AAA TG+ +N+
Sbjct: 61  LEVLKEVKEELGLPVTTDIHEPWQAEKVAEVADVIQIPAFLCRQTDLLVAAAGTGKTVNI 120

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQF++PW+M N ++K+   G ++V   ERGT+FGYN LV D RSIP+M      V+FD
Sbjct: 121 KKGQFMAPWDMENAVEKVRRSGGREVWVTERGTTFGYNNLVVDFRSIPVMEEFADKVVFD 180

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ+PG  G  SGG+R+++  LA+AAVA+G  G+F ETH +PD A SDGPNM+ +  
Sbjct: 181 ATHSVQRPGGLGRASGGDRRFVPYLARAAVAVGADGLFFETHPNPDKALSDGPNMVPLNG 240

Query: 284 LPKLLSQLLAIDKIIKPL 301
             +L+ +L+ +   +  L
Sbjct: 241 FRELIGKLIKLKSCVGEL 258


>gi|238788550|ref|ZP_04632343.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia frederiksenii
           ATCC 33641]
 gi|238723463|gb|EEQ15110.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia frederiksenii
           ATCC 33641]
          Length = 284

 Score =  271 bits (694), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 119/279 (42%), Positives = 176/279 (63%), Gaps = 6/279 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G  IF++LK+++G  ++TDVH   Q + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMRIFQELKQQFGVKVITDVHEASQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI++K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFVSPGQMGNIVEKFKEAGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMVQSTGGHPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLVQMKAIDDLVK 275


>gi|283785496|ref|YP_003365361.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Citrobacter rodentium
           ICC168]
 gi|282948950|emb|CBG88553.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Citrobacter rodentium
           ICC168]
          Length = 284

 Score =  271 bits (694), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVNIGD----IRVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+T  VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTDAVINVKKPQFISPGQMGNIVDKFREGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +HS+Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSVMKKVSGNSPVIFDVTHSLQCRDPFGAASGGRRGQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP NA  DGP+ + +  L + L Q+ AID ++K 
Sbjct: 237 FIEAHPDPANAKCDGPSALPLAKLEQFLVQMKAIDDLVKS 276


>gi|261253594|ref|ZP_05946167.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           orientalis CIP 102891]
 gi|260936985|gb|EEX92974.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase [Vibrio
           orientalis CIP 102891]
          Length = 283

 Score =  271 bits (694), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 175/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +H+G     +  +N++ F L AG   +ES D A  I E    + + L I  V+K+
Sbjct: 1   MEQKIVHVGD----IPVANDKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK  +G  I+TDVHTE Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSVHSYRGPGLEEGMKIFQELKDTFGVKIITDVHTEAQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP ++ NI+ K    G  +++ CERG+  GY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVDKFAECGNDNIILCERGSCHGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G P+IFD +HS+Q     G  SGG R+  V LAKA +A GIAG+
Sbjct: 177 LVVDMLGFGVMKKASNGSPIIFDVTHSLQMRDPSGAASGGRREQTVELAKAGLATGIAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H  PD A  DGP+ + +  L   L+Q+ A+D +IK 
Sbjct: 237 FIEAHPTPDQARCDGPSALPLDKLEPFLAQMKALDDLIKG 276


>gi|290968950|ref|ZP_06560485.1| 3-deoxy-8-phosphooctulonate synthase [Megasphaera genomosp. type_1
           str. 28L]
 gi|290780906|gb|EFD93499.1| 3-deoxy-8-phosphooctulonate synthase [Megasphaera genomosp. type_1
           str. 28L]
          Length = 281

 Score =  271 bits (693), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 126/278 (45%), Positives = 178/278 (64%), Gaps = 4/278 (1%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +    A+ +G      T   + +  ++AGPC +E  +    I + +  IC  L +  V+K
Sbjct: 1   MKPVKAVRIG----NKTVGGDGKLFVLAGPCVLEEEERVLAIGQTMKDICARLGLTYVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS    RG GL+KG EI + +K     PI++D+HT +Q +  A+ +D+LQIP
Sbjct: 57  ASFDKANRSSYTSFRGPGLEKGLEILQRIKDTLQVPIVSDIHTAEQAKRAAEVLDVLQIP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A LCRQTDLL AAA TG+ +NVKKGQF++P +M N+L K+   G ++++  ERG   GY+
Sbjct: 117 AFLCRQTDLLEAAAATGKCVNVKKGQFMAPEDMKNVLAKMVHVGNENLMLTERGFCLGYH 176

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
            LV DMR +PIM   G PVIFDA+HSVQ PG  G  S G+RQ+I  LA+AA   GI G+F
Sbjct: 177 NLVVDMRGLPIMREFGYPVIFDATHSVQLPGGAGTKSSGQRQFIGNLARAAAGSGIDGVF 236

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           +E H +P+ A SDGPNM+ +  +  +L  + AI +I K
Sbjct: 237 MEVHDNPEEALSDGPNMLYLSQVEAVLRDMTAIHEITK 274


>gi|87120715|ref|ZP_01076608.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinomonas sp. MED121]
 gi|86163943|gb|EAQ65215.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinomonas sp. MED121]
          Length = 290

 Score =  271 bits (693), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 117/279 (41%), Positives = 167/279 (59%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           I       +      V  +N   FVL +G   +ES D A  +AE+   +CQ+LNI  V+K
Sbjct: 3   IKMTEKSKIIEINQDVKVANHLPFVLFSGVNVLESRDLAMSVAEEHVKVCQALNIPYVFK 62

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
            SFDKANRSS+   RG G+++G  I  D+K  +  P++TDVH   QC  +A+  D++Q+P
Sbjct: 63  GSFDKANRSSINSFRGPGMEEGLRILEDVKASFNVPVITDVHEVAQCAPVAEVADVIQLP 122

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+ A AQT  VIN+KK QFL+P EM +IL K    G   ++ CERGT  GYN
Sbjct: 123 AFLSRQTDLVVAMAQTDAVINIKKAQFLAPHEMQHILTKCEEAGNDRLMLCERGTMMGYN 182

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
            LV DM    +M     PV+FD +H++Q+PG     + G R  +  LA++ +A+G++ +F
Sbjct: 183 NLVVDMLGFGLMKKFDYPVMFDVTHALQKPGGRAESADGRRAQVAELARSGMALGLSSLF 242

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           LETH +P+ A  DGP  + +  L   L QL  ID+++K 
Sbjct: 243 LETHPNPNQAKCDGPCALPLDKLKPFLHQLKQIDELVKG 281


>gi|238919473|ref|YP_002932988.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Edwardsiella ictaluri
           93-146]
 gi|259494403|sp|C5B817|KDSA_EDWI9 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|238869042|gb|ACR68753.1| 3-deoxy-8-phosphooctulonate synthase, putative [Edwardsiella
           ictaluri 93-146]
          Length = 284

 Score =  271 bits (693), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 127/279 (45%), Positives = 177/279 (63%), Gaps = 6/279 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----IQVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVHT +Q + +AD VDI+Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKRTFGVKIITDVHTPEQAQPVADVVDIIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QFLSP +M NI+ K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFLSPGQMGNIVDKFREGGNDRVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMT--SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M   S G PVIFD +HS+Q     G  SGG R  +  LA++ +AIG+AG+
Sbjct: 177 LVVDMLGFGVMKSVSHGAPVIFDVTHSLQCRDPFGAASGGRRAQVTELARSGMAIGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           F+E H DP +A  DGP+ + ++ L   L Q+ AID ++K
Sbjct: 237 FIEAHPDPVHAMCDGPSALPLEKLEPFLVQMKAIDDLVK 275


>gi|262370257|ref|ZP_06063583.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthase
           [Acinetobacter johnsonii SH046]
 gi|262314599|gb|EEY95640.1| 3-deoxy-D-manno-octulosonic acid 8-phosphate synthase
           [Acinetobacter johnsonii SH046]
          Length = 285

 Score =  271 bits (693), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 126/266 (47%), Positives = 166/266 (62%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N   FVL  G   +ES D AF IAE    IC+ L I  V+K+SFDKANRSSL  
Sbjct: 13  GDIQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICKRLEIPYVFKASFDKANRSSLNS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG E   D+KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 73  FRGPGLEKGIEWLADIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAM 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM 
Sbjct: 133 AKTDAIINIKKAQFLAPHEMRHILHKCLEAGNDKLIICERGSAFGYNNLVVDMLGFDIMK 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP+ A  D
Sbjct: 193 EMNVPVFFDVTHALQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEAHPDPEKAKCD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL  +D ++K 
Sbjct: 253 GPCALRMSQLEPFLAQLKELDTLVKG 278


>gi|332993695|gb|AEF03750.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alteromonas sp. SN2]
          Length = 284

 Score =  271 bits (693), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 120/266 (45%), Positives = 167/266 (62%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             V  +N   FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+  
Sbjct: 11  GDVEVANHLPFVLFGGMNVLESRDLAMRIAEHYVEVTQKLGIPYVFKASFDKANRSSVTS 70

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G  IF ++K  +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 71  YRGPGMEEGLRIFEEIKSTFNVPLITDVHEPHQAAPVAEVVDVIQLPAFLARQTDLVVAM 130

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFL+P EM +I+ KL   G   V+ CERG+SFGYN LV DM  +  M 
Sbjct: 131 AKTGSVINVKKPQFLAPHEMRHIITKLGEAGNDKVILCERGSSFGYNNLVVDMLGMDAMK 190

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           S    VIFDA+H++Q PG     + G R     LA++ +A+G+AG+F+E H +PD A  D
Sbjct: 191 SYAP-VIFDATHALQMPGGRATSADGRRAQAAQLARSGMALGLAGLFIEAHPNPDEAKCD 249

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+Q+ A+D+++K 
Sbjct: 250 GPCALPLAKLEPYLAQMKALDELVKG 275


>gi|90412794|ref|ZP_01220794.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Photobacterium profundum
           3TCK]
 gi|90326153|gb|EAS42580.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Photobacterium profundum
           3TCK]
          Length = 284

 Score =  271 bits (693), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 115/281 (40%), Positives = 170/281 (60%), Gaps = 6/281 (2%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +     + +G     +  +N++ FVL  G   +ES D A  I E    +   L I  V+K
Sbjct: 1   MMEQKTVRVGD----IDVANDKPFVLFGGMNVLESRDLAMKICEHYVEVTNKLGIPFVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS+   RG G+++G +IF++LK  +G  I+TD+H   Q + +AD VD++Q+P
Sbjct: 57  ASFDKANRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDIHEIYQAQPVADVVDVIQLP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+ A A+TG VINVKK Q++SP ++ NI++K      ++V+ CERG   GY+
Sbjct: 117 AFLARQTDLVEAMAKTGAVINVKKPQYMSPGQVGNIVEKFAECDNENVILCERGALHGYD 176

Query: 202 TLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
            LV DM    +M     G P+IFD +H++Q     G  SGG R+  V LA++ +A GIAG
Sbjct: 177 NLVVDMLGFDVMKKASKGSPIIFDVTHALQCRDPLGAASGGRREQTVDLARSGIATGIAG 236

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +F+E H  PD A  DGP+   +  L   L+Q+  +D +IK 
Sbjct: 237 LFMEAHPTPDQARCDGPSAFPLDKLEPFLNQIKQLDDLIKG 277


>gi|325276898|ref|ZP_08142589.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas sp. TJI-51]
 gi|324097967|gb|EGB96122.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas sp. TJI-51]
          Length = 280

 Score =  271 bits (693), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 114/269 (42%), Positives = 166/269 (61%), Gaps = 2/269 (0%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
            + +  SN   FVL  G   +ES D A     +   + Q L I  V+K+SFDKANRSS+ 
Sbjct: 5   NSTIECSNSAPFVLFGGINVLESEDLALTACAEYVRVTQKLGIPYVFKASFDKANRSSIH 64

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RG G+++G  IF  +K ++G PI+TDVH   Q   +A+ VD+LQ+PA L RQTDL+ A
Sbjct: 65  SYRGPGMEEGLRIFEKVKAEFGVPIITDVHEIYQAAPVAEVVDVLQLPAFLARQTDLVVA 124

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            A+TG+ +N+KK QFLSP +M NI+ K    G   ++ C+RGT  GY+ LV DM    +M
Sbjct: 125 LAKTGKPVNIKKPQFLSPSQMQNIVHKFKEAGNDQLILCDRGTCMGYDNLVVDMLGFGVM 184

Query: 214 TSMG--VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
                 +P+IFD +H++Q     G  SGG R+ +V LA+A + +G+AG+FLE H +PD A
Sbjct: 185 KRTCEDLPIIFDVTHALQNRDPSGAASGGRREQVVELARAGMGVGLAGLFLEAHPNPDQA 244

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
             DGP+ + +  L   L+Q+ A+D ++K 
Sbjct: 245 KCDGPSALPLDKLEPFLAQIKALDDLVKS 273


>gi|183221033|ref|YP_001839029.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
 gi|189911127|ref|YP_001962682.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167775803|gb|ABZ94104.1| 3-deoxy-8-phosphooctulonate synthase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167779455|gb|ABZ97753.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 281

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 117/262 (44%), Positives = 171/262 (65%)

Query: 38  TFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRG 97
                Q F LI+GPC +E+ D    +  ++ AIC  L I  ++KSSFDKANRSS+   RG
Sbjct: 14  KIGGRQPFFLISGPCVMENKDLLDRVCGEMKAICDDLGIVYIFKSSFDKANRSSINSYRG 73

Query: 98  VGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQT 157
            GL++GR++   +K KY  P+LTD+H   Q + + D+VDI QIPA L RQTDL+  AA+T
Sbjct: 74  PGLEEGRKLLDFIKNKYNVPVLTDIHETIQVDPLKDTVDIFQIPAFLSRQTDLIAKAAET 133

Query: 158 GRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMG 217
           G+ +NVKKGQF++P +  +I  K+   G++  +  ERG SFGY  LV D+R IP+M   G
Sbjct: 134 GKWVNVKKGQFMAPDDTRHIKTKIQESGSEKYMVTERGASFGYGNLVFDLRGIPMMHKHG 193

Query: 218 VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPN 277
           +P++FD +HS Q PG  GN +GG R++I  + + AV++G+ G+F+E H DP+ A SD   
Sbjct: 194 IPIVFDGTHSAQLPGAAGNITGGLREFIPHMMRGAVSVGVEGLFMEVHPDPEKALSDATT 253

Query: 278 MINIKDLPKLLSQLLAIDKIIK 299
              +     LL+QLL +D+++K
Sbjct: 254 QFPLAKAKSLLTQLLELDRLVK 275


>gi|134093724|ref|YP_001098799.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Herminiimonas
           arsenicoxydans]
 gi|133737627|emb|CAL60670.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO synthetase)
           [Herminiimonas arsenicoxydans]
          Length = 280

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 117/268 (43%), Positives = 168/268 (62%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +   N   FVL  G   +ES D A    E+   + Q L I  V+K+SFDKANRSS+  
Sbjct: 5   GDIKVDNALPFVLFGGINVLESRDLAMKSCEEYVRVTQKLGIPYVFKASFDKANRSSIHS 64

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL++G  IF ++KK +  P++TDVH   Q E +A+  D+LQ+PA L RQTDL+ A 
Sbjct: 65  YRGPGLEEGMRIFEEVKKTFNVPVITDVHEVHQAEIVAEVADVLQLPAFLARQTDLVVAL 124

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VIN+KK QFLSP +M NI++K    G + ++ C+RGT FGY+ LV DM    +M 
Sbjct: 125 AKTGSVINIKKPQFLSPSQMMNIVEKFKEAGNEQLILCDRGTCFGYDNLVVDMLGFGVMK 184

Query: 215 SMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
            +    P+IFD +H++QQ    G  SGG R+ +  LA+A +++G+AG+FLE H DP +A 
Sbjct: 185 KVCNNLPIIFDVTHALQQRDPGGAASGGRREQVADLARAGMSVGLAGLFLEAHPDPKSAK 244

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L+QL  +D ++K 
Sbjct: 245 CDGPSALPLDKLEPFLAQLKQLDDLVKS 272


>gi|283781752|ref|YP_003372507.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pirellula staleyi DSM
           6068]
 gi|283440205|gb|ADB18647.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pirellula staleyi DSM
           6068]
          Length = 285

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 134/268 (50%), Positives = 179/268 (66%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
                     +  +LIAGPC IE  D    IA +L  I   L + LV+K+SFDKANR+S 
Sbjct: 16  DVGPYRCGPGENLLLIAGPCVIEDADFTVAIAHELKRITSGLPVNLVFKASFDKANRTSS 75

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG GL+ G ++   + ++ G P+ TD+H   Q  A A+   +LQIPA L RQTDLL 
Sbjct: 76  GAFRGAGLEGGLKVLDRVVRETGLPVTTDIHESYQAAAAAEVCTVLQIPAFLARQTDLLV 135

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           AAAQTGR +NVKKGQF++PW+M ++  KL + G ++VL CERGT FGY  LV DMRS+P 
Sbjct: 136 AAAQTGRSVNVKKGQFMAPWDMAHVAGKLRSAGCQNVLLCERGTFFGYGRLVNDMRSLPQ 195

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           M S+G PV+FDA+HSVQ+PG  G  +GG R  + PLA+AAVAIG+ G+F ETH DPD +P
Sbjct: 196 MRSLGCPVVFDATHSVQEPGGLGGATGGNRAMVEPLARAAVAIGVDGLFFETHPDPDKSP 255

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           SDGPNM+ +     +LS++LAI +++  
Sbjct: 256 SDGPNMLPLATFSDVLSRVLAIRQLVTS 283


>gi|126667574|ref|ZP_01738544.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinobacter sp. ELB17]
 gi|126628000|gb|EAZ98627.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinobacter sp. ELB17]
          Length = 281

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 123/265 (46%), Positives = 170/265 (64%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +N + FVL AG   +ES + AF +AE    +C+ L I  V+K+SFDKANRSS+   
Sbjct: 10  DIEIANHKPFVLFAGMNVLESRELAFEVAETYVEVCRKLGIPFVFKASFDKANRSSVNSF 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL KG +I  D+K ++G PI++DVH   Q    A+  DI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGLDKGLQILADIKARFGVPIISDVHEAAQAAPAAEVCDIIQLPAFLSRQTDLVVAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG VIN+KK QFL+P EM +I+ K    G   ++ CERG+SFGYN LV DM    IM S
Sbjct: 130 KTGAVINIKKAQFLAPQEMRHIIAKFEEAGNDQIILCERGSSFGYNNLVVDMLGFGIMKS 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           M VPV+FD +HS+Q PG   + +GG R  +  LA A ++ G+AG+FLE H +PD A  DG
Sbjct: 190 MNVPVMFDVTHSLQMPGGRADSAGGRRAQVTELALAGMSQGLAGLFLEAHPNPDEAMCDG 249

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           P  + +  L   L ++ A+D ++K 
Sbjct: 250 PCSLRLSQLEPFLERVKAVDDLVKS 274


>gi|148549114|ref|YP_001269216.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida F1]
 gi|148513172|gb|ABQ80032.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida F1]
          Length = 280

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 111/269 (41%), Positives = 166/269 (61%), Gaps = 2/269 (0%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
           K+ +  SN+  FVL  G   +ES + A     +   + + L I  V+K+SFDKANRSS+ 
Sbjct: 5   KDSIICSNDAPFVLFGGINVLESEELALTACAEYVRVTEKLGIPYVFKASFDKANRSSIH 64

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RG G+++G  IF  +K ++G PI+TDVH   Q   +A+ VD+LQ+PA L RQTDL+ A
Sbjct: 65  SYRGPGMEEGLRIFEKVKAEFGVPIITDVHEISQAAPVAEVVDVLQLPAFLARQTDLVVA 124

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            A+TG+ +N+KK QFLSP +M NI+ K    G   ++ C+RG+  GY+ LV DM    +M
Sbjct: 125 LAKTGKPVNIKKPQFLSPSQMRNIVDKFQEAGNDQLILCDRGSCMGYDNLVVDMLGFGVM 184

Query: 214 TSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
                  P+IFD +H++Q     G  SGG R+ +V LA+A + +G+AG+FLE H +P  A
Sbjct: 185 KRTCNNLPIIFDVTHALQNRDPSGAASGGRREQVVDLARAGMGVGLAGLFLEAHPNPIQA 244

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
             DGP+ + +  L   L+Q+ A+D ++K 
Sbjct: 245 KCDGPSALPLDKLEPFLAQIKALDDLVKS 273


>gi|88861349|ref|ZP_01135979.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas
           tunicata D2]
 gi|88816615|gb|EAR26440.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas
           tunicata D2]
          Length = 282

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 120/266 (45%), Positives = 171/266 (64%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N + FVL  G   +ES D A  IAE    +   L I  V+K+SFDKANRSS+  
Sbjct: 9   GSIEVANNKPFVLFGGMNVLESRDLAMRIAEYYVEVTTKLGIPYVFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL +G +IF+++K+ +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLDEGLKIFQEIKQTFNVPLITDVHEPHQAAPVAEVVDVIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFL+P EM +I+QK H  G   V+ CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAVINVKKPQFLAPHEMRHIIQKFHEAGNDKVILCERGSSFGYNNLVVDMLGMDDMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PVIFDA+H++Q+PG   + + G R     LA++ +A+G+AG+F+E H +P+ A  D
Sbjct: 189 Q-QAPVIFDATHALQRPGGRTDSADGRRAQAAELARSGMALGLAGLFIEAHPNPNEAKCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+Q+ A+D +IK 
Sbjct: 248 GPCALQLDKLAGYLTQMKAVDDLIKS 273


>gi|148238567|ref|YP_001223954.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus sp. WH
           7803]
 gi|158513310|sp|A5GI92|KDSA_SYNPW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|147847106|emb|CAK22657.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Synechococcus sp. WH
           7803]
          Length = 283

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 121/269 (44%), Positives = 170/269 (63%), Gaps = 2/269 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +TF+N+  FVLI G   +ES   A   A     +C+ L+I LV+K+SFDKANRSS+  
Sbjct: 9   GSITFANDAPFVLIGGVNVLESQQFALDAAAVYADVCRRLSIPLVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL  G  + + +K  +G P++TDVHT +Q    A+  DI+Q+PA L RQTDL+ A 
Sbjct: 69  FRGPGLSDGLAMLQAVKDTHGIPVITDVHTPEQAAPAAEVCDIIQLPAFLARQTDLVQAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A TG VIN+KK QFLSP +M N+++K    G + +L CERG++FGY+ LV DM    +M 
Sbjct: 129 AGTGAVINIKKPQFLSPSQMANVVEKFRECGNEQLLICERGSNFGYDNLVVDMLGFGVMK 188

Query: 215 SMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
                 P+IFD +H++Q     G  SGG R  ++ LA+A +A+G+AG+FLE H DP  A 
Sbjct: 189 RCCDDLPLIFDVTHALQCRDPGGAASGGRRSQVLDLARAGMAVGLAGLFLEAHPDPSQAR 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
            DGP+ + +  L   LSQL A+D ++K L
Sbjct: 249 CDGPSALPLHQLEPFLSQLKAVDDLVKSL 277


>gi|85059851|ref|YP_455553.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sodalis glossinidius
           str. 'morsitans']
 gi|123766405|sp|Q2NRS7|KDSA_SODGM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|84780371|dbj|BAE75148.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sodalis glossinidius
           str. 'morsitans']
          Length = 284

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 121/268 (45%), Positives = 171/268 (63%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N+  FVL  G   +ES D A  I E    + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GDIQAANDLPFVLFGGMNVLESRDLAMRICEHYVTVTEKLGIPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL +G +IF +LK ++G  ++TDVH   Q +++AD VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLDEGMKIFSELKAQFGVKVITDVHEAGQAQSVADVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QF+SP ++ NI+ K    G   V+ C+RG++FGY+ LV DM    +M 
Sbjct: 129 ARTGAVINVKKPQFISPGQVGNIVDKFREAGNHQVILCDRGSNFGYDNLVVDMLGFNVMK 188

Query: 215 SM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
            +  G PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+F+E H DP NA 
Sbjct: 189 QVSGGCPVIFDVTHALQTRDPFGAASGGRRAQVSELARAGMAVGIAGLFIEAHPDPANAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + I  L   L Q+ AID+++K 
Sbjct: 249 CDGPSALPIAKLEPFLRQMKAIDELVKS 276


>gi|262372545|ref|ZP_06065824.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter junii SH205]
 gi|262312570|gb|EEY93655.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter junii SH205]
          Length = 285

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 125/266 (46%), Positives = 168/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL  
Sbjct: 13  GDIQMANHLPFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLNS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG +   D+KK++  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 73  FRGPGLEKGIKWLADIKKQFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAM 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM 
Sbjct: 133 AKTQAIINIKKAQFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMK 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +HS+Q PG   + +GG R  I  LA+A +A G+AG+FLE H +P+ A  D
Sbjct: 193 EMNVPVFFDVTHSLQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEAHPEPELAKCD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+QL  +D ++K 
Sbjct: 253 GPCALRLSQLEPFLAQLKELDTLVKG 278


>gi|288927558|ref|ZP_06421405.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella sp. oral taxon 317
           str. F0108]
 gi|288330392|gb|EFC68976.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella sp. oral taxon 317
           str. F0108]
          Length = 261

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 122/254 (48%), Positives = 167/254 (65%)

Query: 39  FSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGV 98
                +   IAGPC IES +  + +AEKL  I Q L + +++K+SFDKANR+S++  RG 
Sbjct: 8   IGRSMKTTFIAGPCVIESQELLYTVAEKLVEINQKLEVDIIFKASFDKANRTSISSFRGP 67

Query: 99  GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTG 158
           GL++G E+  ++K KYG  +LTD+H   Q EA+   VD+LQIPA LCRQTDLL AAA+TG
Sbjct: 68  GLERGLEMLANVKSKYGLKLLTDIHESCQAEAVGQVVDVLQIPAFLCRQTDLLVAAAKTG 127

Query: 159 RVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGV 218
           +V+N+KK QFLS  +M   ++K    GA +V   ERG +FGYN LV D R+IP M  +  
Sbjct: 128 KVVNIKKAQFLSGPDMKYPVEKAKEAGAAEVWLTERGNTFGYNNLVVDFRNIPDMKEIVP 187

Query: 219 PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNM 278
            VI D +HSVQ+PG  G  +GG+R+++  +A AA A G  G F E H +PD   SDGPNM
Sbjct: 188 TVIMDCTHSVQRPGAMGGKTGGDRRFVPSMALAAKAFGATGYFFEVHPNPDKGLSDGPNM 247

Query: 279 INIKDLPKLLSQLL 292
           + +  L  L++ LL
Sbjct: 248 LELDKLENLIANLL 261


>gi|213419810|ref|ZP_03352876.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
          Length = 275

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 123/279 (44%), Positives = 177/279 (63%), Gaps = 6/279 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                +++G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVNIGD----IKVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K H  G   V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFHEGGNDKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSVMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRGQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           FLE+H DP NA  DGP+ + +  L + L+Q+ AID ++K
Sbjct: 237 FLESHPDPANAKCDGPSALPLAKLEQFLTQIKAIDDLVK 275


>gi|195953972|ref|YP_002122262.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hydrogenobaculum sp.
           Y04AAS1]
 gi|195933584|gb|ACG58284.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hydrogenobaculum sp.
           Y04AAS1]
          Length = 265

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 130/258 (50%), Positives = 177/258 (68%), Gaps = 3/258 (1%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGL 100
           E++F++IAGPC IES++  F +A  L            V+K+SFDKANR+S+   RG GL
Sbjct: 2   EKKFLIIAGPCVIESYELCFEVASHLKEFSLKYKEFDFVFKASFDKANRTSVNSYRGPGL 61

Query: 101 KKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRV 160
           +KG EI + +K+++  P+ TDVH   Q + +A+ VDI+QIPA LCRQTDLL AAA+TG+ 
Sbjct: 62  EKGLEILKRIKEEFSMPVTTDVHETYQVKPVAEVVDIIQIPAFLCRQTDLLLAAAETGKS 121

Query: 161 INVKKGQFLSPWEMHNILQKLHAHGAK-DVLFCERGTSFGYNTLVTDMRSIPIMTSMGVP 219
           +NVKKGQFL+PW+   I+ KL +          ERG+SFGYN LV DMRS+PIM      
Sbjct: 122 VNVKKGQFLAPWDTKYIIDKLKSKNKDATFYLTERGSSFGYNNLVVDMRSLPIMRQY-AK 180

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           VIFDA+HSVQ PG  G  S G+R+++  L +AAVA+G+ G+F+ETH +P+ A SDGPN I
Sbjct: 181 VIFDATHSVQLPGGAGGSSSGQREFVPYLIRAAVAVGVDGVFMETHPNPEKALSDGPNSI 240

Query: 280 NIKDLPKLLSQLLAIDKI 297
            +KDL  +L Q+ AI + 
Sbjct: 241 PLKDLEGILIQIKAIKQA 258


>gi|116251994|ref|YP_767832.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115256642|emb|CAK07730.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 281

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 184/277 (66%), Positives = 230/277 (83%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G+ QVTFSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYKSS
Sbjct: 5   TNSEVRIGEGQGQVTFSNAGRLSLIAGPCQMESRDHAFMVAGTLKELCGKLGIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+G++KG E+F DLKK++GFP+LTDVHT +QCE +A  VD+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGIEKGMEVFADLKKEFGFPVLTDVHTAEQCEEVAKVVDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM +MG PV+FDA+HSV QPG  G  SGG+R+++  LA+AAVA GIAG+F+E
Sbjct: 185 VSDMRSLPIMAAMGAPVVFDATHSVAQPGGQGESSGGQREFVETLARAAVAAGIAGVFVE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D + K 
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAVAKA 281


>gi|84501337|ref|ZP_00999542.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanicola batsensis
           HTCC2597]
 gi|84390628|gb|EAQ03116.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Oceanicola batsensis
           HTCC2597]
          Length = 273

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 151/276 (54%), Positives = 204/276 (73%), Gaps = 4/276 (1%)

Query: 26  AAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFD 85
             + +G        SN   ++LIAGPCQ+ES +H+ M+AEK+ A  ++     V+K+S+D
Sbjct: 2   KTVKIGD----FEVSNAHPYMLIAGPCQMESLEHSRMLAEKIAAAAEAAGRPWVFKASYD 57

Query: 86  KANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLC 145
           KANRSSL+GKRG+G++KG  I  D+ K++G P+LTDVH   QC   A+ VDILQIPA L 
Sbjct: 58  KANRSSLSGKRGLGMEKGLRILGDIAKEFGCPVLTDVHEPGQCAVAAEVVDILQIPAFLS 117

Query: 146 RQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVT 205
           RQTDLL AA +TG+ +NVKKGQFL+PW+M N++ K+ + G ++++ CERG SFGYN LV+
Sbjct: 118 RQTDLLLAAGETGKALNVKKGQFLAPWDMQNVVDKIASTGNENIMLCERGASFGYNMLVS 177

Query: 206 DMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
           D RS+PIM   G PV+FDA+HSVQ PG  G  +GG+R+++ PLA+AA+A+G A +F+ETH
Sbjct: 178 DFRSLPIMAQTGCPVVFDATHSVQLPGGLGGSTGGQREFVEPLARAAMAVGTAAVFIETH 237

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
            DPDNAPSDGPNM+ I DLP+LL  L AID + K L
Sbjct: 238 DDPDNAPSDGPNMVPIADLPRLLKGLAAIDDLTKGL 273


>gi|71280246|ref|YP_270221.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Colwellia
           psychrerythraea 34H]
 gi|123733712|sp|Q47Y99|KDSA_COLP3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|71145986|gb|AAZ26459.1| 3-deoxy-8-phosphooctulonate synthase [Colwellia psychrerythraea
           34H]
          Length = 280

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 118/265 (44%), Positives = 170/265 (64%), Gaps = 1/265 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +NEQ FVL  G   +ES D A  IAE    + Q L I  V+K+SFDKANRSS+   
Sbjct: 10  GIDVANEQPFVLFGGMNVLESRDLAMKIAEHYVEVTQKLGIPYVFKASFDKANRSSVNSY 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL +G +IF ++K  +  PI+TDVH   Q + +++ VD++Q+PA L RQTDL+ A A
Sbjct: 70  RGPGLDEGLKIFEEIKSTFNVPIITDVHESYQAQPVSEVVDVIQLPAFLARQTDLVVAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG VINVKK QFL+  EM +I+ K    G ++++ CERG+ +GYN LV DM ++  M +
Sbjct: 130 KTGAVINVKKPQFLAAHEMKHIITKFGEAGNENIILCERGSCYGYNNLVVDMLAMDEMKN 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
               VIFDA+H++Q+PG   + + G R     LA++ +AIGIAG+F+E H DP  A  DG
Sbjct: 190 YAP-VIFDATHALQKPGGRSDSADGRRAQAAQLARSGMAIGIAGLFIEAHPDPSAAKCDG 248

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           P  + +  L   L+Q+ A+D ++K 
Sbjct: 249 PCALPLDKLEPYLAQMKALDDLVKG 273


>gi|326800756|ref|YP_004318575.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingobacterium sp. 21]
 gi|326551520|gb|ADZ79905.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sphingobacterium sp. 21]
          Length = 271

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 116/264 (43%), Positives = 165/264 (62%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  ++   F L+AGPC IE  D A  IA+K+  I   L I  ++K S+ KANRS     
Sbjct: 8   GIKHTDSGNFFLMAGPCAIEGEDMALSIADKIVGITDKLKIPYIFKGSYRKANRSKSDSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
            G+G +K  +I + ++  +G P++TD+H   +    A+ VD+LQIPA LCRQT+LL AA 
Sbjct: 68  TGIGDEKALKILKKVRDTFGVPVVTDIHETHEAAMAAEYVDVLQIPAFLCRQTELLVAAG 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+V+N+KKGQFLS   M   + K+   G + V+  +RG +FGY  L+ D R IP M S
Sbjct: 128 KTGKVVNIKKGQFLSADSMRFAVDKVIETGNQQVILTDRGNTFGYQDLIVDFRGIPTMRS 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
             VPV+ D +HS+QQP      +GG+ + I  +AKAAVA+G  G+F+ETH DP NA SDG
Sbjct: 188 FNVPVVMDCTHSLQQPNQASGVTGGQPELIGTIAKAAVAVGADGLFIETHPDPANAKSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIK 299
            NM+++  L  LL QL  I + I+
Sbjct: 248 ANMLHLNYLEDLLIQLTRIREAIR 271


>gi|320108462|ref|YP_004184052.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Terriglobus saanensis
           SP1PR4]
 gi|319926983|gb|ADV84058.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Terriglobus saanensis
           SP1PR4]
          Length = 275

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 127/273 (46%), Positives = 172/273 (63%), Gaps = 6/273 (2%)

Query: 30  LGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR 89
           +      +         LIAGPC IES +HA  +A  +  I   L +  ++K+S+DKANR
Sbjct: 3   VPFRVGDIEVGGGD-LFLIAGPCVIESEEHAQKMAAAIAEITSELKVPYLFKASYDKANR 61

Query: 90  SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQC----EAIADSVDILQIPALLC 145
           +S+   RG GL +G  I R + K+ G P+LTDVH+ + C    EA+ D   +LQIPA LC
Sbjct: 62  TSIKSFRGPGLIEGARILRAVAKETGLPVLTDVHSAEDCVRLHEALGDVEAMLQIPAFLC 121

Query: 146 RQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVT 205
           RQTDLL AAAQTGR +NVKKGQF++P +M + ++K+   G + V   ERG SFGYN LV 
Sbjct: 122 RQTDLLIAAAQTGRAVNVKKGQFVAPNDMKHAVEKVRESGNERVCLTERGASFGYNNLVV 181

Query: 206 DMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
           DMRS+PIM      VIFD +HSVQ P   G  SGG+ ++I  LA+AAVA G+ G+FLE H
Sbjct: 182 DMRSLPIMRGFAP-VIFDGTHSVQTPSSTGGVSGGQPEFIPVLARAAVAAGVDGLFLEVH 240

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKII 298
            +P  A SDG N ++++ L  +L QLL +   +
Sbjct: 241 DNPACAKSDGANALHLEKLKGVLEQLLRVHAAV 273


>gi|262279284|ref|ZP_06057069.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter calcoaceticus
           RUH2202]
 gi|299769905|ref|YP_003731931.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp. DR1]
 gi|262259635|gb|EEY78368.1| 3-deoxy-8-phosphooctulonate synthase [Acinetobacter calcoaceticus
           RUH2202]
 gi|298699993|gb|ADI90558.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter sp. DR1]
          Length = 285

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 127/266 (47%), Positives = 170/266 (63%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL  
Sbjct: 13  GDIQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICKRLDIPYVFKASFDKANRSSLHS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG E   D+KK +  PI+TDVH   Q EA+A+  DI+Q+PA L RQTDL+ A 
Sbjct: 73  FRGPGLEKGIEWLGDIKKHFNVPIITDVHEPHQAEAVAEVADIIQLPAFLSRQTDLVEAM 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM    IM 
Sbjct: 133 AKTQAIINIKKAQFLAPHEMRHILNKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMK 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP++A  D
Sbjct: 193 EMNVPVFFDVTHALQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEGHPDPEHAKCD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+Q+  +D ++K 
Sbjct: 253 GPCALRMSQLEPFLAQIKELDTLVKG 278


>gi|238783273|ref|ZP_04627298.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia bercovieri ATCC
           43970]
 gi|238715866|gb|EEQ07853.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Yersinia bercovieri ATCC
           43970]
          Length = 284

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G  IF+DLK+++G  I+TDVH   Q + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMRIFQDLKQQFGVKIITDVHEASQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI++K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFVSPGQMGNIVEKFKEAGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMVQATGGHPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLAKLEPFLVQMKAIDDLVKS 276


>gi|293607916|ref|ZP_06690219.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828489|gb|EFF86851.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325122441|gb|ADY81964.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 285

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 124/266 (46%), Positives = 167/266 (62%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N   FVL  G   +ES D AF IAE    IC+ L+I  V+K+SFDKANRSSL  
Sbjct: 13  GDIQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICKRLDIPYVFKASFDKANRSSLHS 72

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL+KG E   D+KK +  PI+TDVH   Q   +A+  DI+Q+PA L RQTDL+ A 
Sbjct: 73  FRGPGLEKGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAM 132

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KK QFL+P EM +IL K    G   ++ CERG++FGYN LV DM     M 
Sbjct: 133 AKTQAIINIKKAQFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDTMK 192

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            M VPV FD +H++Q PG   + +GG R  I  LA+A +A G+AG+FLE H DP++A  D
Sbjct: 193 EMNVPVFFDVTHALQTPGGRSDSAGGRRAQITTLARAGMATGLAGLFLEGHPDPEHAKCD 252

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+Q+  +D ++K 
Sbjct: 253 GPCALRMSQLEPFLAQIKELDTLVKG 278


>gi|225873929|ref|YP_002755388.1| 3-deoxy-8-phosphooctulonate synthase [Acidobacterium capsulatum
           ATCC 51196]
 gi|225791459|gb|ACO31549.1| 3-deoxy-8-phosphooctulonate synthase [Acidobacterium capsulatum
           ATCC 51196]
          Length = 294

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 128/280 (45%), Positives = 172/280 (61%), Gaps = 6/280 (2%)

Query: 19  NHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGL 78
           + +   N    +G     V   + Q   LIAGPC IES  HA  +A+ +  I   L +  
Sbjct: 19  DSIQAVNQPFSIGP----VPVGSGQ-LFLIAGPCVIESEAHARKMADAIQRITADLGVPY 73

Query: 79  VYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDIL 138
           ++K+S+DKANR+S+   RG GL +G  I + +++++G P+LTDVH    C   A+ VD+L
Sbjct: 74  IFKASYDKANRTSVTSFRGPGLVEGTRILKTIQQQHGLPVLTDVHEPGHCAVAAEGVDVL 133

Query: 139 QIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSF 198
           QIPA LCRQTDLL AAA TGR +NVKKGQF++PW+M + + KL + G       ERG SF
Sbjct: 134 QIPAFLCRQTDLLVAAANTGRAVNVKKGQFVAPWDMQHAVGKLESTGNPRFFLTERGASF 193

Query: 199 GYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIA 258
           GYN LV DMRS+ IM  M   V+FD +HSVQ P      SGG+ ++I  L +AAVA G+ 
Sbjct: 194 GYNNLVVDMRSLGIMRKMAP-VVFDGTHSVQIPSGSNGVSGGQPEFIPLLTRAAVAAGVD 252

Query: 259 GIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKII 298
           G+FLE H +P  A SDG N +++  L  LL  LLAI    
Sbjct: 253 GLFLEVHDNPAEAKSDGANALHLDRLRPLLENLLAIHAAA 292


>gi|291279429|ref|YP_003496264.1| 3-deoxy-8-phosphooctulonate synthase [Deferribacter desulfuricans
           SSM1]
 gi|290754131|dbj|BAI80508.1| 3-deoxy-8-phosphooctulonate synthase [Deferribacter desulfuricans
           SSM1]
          Length = 256

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 127/253 (50%), Positives = 174/253 (68%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
            ++IAGPC  E+ + AF   E L  +C+      VYK+S+DKANRSS+   RG G++KG 
Sbjct: 1   MLIIAGPCVYENDNIAFKTCEFLKKLCEKYGFEYVYKTSYDKANRSSVHSYRGPGIEKGV 60

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           E F  LK+K+G  ILTD H+E++ + I D VDILQ+PA LCRQTD+L AAA++G+++NVK
Sbjct: 61  EFFIKLKEKFGVKILTDFHSEKEADIIKDYVDILQVPAFLCRQTDILKAAAKSGKIVNVK 120

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDA 224
           KGQF++PW+M N+++KL   GAK+++  ERG SFGYN LV D RS PIM      +IFD 
Sbjct: 121 KGQFMAPWDMKNVVEKLTYFGAKEIMITERGYSFGYNNLVVDYRSFPIMKEFCDNIIFDV 180

Query: 225 SHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDL 284
           +HSVQ PG  G  S GER++   LA+AAVA G+ G+F+E H DPD+A  DG NM++ +  
Sbjct: 181 THSVQLPGGKGFASSGERRFAPYLARAAVACGVDGLFMEIHPDPDSALCDGANMLDFQMT 240

Query: 285 PKLLSQLLAIDKI 297
            KL  ++  I   
Sbjct: 241 EKLFDEIKRIWDT 253


>gi|325294610|ref|YP_004281124.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065058|gb|ADY73065.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 259

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 126/257 (49%), Positives = 182/257 (70%), Gaps = 1/257 (0%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIG-LVYKSSFDKANRSSLAGKRGVGLKKG 103
            ++IAGPC IE  D  F +A+K+  +         ++K+SFDKANRSS+   RG G++KG
Sbjct: 1   MLIIAGPCVIEDRDTVFEVAKKIRELKDKYPKHMWIFKASFDKANRSSIDSYRGPGIEKG 60

Query: 104 REIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV 163
            E+  ++K+K+  PI TD+H   Q E +   VDI+QIPA LCRQTDL+ AAA+T +++NV
Sbjct: 61  LELLSEVKEKFELPITTDIHEPWQAEIVGKVVDIVQIPAFLCRQTDLIVAAAKTEKIVNV 120

Query: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFD 223
           KKGQF++PW+M N+++KL   GA ++L  ERGT+FGYN LV D RSIPIM   GV V+FD
Sbjct: 121 KKGQFMAPWDMANVVEKLRKSGASEILLTERGTTFGYNNLVVDFRSIPIMKKFGVKVLFD 180

Query: 224 ASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKD 283
           A+HSVQ+PG  G  SGG+R+++  L++AA+AIG+ G+F E H +P+ A SDG NM+N++D
Sbjct: 181 ATHSVQRPGGLGKVSGGDREFVPYLSRAAIAIGVDGLFFEIHPEPERALSDGANMLNLED 240

Query: 284 LPKLLSQLLAIDKIIKP 300
              L+ +L+ +   +K 
Sbjct: 241 FEVLIGKLIKLYSFMKE 257


>gi|85859053|ref|YP_461255.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Syntrophus
           aciditrophicus SB]
 gi|85722144|gb|ABC77087.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Syntrophus
           aciditrophicus SB]
          Length = 292

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 125/257 (48%), Positives = 178/257 (69%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKK 102
              VLIAGPC IE  +    IA  L  +   ++I  ++K+S+DKANR+S    RG GL++
Sbjct: 29  SPLVLIAGPCVIEDEERTRDIALYLKKLTDEMDIPFIFKASYDKANRTSGKAYRGPGLER 88

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G EI + +K   G PIL+DVH+ ++ E  A+ +D++QIPA LCRQTDL+   A+  R +N
Sbjct: 89  GIEILKAIKGDLGIPILSDVHSREEIEKAAEILDVVQIPAFLCRQTDLVREVARLARAVN 148

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           +KKGQFL+PW++ NI++K+ + G + +L  ERGTSFGYN LV D RS+P++   G PVIF
Sbjct: 149 IKKGQFLAPWDVRNIIEKVLSEGNERILVTERGTSFGYNNLVVDFRSLPLLRREGYPVIF 208

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGG+R+ +  L +AA A+GI G+FLE H DP+ A  DGPN + + 
Sbjct: 209 DATHSVQLPGGQGTASGGQREMVPCLMRAAAAVGIDGLFLEVHPDPEKALCDGPNSLYLD 268

Query: 283 DLPKLLSQLLAIDKIIK 299
            LP+LLS + +ID+++K
Sbjct: 269 ALPELLSTVKSIDRLVK 285


>gi|242239293|ref|YP_002987474.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dickeya dadantii Ech703]
 gi|242131350|gb|ACS85652.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Dickeya dadantii Ech703]
          Length = 284

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
             N  +++G     +  +N   FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MNNKVVNVGD----IPVANHLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  ++TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKVITDVHEAYQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G ++V+ C+RGT+FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFISPGQMGNIVDKFREGGNENVILCDRGTNFGYDN 176

Query: 203 LVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    +M     G+PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFNVMKQASHGLPVIFDVTHALQCRDPFGAASGGRRAQVTELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L+Q+ AID+++K 
Sbjct: 237 FIEAHPEPNSARCDGPSALPLNKLEPFLAQMKAIDELVKS 276


>gi|325954978|ref|YP_004238638.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Weeksella virosa DSM
           16922]
 gi|323437596|gb|ADX68060.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Weeksella virosa DSM
           16922]
          Length = 275

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 116/263 (44%), Positives = 161/263 (61%), Gaps = 1/263 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
           ++   +   F LIAGPC IE    A  IAEK+  +   L+I  ++K SF KANRS +   
Sbjct: 13  KIKHKDSPNFFLIAGPCAIEDESMALRIAEKVVEVTDKLSIPYIFKGSFKKANRSRIDSF 72

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
            G+G +K  EI R + K +  P  TD+H     E  A  VD++QIPA L RQTDL+ AAA
Sbjct: 73  TGIGDEKALEIIRKVGKTFDIPTTTDIHEPWHAEMAAQYVDVIQIPAFLVRQTDLVVAAA 132

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+ + +KKGQFLSP  M   +QK+   G ++V   ERGT FGY  LV D R IP+M +
Sbjct: 133 KTGKHVTLKKGQFLSPESMLFPVQKVTDLGNQNVAIIERGTMFGYGDLVVDYRGIPVMRN 192

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
               VI D +HS+QQP      +GG+ + I  +AKA +A+G  G+F+ETH DP  A SDG
Sbjct: 193 YAP-VILDITHSLQQPNQASGVTGGKPELIETIAKAGIAVGADGLFIETHPDPKCAKSDG 251

Query: 276 PNMINIKDLPKLLSQLLAIDKII 298
            NM+ +  L +LL++L+ I ++I
Sbjct: 252 ANMLQLDKLEELLTRLVKIRQVI 274


>gi|315127036|ref|YP_004069039.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas sp.
           SM9913]
 gi|315015550|gb|ADT68888.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudoalteromonas sp.
           SM9913]
          Length = 284

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 120/266 (45%), Positives = 172/266 (64%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N++  +N + FVL  G   +ES D A  IAE    +   LNI  V+K+SFDKANRSS+  
Sbjct: 9   NEIELANNKPFVLFGGMNVLESRDLAMRIAEHYVEVTTKLNIPYVFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++K  +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKNTFNIPLITDVHEPHQAAPVAEVVDVIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  +V  CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNNNVALCERGSSFGYNNLVVDMLGMDDMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PVIFDA+H++Q+PG   + + G R     LA++ +A+GIAG+F+E H +P+ A  D
Sbjct: 189 -TMAPVIFDATHALQRPGGRADSADGRRAQAAELARSGMALGIAGLFIEAHPNPNEAKCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   LSQ+ A+D +IK 
Sbjct: 248 GPCALALSKLEGYLSQMKAVDDLIKS 273


>gi|84514359|ref|ZP_01001723.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Loktanella vestfoldensis
           SKA53]
 gi|84511410|gb|EAQ07863.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Loktanella vestfoldensis
           SKA53]
          Length = 277

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 144/266 (54%), Positives = 192/266 (72%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
            Q+   N+   +LIAGPCQ+ES DHA MIA ++  IC +     ++K SFDKANR+SL G
Sbjct: 7   GQLKVGNDLPLLLIAGPCQLESIDHAQMIAGRMAEICTAHGAQFIFKGSFDKANRTSLGG 66

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G+  G ++ + +K   G P+LTD+HT  QC  +AD  D+LQIPA LCRQTDLL AA
Sbjct: 67  KRGLGIDGGLKVMQSVKDSIGCPVLTDIHTADQCAPVADVCDVLQIPAFLCRQTDLLIAA 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +TG VINVKKGQFL+PW+M N++ K+ + G + +L  +RGTSFGYNTLV DMRS+P M 
Sbjct: 127 GETGAVINVKKGQFLAPWDMPNVVAKIESTGNRRILVTDRGTSFGYNTLVADMRSLPTMA 186

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
            MG PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++GIA +F+ETH+DPD APSD
Sbjct: 187 RMGYPVVMDATHSVQQPGGQGGSSGGQREFAPVMARAAVSLGIAAVFIETHEDPDTAPSD 246

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNMI +  +  L+  L+  D + K 
Sbjct: 247 GPNMIPLSQMDALVKSLMGFDALAKA 272


>gi|54309990|ref|YP_131010.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Photobacterium profundum
           SS9]
 gi|59798291|sp|Q6LNB8|KDSA_PHOPR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|46914429|emb|CAG21208.1| putative 2-dehydro-3-deoxyphosphooctonate aldolase [Photobacterium
           profundum SS9]
          Length = 284

 Score =  270 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 115/281 (40%), Positives = 170/281 (60%), Gaps = 6/281 (2%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +     + +G     +  +N++ FVL  G   +ES D A  I E    +   L I  V+K
Sbjct: 1   MMEQKTVRVGD----IDVANDKPFVLFGGMNVLESRDLAMKICEHYVEVTNKLGIPFVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS+   RG G+++G +IF++LK  +G  I+TD+H   Q + +AD VD++Q+P
Sbjct: 57  ASFDKANRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDIHEIYQAQPVADVVDVIQLP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+ A A+TG VINVKK Q++SP ++ NI++K      ++V+ CERG   GY+
Sbjct: 117 AFLARQTDLVEAMAKTGAVINVKKPQYMSPGQVGNIVEKFAECDNENVILCERGALHGYD 176

Query: 202 TLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
            LV DM    +M     G P+IFD +H++Q     G  SGG R+  V LA++ +A GIAG
Sbjct: 177 NLVVDMLGFDVMKKASKGSPIIFDVTHALQCRDPLGAASGGRREQTVDLARSGIATGIAG 236

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +F+E H  PD A  DGP+   +  L   L+Q+  +D +IK 
Sbjct: 237 LFMEAHPAPDQARCDGPSAFPLDKLEPFLNQIKQLDDLIKG 277


>gi|119472538|ref|ZP_01614586.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alteromonadales
           bacterium TW-7]
 gi|119444862|gb|EAW26162.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Alteromonadales
           bacterium TW-7]
          Length = 284

 Score =  270 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 118/266 (44%), Positives = 172/266 (64%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +  +N + FVL  G   +ES D A  IAE    +   LNI  V+K+SFDKANRSS+  
Sbjct: 9   NDIELANNKPFVLFGGMNVLESRDLAMRIAEHYVEVTTKLNIPYVFKASFDKANRSSINS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++K  +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKNTFNIPLITDVHEPHQAAPVAEVVDVIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG +INVKK QFL+P EM +I+ K +  G  ++  CERG+SFGYN LV DM  +  M 
Sbjct: 129 AKTGAIINVKKPQFLAPHEMRHIITKFNEAGNNNIALCERGSSFGYNNLVVDMLGMDDMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           +M   VIFDA+H++Q+PG   + + G R     LA++ +A+GIAG+F+E H +P+ A  D
Sbjct: 189 AMAP-VIFDATHALQRPGGRADSADGRRAQAAELARSGMALGIAGLFIEAHPNPNEAKCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   LSQ+ A+D ++K 
Sbjct: 248 GPCALALSKLEGYLSQMKAVDDLVKS 273


>gi|89073095|ref|ZP_01159634.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Photobacterium sp.
           SKA34]
 gi|89051048|gb|EAR56505.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Photobacterium sp.
           SKA34]
          Length = 284

 Score =  270 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 115/281 (40%), Positives = 171/281 (60%), Gaps = 6/281 (2%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +     + +G     +  +N++ FVL  G   +ES D A  + E    + + L I  V+K
Sbjct: 1   MMEQKTVRIGD----IDVANDKPFVLFGGMNVLESRDLAMQMCEHYVKVTEKLGIPFVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS+   RG G+++G +IF++LK  +G  I+TD+H + Q + +AD VD++Q+P
Sbjct: 57  ASFDKANRSSVHSYRGPGMEEGLKIFQELKDTFGVKIITDIHEKDQAQPVADVVDVIQLP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K       +V+ CERG   GY+
Sbjct: 117 AFLARQTDLVEAMAKTGAVINVKKPQFMSPGQVGNIVEKFAECDNHNVILCERGVLHGYD 176

Query: 202 TLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
            LV DM    +M     G P+IFD +H++Q     G  SGG R+  V LA++ +A GIAG
Sbjct: 177 NLVVDMLGFDVMKKASQGSPIIFDVTHALQCRDPQGAASGGRREQTVDLARSGIATGIAG 236

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +F+E H  PD A  DGP+   +  L   L+Q+  +D +IK 
Sbjct: 237 LFMEAHPTPDLARCDGPSAFPLDKLEPFLAQIKQLDDLIKS 277


>gi|241204521|ref|YP_002975617.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240858411|gb|ACS56078.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 281

 Score =  270 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 182/277 (65%), Positives = 230/277 (83%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           TN+ + +G G+ QV+FSN  R  LIAGPCQ+ES DHAFM+A  L  +C  L IGLVYKSS
Sbjct: 5   TNSEVRIGEGQGQVSFSNTGRLSLIAGPCQMESRDHAFMVAGTLKELCGKLGIGLVYKSS 64

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANR+SL+ +RG+G++KG E+F DLKK++GFP+LTDVHT +QC  +A  VD+LQIPA 
Sbjct: 65  FDKANRTSLSAERGIGIEKGMEVFADLKKEFGFPVLTDVHTAEQCAEVAKVVDVLQIPAF 124

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L+KL+A G  +VL CERG SFGYNTL
Sbjct: 125 LCRQTDLLIAAAKTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERGASFGYNTL 184

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V+DMRS+PIM +MG PV+FDA+HSV QPG  G+ SGG+R+++  LA+AAVA GIAG+F+E
Sbjct: 185 VSDMRSLPIMAAMGAPVVFDATHSVAQPGGQGDSSGGQREFVETLARAAVAAGIAGVFVE 244

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           THQDPDNAPSDGPNM+ +KD+P+LL +LLA D + K 
Sbjct: 245 THQDPDNAPSDGPNMVYLKDMPRLLEKLLAFDAVAKA 281


>gi|313207369|ref|YP_004046546.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Riemerella anatipestifer
           DSM 15868]
 gi|312446685|gb|ADQ83040.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Riemerella anatipestifer
           DSM 15868]
 gi|315023264|gb|EFT36274.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Riemerella anatipestifer
           RA-YM]
 gi|325335173|gb|ADZ11447.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Riemerella anatipestifer RA-GD]
          Length = 269

 Score =  270 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 115/264 (43%), Positives = 156/264 (59%), Gaps = 1/264 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           + ++  N   F L+AGPC IE+ D A  IAE +  +     I  ++K SF KANRS +  
Sbjct: 6   DNISHKNSSNFFLVAGPCAIENGDMAMKIAEHIVKLSDKYKIPYIFKGSFKKANRSRIDS 65

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
             G+G +K  +I + +   +G P  TD+H  +     A  VD+LQIPA L RQTDLL +A
Sbjct: 66  FTGIGDEKALKILKKVGDTFGIPTTTDIHENEHATLAAQYVDVLQIPAFLVRQTDLLVSA 125

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG+ I +KKGQFLSP  M   +QK+       V   ERG SFGY  LV D R IP M 
Sbjct: 126 AKTGKCITLKKGQFLSPEAMKFAVQKIKDCDNDKVAIIERGNSFGYTDLVVDFRGIPTMQ 185

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           +    VI D +HS+QQP      +GG+ Q I  +AKA +A+G  G+F+ETH DP NA SD
Sbjct: 186 NYAP-VILDVTHSLQQPNQESGVTGGKPQLIETIAKAGIAVGADGLFIETHPDPKNAKSD 244

Query: 275 GPNMINIKDLPKLLSQLLAIDKII 298
           G NM+ ++ L  LL++L  I + I
Sbjct: 245 GANMLPLEQLDSLLAKLTKIREAI 268


>gi|260428720|ref|ZP_05782698.1| 3-deoxy-8-phosphooctulonate synthase [Citreicella sp. SE45]
 gi|260420314|gb|EEX13566.1| 3-deoxy-8-phosphooctulonate synthase [Citreicella sp. SE45]
          Length = 278

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 150/264 (56%), Positives = 202/264 (76%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           VTF+N+    LIAGPCQ+ES +HA M+A ++ A  ++  +  V+K SFDKANRSSL+GKR
Sbjct: 15  VTFANDAPLALIAGPCQLESLEHARMLAGRIAAAAEAARMPWVFKGSFDKANRSSLSGKR 74

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G++ G  I   +  ++G P+LTD+H  +QC  +A +VDILQIPA L RQTDLL AA +
Sbjct: 75  GLGMEAGLSILSKIGAEFGVPVLTDIHGPEQCATVAQAVDILQIPAFLSRQTDLLLAAGE 134

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           TG  INVKKGQFL+PW+M N+  K+ + G + ++ CERG SFGYN LV+DMRS+PIM   
Sbjct: 135 TGAAINVKKGQFLAPWDMANVAAKIASTGNQRLMLCERGASFGYNMLVSDMRSLPIMAET 194

Query: 217 GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGP 276
           G PV+FDA+HSVQ PG  G+ SGG+RQ++  LA+AAVA+G AG+F+ETH+DPDNAPSDGP
Sbjct: 195 GYPVVFDATHSVQLPGGQGSSSGGQRQFVGTLARAAVAVGCAGVFIETHEDPDNAPSDGP 254

Query: 277 NMINIKDLPKLLSQLLAIDKIIKP 300
           NM+ I  L  LL++L A+D+++KP
Sbjct: 255 NMVPIDGLAPLLARLHALDEVVKP 278


>gi|15605681|ref|NP_213056.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Aquifex aeolicus VF5]
 gi|6647545|sp|O66496|KDSA_AQUAE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|14278397|pdb|1FWN|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep
 gi|14278398|pdb|1FWN|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep
 gi|14278399|pdb|1FWS|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep And
           Cadmium
 gi|14278400|pdb|1FWS|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep And
           Cadmium
 gi|14278401|pdb|1FWT|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep, E4p
           And Cadmium
 gi|14278402|pdb|1FWT|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep, E4p
           And Cadmium
 gi|14278403|pdb|1FWW|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep, A5p
           And Cadmium
 gi|14278404|pdb|1FWW|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep, A5p
           And Cadmium
 gi|14278405|pdb|1FX6|A Chain A, Aquifex Aeolicus Kdo8p Synthase
 gi|14278406|pdb|1FX6|B Chain B, Aquifex Aeolicus Kdo8p Synthase
 gi|14278407|pdb|1FXP|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Cadmium
 gi|14278408|pdb|1FXP|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Cadmium
 gi|14278409|pdb|1FXQ|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep And
           A5p
 gi|14278410|pdb|1FXQ|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep And
           A5p
 gi|14278411|pdb|1FY6|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Cadmium
           And A5p
 gi|14278412|pdb|1FY6|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Cadmium
           And A5p
 gi|18655839|pdb|1JCX|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Api And
           Cadmium
 gi|18655840|pdb|1JCX|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With Api And
           Cadmium
 gi|18655841|pdb|1JCY|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With R5p, Pep
           And Cadmium
 gi|18655842|pdb|1JCY|B Chain B, Aquifex Aeolicus Kdo8p Synthase In Complex With R5p, Pep
           And Cadmium
 gi|42543281|pdb|1PE1|A Chain A, Aquifex Aeolicus Kdo8ps In Complex With Cadmium And 2-Pga
 gi|42543282|pdb|1PE1|B Chain B, Aquifex Aeolicus Kdo8ps In Complex With Cadmium And 2-Pga
 gi|46015195|pdb|1PCK|A Chain A, Aquifex Aeolicus Kdo8ps In Complex With Z-Methyl-Pep
 gi|46015196|pdb|1PCK|B Chain B, Aquifex Aeolicus Kdo8ps In Complex With Z-Methyl-Pep
 gi|46015199|pdb|1PCW|A Chain A, Aquifex Aeolicus Kdo8ps In Complex With Cadmium And App, A
           Bisubstrate Inhibitor
 gi|46015200|pdb|1PCW|B Chain B, Aquifex Aeolicus Kdo8ps In Complex With Cadmium And App, A
           Bisubstrate Inhibitor
 gi|110590753|pdb|2A21|A Chain A, Aquifex Aeolicus Kdo8ps In Complex With Pep, Po4, And Zn2+
 gi|110590754|pdb|2A21|B Chain B, Aquifex Aeolicus Kdo8ps In Complex With Pep, Po4, And Zn2+
 gi|110590757|pdb|2A2I|A Chain A, Aquifex Aeolicus Kdo8ps In Complex With Pep, A5p, Zn2+
 gi|110590758|pdb|2A2I|B Chain B, Aquifex Aeolicus Kdo8ps In Complex With Pep, A5p, Zn2+
 gi|237640503|pdb|3E0I|A Chain A, Cu2+ Substituted Aquifex Aeolicus Kdo8ps In Complex With
           Pep
 gi|237640504|pdb|3E0I|B Chain B, Cu2+ Substituted Aquifex Aeolicus Kdo8ps In Complex With
           Pep
 gi|237640505|pdb|3E12|A Chain A, Cu2+ Substituted Aquifex Aeolicus Kdo8ps In Complex With
           Kdo8p
 gi|237640506|pdb|3E12|B Chain B, Cu2+ Substituted Aquifex Aeolicus Kdo8ps In Complex With
           Kdo8p
 gi|2982835|gb|AAC06457.1| 3-deoxy-d-manno-octulosonic acid 8-phosphate synthase [Aquifex
           aeolicus VF5]
          Length = 267

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 124/257 (48%), Positives = 176/257 (68%), Gaps = 2/257 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGPC IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 2   EKFLVIAGPCAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LCRQTDLL AAA+TGR +
Sbjct: 62  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 122 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQW-AKVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD    + +
Sbjct: 181 YDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDASTQLPL 240

Query: 282 KDLPKLLSQLLAIDKII 298
             L  ++  +L I ++ 
Sbjct: 241 SQLEGIIEAILEIREVA 257


>gi|114770366|ref|ZP_01447904.1| 2-dehydro-3-deoxyphosphooctonate aldolase [alpha proteobacterium
           HTCC2255]
 gi|114549203|gb|EAU52086.1| 2-dehydro-3-deoxyphosphooctonate aldolase [alpha proteobacterium
           HTCC2255]
          Length = 278

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 141/266 (53%), Positives = 193/266 (72%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N    SN+    +I+GPCQ+ES DH+  IAE L   C   +   ++K SFDKANR+S+ G
Sbjct: 8   NNFEISNDSPLTIISGPCQLESIDHSLNIAETLMKACSKFDANFIFKGSFDKANRTSMNG 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
           KRG+G+++G  + +++K   G P +TDVHT +QC  +A  VD+LQIPA LCRQTDLL AA
Sbjct: 68  KRGLGIEEGLRVMQEVKSNLGCPTITDVHTAEQCSQVAKIVDVLQIPAFLCRQTDLLLAA 127

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+T  +IN+KKGQFL+PW+MHN+L+K+   G   ++ CERGTSFGYNTLV DMR +P M 
Sbjct: 128 AKTNAIINIKKGQFLAPWDMHNVLEKVSTSGNNKIMACERGTSFGYNTLVADMRGLPEMA 187

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
             G+PVI DA+HSVQQPG +G  SGG+R++   +A+ AV++GIAG+F+E H+DP+NAPSD
Sbjct: 188 RNGIPVIMDATHSVQQPGGNGGSSGGQREFAPVMARCAVSLGIAGVFIECHEDPNNAPSD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GPNMI +  +P L+  L+  D + K 
Sbjct: 248 GPNMIELNRMPDLIKSLMEFDILAKK 273


>gi|38145967|emb|CAE11287.1| KDO 8-phosphate synthase [Neisseria meningitidis]
          Length = 283

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 120/274 (43%), Positives = 169/274 (61%), Gaps = 2/274 (0%)

Query: 29  HLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKAN 88
           ++      +  SN   F L  G   +E  D      EK   + + L I  V+K+SFDKAN
Sbjct: 3   NINLPTFNIKISNSLPFTLFGGINVLEDLDSTLFACEKYVEVTEKLKIPYVFKASFDKAN 62

Query: 89  RSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQT 148
           RSS+   RGVGL++G  IF  +K ++G P++TDVH   QC A+A+ VDILQ+PA L RQT
Sbjct: 63  RSSIHSYRGVGLEEGMNIFSAVKDRFGVPVITDVHEPYQCNAVAEVVDILQLPAFLARQT 122

Query: 149 DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMR 208
           DL+ A AQTGRVIN+KK QFLSP +M NI++K    G   ++ CERG +FGY+ LV DM 
Sbjct: 123 DLVFAMAQTGRVINIKKPQFLSPEQMKNIVEKFKEAGNDQLILCERGANFGYDNLVVDML 182

Query: 209 SIPIMTSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQ 266
              +M       PVIFD +H++Q+     + SGG R+ ++ LA A +A G+AG+FLE H 
Sbjct: 183 GFGVMKKTCDDLPVIFDVTHALQKRDSGSSASGGRREQVLDLAMAGMATGLAGLFLEAHP 242

Query: 267 DPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +PD A  DGP+ + +  L   L ++ A+D+ +K 
Sbjct: 243 NPDKARCDGPSALPLDKLEDFLLRVKAVDETVKS 276


>gi|281356231|ref|ZP_06242724.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Victivallis vadensis
           ATCC BAA-548]
 gi|281317600|gb|EFB01621.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Victivallis vadensis
           ATCC BAA-548]
          Length = 277

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 120/270 (44%), Positives = 181/270 (67%), Gaps = 4/270 (1%)

Query: 33  GKNQVTFS----NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKAN 88
             N +        + R  LIAGPC  E+ +     AE L  +   LN+  ++K+S+DKAN
Sbjct: 5   PVNPIQCGPLTIGDGRLTLIAGPCMAETLEVCLETAEFLKNLTAELNVQYIFKASYDKAN 64

Query: 89  RSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQT 148
           R+S   KRG G+++G E+  ++K+++  P++TDVH  ++   +A+  D+LQIPA LCRQT
Sbjct: 65  RTSNDSKRGPGMERGLEMLAEVKRRFDVPVITDVHEHEEVPRVAEVADVLQIPAFLCRQT 124

Query: 149 DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMR 208
           DLL AA ++GR +N+KKGQF++P +M   ++K+ + G   V+  ERGT+FGY+ LV DMR
Sbjct: 125 DLLHAAGESGRAVNIKKGQFMAPEDMLGAVEKVRSTGNDRVMLTERGTTFGYHNLVVDMR 184

Query: 209 SIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP 268
           S+  M S GVPV+FDA+HSVQ PG  GN SGG R+++ PLA+AA A+GI  +F E H  P
Sbjct: 185 SLMTMRSFGVPVVFDATHSVQLPGGLGNASGGRREFVYPLARAAAAVGIDVLFTEVHPRP 244

Query: 269 DNAPSDGPNMINIKDLPKLLSQLLAIDKII 298
           D A SDGPN ++ + + ++L+++ AI  ++
Sbjct: 245 DEAWSDGPNSLDFRQIREILTKVKAIHDLV 274


>gi|332530631|ref|ZP_08406564.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hylemonella gracilis
           ATCC 19624]
 gi|332039914|gb|EGI76307.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Hylemonella gracilis
           ATCC 19624]
          Length = 281

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 122/267 (45%), Positives = 174/267 (65%), Gaps = 2/267 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            ++  N Q FVL  G   +ES D A    E+   +   L I  V+K+SFDKANRSS+   
Sbjct: 8   NLSVGNAQPFVLFGGINVLESRDLALRACEEYVRVTGKLGIPYVFKASFDKANRSSIHSY 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL +G  IF D+KK +G P++TDVH   Q +A+A+ VD+LQ+PA L RQTDL+ A A
Sbjct: 68  RGPGLDEGLRIFEDVKKSFGVPLITDVHEPHQAQAVAEVVDVLQLPAFLARQTDLVVALA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TGRVIN+KK QFLSP ++ NI++K    G   ++ C+RGT FGY+ LV DM    +M  
Sbjct: 128 KTGRVINIKKPQFLSPSQVGNIVEKFKEAGNDQLILCDRGTCFGYDNLVVDMLGFGVMKQ 187

Query: 216 M--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
           +   +PVIFDA+H++QQ       SGG R+ +V LA+A +++G+AG+FLE H +PD A  
Sbjct: 188 VSGNLPVIFDATHALQQRAPGAAASGGRREQLVDLARAGMSVGLAGLFLEAHPNPDKALC 247

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGP+ + +  L   L+Q+ A+D ++K 
Sbjct: 248 DGPSALPLDKLEPFLAQIKALDDLVKS 274


>gi|167563930|ref|ZP_02356846.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           oklahomensis EO147]
 gi|167571064|ref|ZP_02363938.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           oklahomensis C6786]
          Length = 281

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 120/270 (44%), Positives = 173/270 (64%), Gaps = 2/270 (0%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
              VT  N+  FVL  G   +ES D    +  +  ++ + L I  V+K+SFDKANRSS+ 
Sbjct: 6   SPGVTAGNDLPFVLFGGINVLESLDFTLDVCSEYVSVTRKLGIPFVFKASFDKANRSSIH 65

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RGVGL +G +IF  +K+++G P++TDVH  +Q   +A+  D+LQ+PA L RQTDL+ A
Sbjct: 66  SYRGVGLDEGLKIFAAVKERFGVPVITDVHEIEQAAPVAEVADVLQVPAFLARQTDLVVA 125

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            A+TG+ +NVKK QF+SP ++ +++ K    G   V+ CERG+SFGY+ LV DM     M
Sbjct: 126 IAKTGKPVNVKKPQFMSPTQLKHVVTKCREVGNDQVILCERGSSFGYDNLVVDMLGFRQM 185

Query: 214 TSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
                G PVIFD +HS+Q     G+ S G R+ ++ LA+A VA+GIAG+FLE H DPD+A
Sbjct: 186 AETTGGCPVIFDVTHSLQCRDPLGDASSGRRRQVLDLARAGVAVGIAGLFLEAHPDPDHA 245

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
             DGP+ + +  L   LSQ+ AID ++K +
Sbjct: 246 RCDGPSALPLHLLEGFLSQMKAIDDLVKRM 275


>gi|189218966|ref|YP_001939607.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Methylacidiphilum
           infernorum V4]
 gi|189185824|gb|ACD83009.1| 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
           [Methylacidiphilum infernorum V4]
          Length = 261

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 122/257 (47%), Positives = 163/257 (63%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++ F LIAGPC IES +    IA +L  I     I   +KSSFDKANRSS+   RG GLK
Sbjct: 4   KKPFFLIAGPCVIESLELVIDIALELKKITSKHQIPFYFKSSFDKANRSSIDSFRGPGLK 63

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
           +G  I   +K+K G  + TDVH+  Q + +A  VD++QIPA LCRQTDL+ A  ++G+ +
Sbjct: 64  EGLRILTKIKEKTGCALTTDVHSADQVKPVAQVVDLVQIPAFLCRQTDLILACGESGKAV 123

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+P ++  I +KL   G     F ERG+ FGY+ L+ DMR+I +M S    VI
Sbjct: 124 NVKKGQFLAPEDVDLIAEKLKRVGCHHYFFTERGSCFGYHDLIVDMRAIYLMRSRQHKVI 183

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ+P   G  +GG+     PLA+AAVA+GI G+F ETH  P+NA SD   MI +
Sbjct: 184 FDATHSVQRPSALGRVTGGDSSLAFPLARAAVAVGIDGLFFETHPCPENALSDSSTMIPL 243

Query: 282 KDLPKLLSQLLAIDKII 298
             +  +L  LL I +  
Sbjct: 244 DKVDPMLECLLKIHEAT 260


>gi|221135297|ref|ZP_03561600.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Glaciecola sp. HTCC2999]
          Length = 282

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 117/266 (43%), Positives = 173/266 (65%), Gaps = 1/266 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N+  FVL  G   +ES D A  IAE+   + + L IG V+K+SFDKANRSS++ 
Sbjct: 9   GDLNVANDAPFVLFGGMNVLESRDLAMRIAEEYQRVTEKLGIGYVFKASFDKANRSSVSS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+ +G +IF ++K  +  PI+TDVH   Q + +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMDEGLKIFEEIKATFNVPIITDVHEPYQAQPVAEVVDVIQLPAFLARQTDLVVAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFL+  EM +I+ K    G + +L CERG+ +GYN LV DM ++  M 
Sbjct: 129 AKTGAVINVKKPQFLAAHEMRHIINKFAEAGNEQILLCERGSCYGYNNLVVDMLAMDEMK 188

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               PVIFDA+H++Q+PG   + + G R     LA++ +A+GIAG+F+E H +P+ A  D
Sbjct: 189 -TQAPVIFDATHALQKPGGRESSADGRRAQAAQLARSGMALGIAGLFIEAHPNPNEAKCD 247

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP  + +  L   L+Q+ AID+++K 
Sbjct: 248 GPCALALDKLAPYLTQMKAIDELVKS 273


>gi|257094878|ref|YP_003168519.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257047402|gb|ACV36590.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 278

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 127/266 (47%), Positives = 179/266 (67%), Gaps = 2/266 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +Q   LIAGPC  ES D    +A +++ IC  L +  ++K+S+DKANRSS    
Sbjct: 5   HFEAGIDQPLFLIAGPCTAESLDLCLEVAGQMHEICSRLGLPYIFKASYDKANRSSGRSP 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL  G +I  +++++ G P+LTDVH EQ   A+A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGPGLDAGLQILAEVRRQIGVPVLTDVHREQDIAAVASVVDVLQTPAFLCRQTDFIEAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGA--KDVLFCERGTSFGYNTLVTDMRSIPIM 213
            +G+ +N+KKGQFL+P +M N++ K     A  + ++ CERG SFGYN LV+DMRS+ IM
Sbjct: 125 ASGKPVNIKKGQFLAPGDMRNVVAKAREAAAGAESIMVCERGASFGYNNLVSDMRSLAIM 184

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
                PV+FDA+HSVQ PG  G+ SGG+R+++  LA+AAVA+GIAG+F+ETH  P+ A S
Sbjct: 185 RETACPVVFDATHSVQLPGGLGSASGGQREFVPVLARAAVAVGIAGLFMETHPRPETALS 244

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIK 299
           DGPN   +  +  LL+ L+A+D+ +K
Sbjct: 245 DGPNSWPLARMEGLLTTLVALDRAVK 270


>gi|163755987|ref|ZP_02163104.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Kordia algicida OT-1]
 gi|161324158|gb|EDP95490.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Kordia algicida OT-1]
          Length = 272

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 113/266 (42%), Positives = 159/266 (59%), Gaps = 1/266 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
           ++  ++   F L+AGPC IES D A  IAE++  I   L I  V+K SF KANRS +   
Sbjct: 8   KIKHTDSNNFFLLAGPCAIESEDMALRIAERVVKITDDLAIPYVFKGSFKKANRSRIDSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
            G+G +K  EI + +   +  P +TD+H        A  VD+LQIPA L RQTDL+ AAA
Sbjct: 68  TGIGDEKALEILKKVSDTFDVPTITDIHEVSDAAKAAQYVDVLQIPAFLVRQTDLVVAAA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+V+N+KKGQF+SP  M + ++K+H  G ++    +RGT FGY  ++ D R IP M  
Sbjct: 128 KTGKVVNLKKGQFMSPESMKHAVKKVHDSGNENAWITDRGTMFGYQDMIVDFRGIPTMKQ 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
                + D +HS+QQP      +GG    I  +A+A V   + G+F+ETH DP NA SDG
Sbjct: 188 FAP-TVLDVTHSLQQPNQSSGVTGGRPDMIETIARAGVVNNVDGLFIETHFDPANAKSDG 246

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKPL 301
            NM+++  L +LLS L+ I K I  L
Sbjct: 247 ANMLHLDHLERLLSNLVKIRKTISSL 272


>gi|322832982|ref|YP_004213009.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rahnella sp. Y9602]
 gi|321168183|gb|ADW73882.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rahnella sp. Y9602]
          Length = 284

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 120/267 (44%), Positives = 173/267 (64%), Gaps = 2/267 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +N+  FVL  G   +ES D A  + E    + Q L+I  V+K+SFDKANRSS+   
Sbjct: 10  DIKVANDLPFVLFGGMNVLESRDMAMRVCEHYVTVTQKLSIPYVFKASFDKANRSSIHSY 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL +G +IF++LKK +G  I+TDVH   Q + +++ VD++Q+PA L RQTDL+ A A
Sbjct: 70  RGPGLDEGMKIFQELKKAFGVKIITDVHESWQAQPVSEVVDVIQLPAFLARQTDLVEAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG VINVKK QF+SP +M NI+ K    G   V+ C+RG++FGY+ LV DM  + +M +
Sbjct: 130 KTGAVINVKKPQFVSPGQMGNIVDKFKEGGNDQVILCDRGSNFGYDNLVVDMLGMNVMIN 189

Query: 216 M--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
              G PVIFD +H++Q     G  SGG R  +  LA+A +A+GIAG+F+E H+DP +A  
Sbjct: 190 ATGGHPVIFDVTHALQTRDPFGAASGGRRAQVAELARAGMAVGIAGLFIEAHEDPAHAKC 249

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGP+ + +  L   L Q+ AID ++K 
Sbjct: 250 DGPSALPLDKLEPFLVQMKAIDDLVKS 276


>gi|308050531|ref|YP_003914097.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ferrimonas balearica DSM
           9799]
 gi|307632721|gb|ADN77023.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Ferrimonas balearica DSM
           9799]
          Length = 283

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 124/268 (46%), Positives = 171/268 (63%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
            Q   +N++ FVL  G   +ES D A  IAE    + + L I  V+K+SFDKANRSS+  
Sbjct: 9   GQCDVANDKPFVLFGGMNVLESRDLAMRIAEHYVQVTEKLGIPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF ++K  +  P++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFEEIKSTFNVPLITDVHETHQAAPVAEVVDVIQLPAFLARQTDLVAAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A T  V+NVKK QFLSP +M NI++K    G ++V+ CERG +FGY+ LV DM     M 
Sbjct: 129 AATDAVVNVKKPQFLSPGQMKNIVEKFRECGKEEVILCERGANFGYDNLVVDMLGFRTMK 188

Query: 215 SM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G+PVIFD +H++Q     G  SGG R+  V LAKA +A G+AG+FLE H DPDNA 
Sbjct: 189 EASGGLPVIFDVTHALQCRDPLGAASGGRRRQTVELAKAGMATGLAGLFLEAHPDPDNAL 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L+QL A+D +IK 
Sbjct: 249 CDGPSALPLAMLEPFLAQLKALDDLIKA 276


>gi|225848204|ref|YP_002728367.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225643555|gb|ACN98605.1| 3-deoxy-8-phosphooctulonate synthase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 262

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 136/257 (52%), Positives = 177/257 (68%), Gaps = 2/257 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLK 101
            RF +IAGPC IES +  F +AE L  + +   +I  V+KSSFDKANRSSL   RG GL+
Sbjct: 2   NRFTIIAGPCVIESREICFEVAEVLRQLQEKYSDIRFVFKSSFDKANRSSLESFRGRGLE 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G  + +D+K K+G  +LTD+H   Q + +++ VDI+QIPA LCRQTDLL AAA+TG+ +
Sbjct: 62  WGLSVLKDVKDKFGLEVLTDIHESYQAKPVSEVVDIIQIPAFLCRQTDLLLAAAETGKEV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  NI+ KL   GA  +   ERGT+FGYN LV D R + IM      VI
Sbjct: 122 NVKKGQFLAPWDTKNIVDKLKFGGADKIYLTERGTTFGYNNLVVDFRGLKIMRQYAP-VI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           FDA+HSVQ PG  G  SGG+R++  PLAKAAV +G+ G+F ETH DPD A SDGPN I +
Sbjct: 181 FDATHSVQIPGGLGKASGGQREFAYPLAKAAVVVGVDGLFFETHPDPDKALSDGPNQIPL 240

Query: 282 KDLPKLLSQLLAIDKII 298
           KD P ++  LL + + +
Sbjct: 241 KDFPTIVENLLRLREFV 257


>gi|311694164|gb|ADP97037.1| 2-dehydro-3-deoxyphosphooctonate aldolase [marine bacterium HP15]
          Length = 281

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 122/265 (46%), Positives = 166/265 (62%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +  +N++ FVL  G   +ES + A  +AE        L I  V+K+SFDKANRSS+   
Sbjct: 10  GIDVANDKPFVLFGGMNVLESPELAMEVAEAYVEATGKLGIPYVFKASFDKANRSSVNSF 69

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL+KG +I  D+K K+G PI++DVH   Q    A   DI+Q+PA L RQTDL+ A A
Sbjct: 70  RGPGLEKGLQILADIKSKFGVPIISDVHEPAQAAPAAQVCDIIQLPAFLSRQTDLVVAMA 129

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG VIN+KK QFL+P EM +I+ K    G   V+ CERG+SFGYN LV DM    IM +
Sbjct: 130 KTGAVINIKKAQFLAPQEMKHIITKCEEAGNDKVILCERGSSFGYNNLVVDMLGFGIMKA 189

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
           M VPV+FD +HS+Q PG   + +GG R  +  LA A ++ G+AG+FLE H DPD A  DG
Sbjct: 190 MNVPVMFDVTHSLQMPGGRADSAGGRRAQVTDLALAGMSQGLAGLFLEAHPDPDKAKCDG 249

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           P  + +  L   L ++ A+D ++K 
Sbjct: 250 PCALRLSQLEPFLQRVKAVDDLVKS 274


>gi|222110128|ref|YP_002552392.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidovorax ebreus TPSY]
 gi|254807739|sp|B9MEQ6|KDSA_ACIET RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|221729572|gb|ACM32392.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidovorax ebreus TPSY]
          Length = 285

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 130/271 (47%), Positives = 170/271 (62%), Gaps = 6/271 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +QRF LIAG C IE  + +  +A +L   C  L I L+YK SFDKANRSS   K
Sbjct: 5   GFNVGLDQRFFLIAGTCSIEGLEMSLDVAGQLKEACAPLGIPLIYKGSFDKANRSSGTSK 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RGVGL  G +I  +++++   PILTDVH       +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGVGLDAGLKILDEVRRQLQLPILTDVHDTSHVAEVASVVDVLQTPAFLCRQTDFIRAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+PW+M N++ K  A            L CERG SFGYN LV DM S
Sbjct: 125 QSGKPVNIKKGQFLAPWDMKNVIDKARAAAREVGLSEDRFLACERGVSFGYNNLVADMTS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           +  M + G PV+FD +HSVQ+PG  G  SGG R  +  LA+A VA+G+AG+F+ETH  P 
Sbjct: 185 LAEMRNSGAPVVFDVTHSVQKPGGLGAVSGGARDMVPVLARAGVAVGVAGLFMETHPKPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            A SDGPN + +K +  LL  L+A+D + K 
Sbjct: 245 EAWSDGPNAVPLKHMRALLETLVALDDVTKK 275


>gi|26988537|ref|NP_743962.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida
           KT2440]
 gi|37999629|sp|Q88LX0|KDSA2_PSEPK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase 2; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase 2; AltName: Full=KDO-8-phosphate synthase 2;
           Short=KDO 8-P synthase 2; Short=KDOPS 2; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase 2
 gi|24983307|gb|AAN67426.1|AE016370_1 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudomonas putida
           KT2440]
          Length = 280

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 165/269 (61%), Gaps = 2/269 (0%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
            + +  SN   FVL  G   +ES D A     +   + Q L I  V+K+SFDKANRSS+ 
Sbjct: 5   NSTIECSNSAPFVLFGGINVLESEDLALTACAEYVRVTQKLGIPYVFKASFDKANRSSIH 64

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RG G+++G  IF  +K ++G PI+TDVH   Q   +A+ VD+LQ+PA L RQTDL+ A
Sbjct: 65  SYRGPGMEEGLRIFEKVKAEFGVPIITDVHEIYQTAPVAEVVDVLQLPAFLARQTDLVVA 124

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            A+TG+ +N+KK QFLSP +M NI+ K    G   ++ C+RGT  GY+ L+ DM    +M
Sbjct: 125 LAKTGKPVNIKKPQFLSPSQMQNIVHKFKEAGNDQLILCDRGTCMGYDNLIVDMLGFGVM 184

Query: 214 TSMGV--PVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
                  P+IFD +H++Q     G  SGG R+ +V LA+A + +G+AG+FLE H +PD A
Sbjct: 185 KRTCQDLPIIFDVTHALQNRDPSGAASGGRREQVVELARAGMGVGLAGLFLEAHPNPDQA 244

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
             DGP+ + +  L   L+Q+ A+D ++K 
Sbjct: 245 KCDGPSALPLDKLEPFLAQIKALDDLVKS 273


>gi|269102029|ref|ZP_06154726.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268161927|gb|EEZ40423.1| 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase
           [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 284

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 116/281 (41%), Positives = 168/281 (59%), Gaps = 6/281 (2%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +     + +G     +  +N++ FVL  G   +ES D A  I E    +   L I  V+K
Sbjct: 1   MMEQKVVRVGD----IDVANDKPFVLFGGMNVLESRDLAMKICEHYVEVTNKLGIPYVFK 56

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           +SFDKANRSS+   RG G+ +G +IF++LK  +G  I+TDVH + Q + +A+ VD++Q+P
Sbjct: 57  ASFDKANRSSVHSYRGPGMDEGLKIFQELKDTFGVKIITDVHEQYQAQPVAEVVDVIQLP 116

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDL+ A A+TG VINVKK QF+SP ++ NI++K       +++ CERG   GY+
Sbjct: 117 AFLARQTDLVEAMAKTGAVINVKKPQFMSPNQVGNIVEKFAECDNHNIILCERGVVHGYD 176

Query: 202 TLVTDMRSIPIMTS--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAG 259
            LV DM    +M     G P+IFD +HS+Q     G  SGG R   V LA + VA GIAG
Sbjct: 177 NLVVDMLGFDVMKEASKGSPIIFDVTHSLQCRDPQGAASGGRRAQTVSLALSGVATGIAG 236

Query: 260 IFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +F+E H +P+NA  DGP+   +  L   L Q+  +D ++K 
Sbjct: 237 LFMEAHPEPNNARCDGPSAFPLAQLEPFLKQVKQLDDLVKS 277


>gi|332828882|gb|EGK01565.1| 3-deoxy-8-phosphooctulonate synthase [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 266

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 121/265 (45%), Positives = 165/265 (62%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T      F L+AGPC IE  + A  IAEK+  I   L+I  V+K S+ KANRS +   
Sbjct: 2   NITNLKNDNFFLLAGPCVIEGEEMALRIAEKIIGITSKLDIPYVFKGSYKKANRSRVDSF 61

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
            G+G +K  +I R + + +G P +TD+H   +    A+ VD+LQIPA LCRQTDLL AAA
Sbjct: 62  TGIGDEKALKILRKVNETFGVPTVTDIHETHEAAMAAEYVDVLQIPAFLCRQTDLLIAAA 121

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+++N+KKGQFL+P  M    QK+   G  +V+  +RGTSFGY+ LV D R IP M  
Sbjct: 122 KTGKIVNIKKGQFLAPGGMKFAAQKVVDSGNNNVIITDRGTSFGYSDLVVDFRGIPEMKE 181

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+ DA+HS+Q+P      +GG+ Q I  + KA +A G+ G+FLETH DP NA SDG
Sbjct: 182 FGFPVVLDATHSLQKPNQASGVTGGQPQLIETMCKAGIATGVDGLFLETHFDPANALSDG 241

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
            NM+ +  L  LL +L  I   +K 
Sbjct: 242 ANMLPLDQLEGLLIKLTRIKSALKE 266


>gi|94970696|ref|YP_592744.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Koribacter
           versatilis Ellin345]
 gi|123381265|sp|Q1IKD0|KDSA_ACIBL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|94552746|gb|ABF42670.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 278

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 126/266 (47%), Positives = 173/266 (65%), Gaps = 5/266 (1%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            V     +   LIAGPC IES  HA  +AE +  +C+++ I  ++K+S+DKANR+SL+  
Sbjct: 9   DVEIGGPK-LFLIAGPCVIESEAHAMKMAEAISGVCKAMKIPYIFKASYDKANRTSLSSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL +G  I   +  +   P+LTDVH  +Q  A  D VD+LQIPA LCRQTDLL AAA
Sbjct: 68  RGPGLHEGLRILAKVADEVNVPVLTDVHDTEQATAAGDIVDVLQIPAFLCRQTDLLVAAA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+V+NVKKGQF++P +M   + K+   G + V   ERG SFGYN LV DMR++PIM  
Sbjct: 128 KTGKVVNVKKGQFVAPNDMQYAVTKVRESGNQRVCLTERGASFGYNNLVVDMRALPIMRQ 187

Query: 216 MGVPVIFDASHSVQQP---GIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               VIFDA+HSVQ P         SGG+ ++I  L++AAVA G+ G+F+E H DP +A 
Sbjct: 188 FAP-VIFDATHSVQLPSAGKDGHAVSGGQPEFIPVLSRAAVAAGVDGVFMEVHDDPPHAK 246

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKII 298
           SDG N +++K L  +L+ LL I + +
Sbjct: 247 SDGANALDLKLLRGVLTSLLRIREAV 272


>gi|254180817|ref|ZP_04887415.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1655]
 gi|184211356|gb|EDU08399.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1655]
          Length = 281

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 121/270 (44%), Positives = 172/270 (63%), Gaps = 2/270 (0%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
              VT  N   FVL  G   +ES D    +  +  A+ + L I  V+K+SFDKANRSS+ 
Sbjct: 6   SPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIH 65

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RGVGL +G +IF ++K ++G P++TDVH  +Q   +A+  D+LQ+PA L RQTDL+ A
Sbjct: 66  SYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVA 125

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            A+TG+ +NVKK QF+SP ++ +++ K    G   V+ CERG+SFGY+ LV DM     M
Sbjct: 126 IAKTGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQM 185

Query: 214 TSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
                G PVIFD +HS+Q     G+ SGG R+ ++ LA+A +A+GIAG+FLE H DPD A
Sbjct: 186 AETTGGCPVIFDVTHSLQCRDPLGDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRA 245

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
             DGP+ + +  L   LSQ+ AID ++K +
Sbjct: 246 RCDGPSALPLHQLEGFLSQMKAIDDLVKRM 275


>gi|225849973|ref|YP_002730207.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Persephonella marina
           EX-H1]
 gi|225646081|gb|ACO04267.1| 3-deoxy-8-phosphooctulonate synthase [Persephonella marina EX-H1]
          Length = 262

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 133/254 (52%), Positives = 181/254 (71%), Gaps = 2/254 (0%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           RF +IAGPC IE+ +  F +AE L  + +   +I  V+KSSFDKANRSS    RG G+  
Sbjct: 3   RFTVIAGPCVIENEEVCFKVAETLSELQKRYPDIRFVFKSSFDKANRSSHESFRGRGMDY 62

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G ++  ++K ++G P+LTD+H   Q E +++ VDI+QIPA LCRQTDLL +AA+TGR IN
Sbjct: 63  GLKVLEEVKSEFGLPVLTDIHESYQAEPVSEVVDIIQIPAFLCRQTDLLLSAAKTGREIN 122

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQFLSPW+  NI++KL   GAK     ERG +FGYN LV D RS+P+M      VI+
Sbjct: 123 VKKGQFLSPWDTKNIVEKLKFGGAKKFYLTERGVTFGYNNLVVDFRSLPVMRQFAP-VIY 181

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G  SGG+R++I PLAKAAV++G+ G+F ETH DPD A SDGPN I + 
Sbjct: 182 DATHSVQLPGGKGKSSGGQREFIYPLAKAAVSVGVDGLFFETHPDPDKALSDGPNQIPLS 241

Query: 283 DLPKLLSQLLAIDK 296
           + P+++ +L+++ +
Sbjct: 242 EFPEVIEKLISLRE 255


>gi|326796607|ref|YP_004314427.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinomonas mediterranea
           MMB-1]
 gi|326547371|gb|ADZ92591.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Marinomonas mediterranea
           MMB-1]
          Length = 285

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 118/276 (42%), Positives = 171/276 (61%), Gaps = 3/276 (1%)

Query: 24  TNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSS 83
           T+  I +G   N+V  +N   FVL +G   +ES D A  +AE    + + L+I  V+K S
Sbjct: 4   TSKVIRIG---NKVDVANHLPFVLFSGVNVLESRDLAMQVAEAHVKVTEELDIPYVFKGS 60

Query: 84  FDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPAL 143
           FDKANRSS+   RG GL +G +I  ++K  +G P++TDVH   QC   A+  D++Q+PA 
Sbjct: 61  FDKANRSSINSFRGPGLDEGLKILEEIKNTFGVPVITDVHEIDQCAPTAEVADVIQLPAF 120

Query: 144 LCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTL 203
           L RQTDL+ A AQTG VIN+KK QFL+P EM +IL K    G   ++ CERGT FGYN L
Sbjct: 121 LSRQTDLVVAMAQTGAVINIKKAQFLAPHEMKHILTKCQEAGNDQLMLCERGTMFGYNNL 180

Query: 204 VTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLE 263
           V DM     M     PV+FD +H++Q+PG   + + G R  +  LA+A +++G++ +FLE
Sbjct: 181 VVDMLGFGEMKKFDFPVMFDVTHALQRPGGRSDSADGRRAQVTELARAGMSLGLSSMFLE 240

Query: 264 THQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIK 299
           TH  P++A  DGP  + +  L   L Q+  +D+++K
Sbjct: 241 THPSPNDARCDGPCALPLDKLSPFLKQIKQLDELVK 276


>gi|299140979|ref|ZP_07034117.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella oris C735]
 gi|298577945|gb|EFI49813.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella oris C735]
          Length = 250

 Score =  268 bits (686), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 120/247 (48%), Positives = 159/247 (64%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
           + IAGPC IES      +A +L  I +   I +++K+SFDKANR+S+   RG GL KG +
Sbjct: 4   IFIAGPCVIESATLLNTVAHELVRINRKYGINIIFKASFDKANRTSIHSFRGPGLDKGLQ 63

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
           +  D+K +YG  ILTD+H   Q EA  +  D+LQIPA LCRQTDLL AAA+TG+ IN+KK
Sbjct: 64  MLADIKAEYGLQILTDIHESCQAEAAGEVCDVLQIPAFLCRQTDLLVAAAKTGKTINIKK 123

Query: 166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDAS 225
            QFLS  +M   ++K    GAK+V   ERG SFGYN LV D R+IP M  +   VI D +
Sbjct: 124 AQFLSGADMRYPVEKAMESGAKEVWLTERGNSFGYNNLVVDFRNIPDMKEIVPTVIMDCT 183

Query: 226 HSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLP 285
           HSVQ+PG     + G+R+++  +A AA A G  G F E H +PD   SDGPNM+ +  L 
Sbjct: 184 HSVQRPGAGNGKTSGDRRFVPSMALAAKAFGATGYFFEVHPNPDKGLSDGPNMLELDKLE 243

Query: 286 KLLSQLL 292
           +L+ QLL
Sbjct: 244 QLIGQLL 250


>gi|218885536|ref|YP_002434857.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio vulgaris
           str. 'Miyazaki F']
 gi|218756490|gb|ACL07389.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Desulfovibrio vulgaris
           str. 'Miyazaki F']
          Length = 270

 Score =  268 bits (686), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 128/252 (50%), Positives = 171/252 (67%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
            + AGPC +ES + A   A  +    ++  +  V+KSS+DKANR+SL G RG GL +G E
Sbjct: 15  FIFAGPCALESLELAMDTAHAVREAAEAAGLFAVFKSSWDKANRTSLDGFRGPGLARGME 74

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
               +K++ G P++TD+H   Q + +A+  D+LQIPA LCRQT LL AAAQTGRV+NVKK
Sbjct: 75  WLARIKQETGLPVVTDIHEPDQAKPVAEVADVLQIPAFLCRQTSLLLAAAQTGRVVNVKK 134

Query: 166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDAS 225
           GQF++PW+M   L KL + G + +L  ERG SFGYN LV D RS+PIM   GVPV+FDA+
Sbjct: 135 GQFVAPWDMAPALDKLRSTGNQRILLTERGASFGYNNLVVDFRSLPIMQGYGVPVVFDAT 194

Query: 226 HSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLP 285
           HSVQ PG  G  SGG+R+++  L++AAVA G+ G+FLETH DPD+A  DGPN   +  L 
Sbjct: 195 HSVQLPGGKGTSSGGDRRFVPMLSRAAVAAGVDGVFLETHPDPDHALCDGPNSWPLDRLA 254

Query: 286 KLLSQLLAIDKI 297
            LL    A+  +
Sbjct: 255 PLLRDFAALWSL 266


>gi|282856194|ref|ZP_06265477.1| 3-deoxy-8-phosphooctulonate synthase [Pyramidobacter piscolens
           W5455]
 gi|282585953|gb|EFB91238.1| 3-deoxy-8-phosphooctulonate synthase [Pyramidobacter piscolens
           W5455]
          Length = 283

 Score =  268 bits (686), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 130/268 (48%), Positives = 179/268 (66%), Gaps = 4/268 (1%)

Query: 36  QVTFS----NEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSS 91
           ++          R  LIAGPC +ES +    +  K   +C+ L +  ++K+S+DKANR+S
Sbjct: 3   KIEIGDFVVGGDRLTLIAGPCALESLELGLEVGRKTQVLCEKLGLNYIFKASYDKANRTS 62

Query: 92  LAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLL 151
           ++  RG G++KG +    +K + G PILTD+H   Q   +A+  D+LQIPA LCRQTDLL
Sbjct: 63  ISSPRGPGIEKGLQWLAQIKAELGAPILTDIHEPWQAAPVAEVADVLQIPAFLCRQTDLL 122

Query: 152 TAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIP 211
            AAA+TGR +NVKK QFLS W+M ++L KL   G   V+ CERGT  GYN LV DMRS+ 
Sbjct: 123 VAAAKTGRAVNVKKAQFLSAWDMKSVLGKLTEAGNDRVMLCERGTMMGYNQLVVDMRSLV 182

Query: 212 IMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
           IM S+G PV+FDA+HSVQ PG  G  SGG+R++ +PLA+AAV IG+  +FLE H  P+ A
Sbjct: 183 IMRSLGAPVVFDATHSVQMPGGMGGSSGGDRRFALPLARAAVGIGVDALFLEVHPQPEKA 242

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            SDGPNM+ +  L   L Q+ AID++++
Sbjct: 243 MSDGPNMVPLDLLEGFLEQVRAIDRLVR 270


>gi|119477274|ref|ZP_01617510.1| 2-dehydro-3-deoxyphosphooctonate aldolase [marine gamma
           proteobacterium HTCC2143]
 gi|119449637|gb|EAW30875.1| 2-dehydro-3-deoxyphosphooctonate aldolase [marine gamma
           proteobacterium HTCC2143]
          Length = 283

 Score =  268 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 120/271 (44%), Positives = 172/271 (63%), Gaps = 2/271 (0%)

Query: 33  GKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSL 92
               V+ SN+  FVL  G   +ES D A  +AE+   I Q L I  V+K+SFDKANRSS+
Sbjct: 7   NVGSVSISNDLPFVLFGGMNVLESRDMAMTMAEQYVEITQRLGIPYVFKASFDKANRSSI 66

Query: 93  AGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLT 152
              RG GL++G +IF ++K+ +  P++TD+H  +Q +A+AD  D++Q+PA L RQTDL+ 
Sbjct: 67  HSFRGPGLEEGLKIFEEIKQTFNVPVITDIHEIEQAQAVADVCDVIQLPAFLARQTDLVA 126

Query: 153 AAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPI 212
           A A TG VIN+KK QFLSP +M NI++K    G   V+ CERG++FGY+ LV DM     
Sbjct: 127 AMAATGNVINIKKPQFLSPSQMKNIVEKFAECGNDKVMLCERGSNFGYDNLVVDMLGFRT 186

Query: 213 MTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDN 270
           M  +  G P+IFD +H++Q     G  SGG R  +  L +A ++  +AG+FLE H DPDN
Sbjct: 187 MKEVSGGAPIIFDVTHALQCRDPMGAASGGRRHQVAELGRAGMSQKLAGLFLEAHPDPDN 246

Query: 271 APSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           A  DGP+ + +  L   L ++ A+D ++K L
Sbjct: 247 AKCDGPSALPMAVLEDFLKEMKAVDDLMKSL 277


>gi|71041554|pdb|1T8X|A Chain A, R106g Kdo8ps With Pep And A5p
 gi|71041555|pdb|1T8X|B Chain B, R106g Kdo8ps With Pep And A5p
 gi|71041556|pdb|1T96|A Chain A, R106g Kdo8ps With Pep
 gi|71041557|pdb|1T96|B Chain B, R106g Kdo8ps With Pep
 gi|71041558|pdb|1T99|A Chain A, R106g Kdo8ps Without Substrates
 gi|71041559|pdb|1T99|B Chain B, R106g Kdo8ps Without Substrates
 gi|78101063|pdb|1ZHA|A Chain A, A. Aeolicus Kdo8ps R106g Mutant In Complex With Pep And
           R5p
 gi|78101064|pdb|1ZHA|B Chain B, A. Aeolicus Kdo8ps R106g Mutant In Complex With Pep And
           R5p
 gi|78101068|pdb|1ZJI|A Chain A, Aquifex Aeolicus Kdo8ps R106g Mutant In Complex With 2pga
           And R5p
 gi|78101069|pdb|1ZJI|B Chain B, Aquifex Aeolicus Kdo8ps R106g Mutant In Complex With 2pga
           And R5p
          Length = 267

 Score =  268 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 123/257 (47%), Positives = 175/257 (68%), Gaps = 2/257 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGPC IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 2   EKFLVIAGPCAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LC QTDLL AAA+TGR +
Sbjct: 62  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCGQTDLLLAAAKTGRAV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 122 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQW-AKVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD    + +
Sbjct: 181 YDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDASTQLPL 240

Query: 282 KDLPKLLSQLLAIDKII 298
             L  ++  +L I ++ 
Sbjct: 241 SQLEGIIEAILEIREVA 257


>gi|84683740|ref|ZP_01011643.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84668483|gb|EAQ14950.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhodobacterales
           bacterium HTCC2654]
          Length = 276

 Score =  268 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 143/266 (53%), Positives = 195/266 (73%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T   E     I GPCQ+ES DHA M+AEK+ A C+S     ++KSS+DKANRSS++ K
Sbjct: 9   DLTVGGENPVAFILGPCQLESLDHARMMAEKIAAACESAGAKFIFKSSYDKANRSSISTK 68

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+ +G  I   ++ ++G P+LTDVH   QC  + ++VD+LQIPA LCRQTDLL AA 
Sbjct: 69  RGLGMDEGLTILSKIRDEFGVPVLTDVHDAHQCGPVGEAVDVLQIPAFLCRQTDLLLAAG 128

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TGR INVKKGQFL+PW++ N+  K+ + G + ++ C+RGTSFGYNTLVTD R +PIM  
Sbjct: 129 ETGRAINVKKGQFLAPWDIGNVADKIASTGNEKIMLCDRGTSFGYNTLVTDFRGLPIMAQ 188

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+FDA+HSVQQPG  G  SGG+R++   LA+AA A+G++ +FLETH+DPDNAPSDG
Sbjct: 189 TGYPVVFDATHSVQQPGGQGTTSGGQREFAPILARAACAVGVSAVFLETHEDPDNAPSDG 248

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKPL 301
           PNMI + +L  +L+ L+  D + + L
Sbjct: 249 PNMIPVDELAGVLTALVRYDALTREL 274


>gi|166210645|ref|ZP_02236680.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166207825|gb|EDR52305.1| 3-deoxy-8-phosphooctulonate synthase [Yersinia pestis biovar
           Antiqua str. B42003004]
          Length = 284

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 118/280 (42%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+++G  ++TDVH   Q + +++ VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQQFGVKVITDVHEASQAQPVSEVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI++K    G   V+ C+RG++FGY+ 
Sbjct: 117 FLARQTDLVEAMARTGAVINVKKPQFVSPGQMGNIVEKFKEAGNDQVILCDRGSNFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM  I +M     G PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGINVMVQATGGHPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H +P++A  DGP+ + +  L   L Q+ A D ++K 
Sbjct: 237 FIEAHPEPNSAKCDGPSALPLDKLEPFLVQMKATDDLVKS 276


>gi|332883848|gb|EGK04128.1| 3-deoxy-8-phosphooctulonate synthase [Dysgonomonas mossii DSM
           22836]
          Length = 264

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 116/262 (44%), Positives = 162/262 (61%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +       F L+AGPC IE  + A  IAEK+  I   LNI  V+K S+ KANRS +   
Sbjct: 2   NIENLKNDNFFLLAGPCVIEGEEMALRIAEKVKTITDRLNIPHVFKGSYKKANRSRVDSF 61

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
            G+G +K  +I R + + +G P +TD+H   +    A+ VD+LQIPA LCRQTDLL AAA
Sbjct: 62  TGIGDEKALKILRKVGETFGIPTVTDIHETHEAAMAAEYVDVLQIPAFLCRQTDLLIAAA 121

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
           +TG+++N+KKGQFL+P  M    QK+   G K+V+  +RGTSFGY+ LV D R IP M  
Sbjct: 122 KTGKIVNIKKGQFLAPSGMQFAAQKVLDSGNKNVILTDRGTSFGYSDLVVDFRGIPEMKE 181

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+ DA+H +Q+P      +GG+ + I  + KA +A G+ G+F+ETH D  NA SDG
Sbjct: 182 FGFPVVLDATHCLQKPNQASGVTGGQPKLIETMCKAGIATGVDGLFIETHFDTANALSDG 241

Query: 276 PNMINIKDLPKLLSQLLAIDKI 297
            NM+ +  L  L+ +L+ I   
Sbjct: 242 ANMLPLDQLEGLMEKLVRIKAA 263


>gi|121593417|ref|YP_985313.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidovorax sp. JS42]
 gi|158513898|sp|A1W4R2|KDSA_ACISJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|120605497|gb|ABM41237.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Acidovorax sp. JS42]
          Length = 285

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 130/271 (47%), Positives = 170/271 (62%), Gaps = 6/271 (2%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
                 +QRF LIAG C IE  + +  +A +L   C  L I L+YK SFDKANRSS   K
Sbjct: 5   GFDVGLDQRFFLIAGTCSIEGLEMSLDVAGQLKEACAPLGIPLIYKGSFDKANRSSGTSK 64

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RGVGL  G +I  +++++   PILTDVH       +A  VD+LQ PA LCRQTD + A A
Sbjct: 65  RGVGLDAGLKILDEVRRQLQLPILTDVHDTSHVAEVASVVDVLQTPAFLCRQTDFIRAVA 124

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAH------GAKDVLFCERGTSFGYNTLVTDMRS 209
           Q+G+ +N+KKGQFL+PW+M N++ K  A            L CERG SFGYN LV DM S
Sbjct: 125 QSGKPVNIKKGQFLAPWDMKNVIDKARAAAREVGLSEDRFLACERGVSFGYNNLVADMTS 184

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           +  M + G PV+FD +HSVQ+PG  G  SGG R  +  LA+A VA+G+AG+F+ETH  P 
Sbjct: 185 LAEMRNSGAPVVFDVTHSVQKPGGLGAVSGGARDMVPVLARAGVAVGVAGLFMETHPKPA 244

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            A SDGPN + +K +  LL  L+A+D + K 
Sbjct: 245 EAWSDGPNAVPLKHMRALLETLVALDDVTKK 275


>gi|149276389|ref|ZP_01882533.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pedobacter sp. BAL39]
 gi|149232909|gb|EDM38284.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pedobacter sp. BAL39]
          Length = 271

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 115/269 (42%), Positives = 163/269 (60%)

Query: 30  LGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANR 89
           +      +   +   F L+AGPC IE  + A  IAEK+  I   L I  ++K S+ KANR
Sbjct: 2   INFDLANLKHQDSGNFFLMAGPCAIEGEEIALRIAEKIVTITDKLEIPFIFKGSYRKANR 61

Query: 90  SSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTD 149
           S      G+G +K  +I   + K +  P +TD+H   +    A  VD+LQIPA LCRQTD
Sbjct: 62  SKGGSFTGIGDEKALKILEKVSKTFNVPTVTDIHESDEAAMAAAYVDVLQIPAFLCRQTD 121

Query: 150 LLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRS 209
           LL AAA+TG+V+NVKKGQFLS   M   ++K+   G   V+  +RG +FGY  L+ D R 
Sbjct: 122 LLIAAAKTGKVVNVKKGQFLSAGSMKFAVEKIVESGNNRVILTDRGNTFGYQDLIVDYRG 181

Query: 210 IPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
           +P M   GVPV+ D +HS+QQP      +GG+ + I  ++KAAVA+G+ G+F+ETH DP 
Sbjct: 182 LPEMQGFGVPVVMDCTHSLQQPNQSSGVTGGKPELIETISKAAVAVGVDGLFIETHPDPA 241

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKII 298
           NA SDG NM+++  L  LL +L+ + K +
Sbjct: 242 NAKSDGANMLHLDYLEDLLIKLVRLRKAV 270


>gi|294678396|ref|YP_003579011.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacter capsulatus SB
           1003]
 gi|294477216|gb|ADE86604.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacter capsulatus SB
           1003]
          Length = 277

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 146/275 (53%), Positives = 196/275 (71%), Gaps = 4/275 (1%)

Query: 26  AAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFD 85
             + +G    ++T +N+    +IAGPCQ+ES  HA MIAE +   C +     V+K SFD
Sbjct: 2   KNVTIG----RLTVANDLPLTVIAGPCQLESLPHALMIAEVMAEACAAAGAQFVFKGSFD 57

Query: 86  KANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLC 145
           KANR+SL GKRGVGL+ G  I   ++ K G P+LTD+H  +Q    A  VD++QIPA LC
Sbjct: 58  KANRTSLKGKRGVGLEAGLAILDTVRAKLGCPVLTDIHDPEQARIAAQVVDVIQIPAFLC 117

Query: 146 RQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVT 205
           RQTDLL AA +TGRV+N+KKGQFL+PW+M N+ +K+ + G + +L  ERGTSFGYNTLV 
Sbjct: 118 RQTDLLIAAGETGRVVNIKKGQFLAPWDMPNVAEKVASTGNEKILLTERGTSFGYNTLVA 177

Query: 206 DMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETH 265
           DMR +P+M   G PVI DA+HSVQQPG  G  SGG+R+    +A+AAV++GIAG+F+ETH
Sbjct: 178 DMRGLPVMAKTGYPVIMDATHSVQQPGGLGGASGGQREMAPVMARAAVSLGIAGVFIETH 237

Query: 266 QDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           + PD APSDGPNMI +  +PKL++ L+A D++ K 
Sbjct: 238 EAPDTAPSDGPNMIPLDQMPKLIATLMAFDRLAKA 272


>gi|311107176|ref|YP_003980029.1| 3-deoxy-8-phosphooctulonate synthase [Achromobacter xylosoxidans
           A8]
 gi|310761865|gb|ADP17314.1| 3-deoxy-8-phosphooctulonate synthase [Achromobacter xylosoxidans
           A8]
          Length = 285

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 120/266 (45%), Positives = 173/266 (65%), Gaps = 2/266 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           ++ +N++ FVL  G   +ES D A    E+   + + L I  V+K+SFDKANRSS+   R
Sbjct: 12  ISCANDRPFVLFGGINVLESMDLALRAGEEYQRVTRKLGIPYVFKASFDKANRSSIHSYR 71

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF  +KK++G P++TDVH   Q   +A+ VDILQ+PA L RQTDL+ A A+
Sbjct: 72  GPGLEEGMKIFEAVKKEFGVPVITDVHEPWQAAPVAEVVDILQLPAFLARQTDLVVALAK 131

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T RVIN+KK QFLSP +M NI++K    G   ++ C+RGTSFGY+ LV DM    +M  +
Sbjct: 132 TQRVINIKKPQFLSPGQMLNIVEKFTEAGNDKLILCDRGTSFGYDNLVVDMLGFGVMKKV 191

Query: 217 --GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               P+IFD +H++QQ       SGG R+ +  LA+A +A+G+AG+FLE H DP NA  D
Sbjct: 192 SGNRPLIFDVTHALQQRSALDAASGGRREQVAELARAGMAVGLAGLFLEAHPDPKNAKCD 251

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP+ + +  L   L+QL  +D ++K 
Sbjct: 252 GPSALPLDKLEPFLTQLKRLDDLVKS 277


>gi|254511604|ref|ZP_05123671.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacteraceae bacterium
           KLH11]
 gi|221535315|gb|EEE38303.1| 3-deoxy-8-phosphooctulonate synthase [Rhodobacteraceae bacterium
           KLH11]
          Length = 277

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 141/265 (53%), Positives = 190/265 (71%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            +T  N+    +IAGPCQ+E+ DHA MIA  +   C +     V+K+S+DKANR+SL+GK
Sbjct: 8   NLTVGNDLPLTVIAGPCQLETADHARMIAGTMKEACDAAGAQYVFKASYDKANRTSLSGK 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG+G+  G ++  D++   G P+LTDVHTE QC   A+ VDILQIPA LCRQTD+L AA 
Sbjct: 68  RGMGIDAGLKVLGDIRHTMGIPVLTDVHTEAQCAIAAEVVDILQIPAFLCRQTDMLLAAG 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
            TG+ +NVKKGQFL+PWEM NI+ K+ + G +++L  ERGTSFGYNTLV DMRS+P M  
Sbjct: 128 STGKAVNVKKGQFLAPWEMPNIVTKIESTGNQNILLTERGTSFGYNTLVADMRSLPQMAK 187

Query: 216 MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDG 275
            G PV+ DA+HSVQQPG  G  SGG+R++   +A+AAV++G+  +F+ETHQ+PD APSDG
Sbjct: 188 TGYPVVMDATHSVQQPGGQGGSSGGQREFAPVMARAAVSLGVGAVFIETHQEPDTAPSDG 247

Query: 276 PNMINIKDLPKLLSQLLAIDKIIKP 300
           PNMI +  +  L+  L+  D + K 
Sbjct: 248 PNMIPLDQMGHLIDTLMRFDALAKE 272


>gi|325292756|ref|YP_004278620.1| 2-dehydro-3-deoxyphosphooctonate aldolase / KDO 8-P synthase
           [Agrobacterium sp. H13-3]
 gi|325060609|gb|ADY64300.1| 2-dehydro-3-deoxyphosphooctonate aldolase / KDO 8-P synthase
           [Agrobacterium sp. H13-3]
          Length = 281

 Score =  268 bits (685), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 177/279 (63%), Positives = 229/279 (82%)

Query: 22  IHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYK 81
           +  N  +  G G ++V+FSN +RF LIAGPCQ+ES +HAFMIA  L  +C  L IGLVYK
Sbjct: 3   VTNNLKVTAGDGASKVSFSNAERFSLIAGPCQMESREHAFMIAGVLKELCDKLGIGLVYK 62

Query: 82  SSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIP 141
           SSFDKANR+SL+GKRG+GL    ++F DLKK++GFP+LTD+HTE+QC  +++ VD+LQIP
Sbjct: 63  SSFDKANRTSLSGKRGIGLDNAMQVFADLKKEFGFPVLTDIHTEEQCAVVSEVVDVLQIP 122

Query: 142 ALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN 201
           A L RQTDLL AAA+TGRVINVKKGQFL+PW+M N+L KL+  G  +V+ CERG SFGYN
Sbjct: 123 AFLSRQTDLLVAAAKTGRVINVKKGQFLAPWDMKNVLAKLNESGNPNVMLCERGASFGYN 182

Query: 202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIF 261
           TLV+DMRS+PIM ++G PV+FDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G+AG+F
Sbjct: 183 TLVSDMRSLPIMAALGAPVVFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVGVAGLF 242

Query: 262 LETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           +ETH+DPDNAPSDGPNM+++KD+PKLL +LLA D I K 
Sbjct: 243 IETHEDPDNAPSDGPNMVHLKDMPKLLEKLLAFDAITKA 281


>gi|146386965|pdb|2NX3|A Chain A, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386966|pdb|2NX3|B Chain B, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386967|pdb|2NX3|C Chain C, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386968|pdb|2NX3|D Chain D, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386969|pdb|2NX3|E Chain E, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386970|pdb|2NX3|F Chain F, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386971|pdb|2NX3|G Chain G, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386972|pdb|2NX3|H Chain H, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386973|pdb|2NX3|I Chain I, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386974|pdb|2NX3|J Chain J, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386975|pdb|2NX3|K Chain K, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
 gi|146386976|pdb|2NX3|L Chain L, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
          Length = 267

 Score =  268 bits (685), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 124/257 (48%), Positives = 176/257 (68%), Gaps = 2/257 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGP  IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 2   EKFLVIAGPNAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LCRQTDLL AAA+TGR +
Sbjct: 62  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 122 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQW-AKVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD P  + +
Sbjct: 181 YDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDAPTALPL 240

Query: 282 KDLPKLLSQLLAIDKII 298
             L  ++  +L I ++ 
Sbjct: 241 SQLEGIIEAILEIREVA 257


>gi|146386977|pdb|2NXG|A Chain A, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386978|pdb|2NXG|B Chain B, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386979|pdb|2NXH|A Chain A, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386980|pdb|2NXH|B Chain B, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386981|pdb|2NXH|C Chain C, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386982|pdb|2NXH|D Chain D, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386983|pdb|2NXH|E Chain E, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386984|pdb|2NXH|F Chain F, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386985|pdb|2NXH|G Chain G, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386986|pdb|2NXH|H Chain H, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386987|pdb|2NXH|I Chain I, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386988|pdb|2NXH|J Chain J, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386989|pdb|2NXH|K Chain K, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase.
 gi|146386990|pdb|2NXH|L Chain L, Structural And Mechanistic Changes Along An Engineered
           Path From Metallo To Non-Metallo Kdo8p Synthase
          Length = 263

 Score =  268 bits (685), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 124/257 (48%), Positives = 176/257 (68%), Gaps = 2/257 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGP  IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+
Sbjct: 1   EKFLVIAGPNAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLE 60

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LCRQTDLL AAA+TGR +
Sbjct: 61  YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAV 120

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI
Sbjct: 121 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMKQW-AKVI 179

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD P  + +
Sbjct: 180 YDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDAPTALPL 239

Query: 282 KDLPKLLSQLLAIDKII 298
             L  ++  +L I ++ 
Sbjct: 240 SQLEGIIEAILEIREVA 256


>gi|76811601|ref|YP_334635.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 1710b]
 gi|254262098|ref|ZP_04953152.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1710a]
 gi|76581054|gb|ABA50529.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1710b]
 gi|254220787|gb|EET10171.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           1710a]
          Length = 281

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 121/270 (44%), Positives = 172/270 (63%), Gaps = 2/270 (0%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
              VT  N   FVL  G   +ES D    +  +  A+ + L I  V+K+SFDKANRSS+ 
Sbjct: 6   SPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIH 65

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RGVGL +G +IF ++K ++G P++TDVH  +Q   +A+  D+LQ+PA L RQTDL+ A
Sbjct: 66  SYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVA 125

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            A+ G+ +NVKK QF+SP ++ +++ K    G   V+ CERG+SFGY+ LV DM     M
Sbjct: 126 IAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQM 185

Query: 214 TSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
                G PVIFD +HS+Q     G+ SGG R+ ++ LA+A +A+GIAG+FLE H DPD A
Sbjct: 186 AETTGGCPVIFDVTHSLQCRDPLGDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRA 245

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
             DGP+ + +  L  LLSQ+ AID ++K +
Sbjct: 246 RCDGPSALPLHQLEGLLSQMKAIDDLVKRM 275


>gi|254455657|ref|ZP_05069086.1| 3-deoxy-8-phosphooctulonate synthase [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082659|gb|EDZ60085.1| 3-deoxy-8-phosphooctulonate synthase [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 274

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 150/272 (55%), Positives = 200/272 (73%)

Query: 29  HLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKAN 88
            +      +  SN+ +  +IAGPCQ+E+  HA  +A K+  I +  N+G +YK+SFDKAN
Sbjct: 3   SIKVNCRNIEISNDNKICIIAGPCQLETEQHAMDMAGKIKEITKKFNLGFIYKTSFDKAN 62

Query: 89  RSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQT 148
           R+SL G+RG GL+    +F  +KK+   PILTD+H  +QC  +A+ VDILQIPA LCRQT
Sbjct: 63  RTSLKGERGAGLEASLPVFDKIKKELDVPILTDIHNAEQCSILANHVDILQIPAFLCRQT 122

Query: 149 DLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMR 208
           DLL +AA+T ++INVKKGQFL+PW+M N+ +K+   G +++L  ERG SFGYNTLV+DMR
Sbjct: 123 DLLISAAKTNKIINVKKGQFLAPWDMVNVTKKISDSGNENILVTERGASFGYNTLVSDMR 182

Query: 209 SIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDP 268
           S+PIM   G PVIFDA+HSVQQPG  G  SGG+R+++  LA+AAVA+G+AG+F+ETH DP
Sbjct: 183 SLPIMAKNGYPVIFDATHSVQQPGGQGESSGGQREFVEYLARAAVAVGVAGVFIETHHDP 242

Query: 269 DNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DNAPSDGPNM+ +  L  LL QL  ID +IK 
Sbjct: 243 DNAPSDGPNMVPLDKLENLLKQLNDIDNLIKK 274


>gi|23296073|gb|AAN12290.1| 3-deoxy-D-manno-2-octulosonate-8-phosphate synthase [Aquifex
           pyrophilus]
          Length = 267

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 125/259 (48%), Positives = 176/259 (67%), Gaps = 2/259 (0%)

Query: 43  QRFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLK 101
           ++F++IAGPC IES      +AEK+  +     ++  V+KSSFDKANRSS+   RG GL 
Sbjct: 2   EKFLIIAGPCAIESESLVLRVAEKIRELQDKFRDVEFVFKSSFDKANRSSIHSFRGHGLD 61

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +  R +K+++G    TD+H   Q E + + VDI+QIPA LCRQTDLL AAA+TG+ +
Sbjct: 62  YGLKALRRVKEEFGLKTTTDIHESWQAEPVGEVVDIIQIPAFLCRQTDLLLAAAKTGKPV 121

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI 221
           NVKKGQFL+PW+  N+++KL   GAK++   ERGTSFGYN LV D RS+PIM      VI
Sbjct: 122 NVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTSFGYNNLVVDFRSLPIMKQY-AKVI 180

Query: 222 FDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI 281
           +DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD    + +
Sbjct: 181 YDATHSVQLPGGLGDKSGGMREFIFPLLRAAVAVGCDGVFMETHPEPEKALSDSATQLPL 240

Query: 282 KDLPKLLSQLLAIDKIIKP 300
            +L  ++  +L I ++ + 
Sbjct: 241 GELDGIVEAILEIKQVAEK 259


>gi|259416483|ref|ZP_05740403.1| 3-deoxy-8-phosphooctulonate synthase [Silicibacter sp. TrichCH4B]
 gi|259347922|gb|EEW59699.1| 3-deoxy-8-phosphooctulonate synthase [Silicibacter sp. TrichCH4B]
          Length = 281

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 115/268 (42%), Positives = 167/268 (62%), Gaps = 2/268 (0%)

Query: 36  QVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGK 95
            ++  N     LI G   IES D A  +AE+   + + L I  ++K+SFDKANRSS+   
Sbjct: 8   GISIGNRNPMTLIGGMNVIESRDIALHVAEEFAKVTEELGIPYIFKASFDKANRSSIHSF 67

Query: 96  RGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAA 155
           RG GL +G ++  ++K ++G P++TDVH   Q    A+  DILQ+PA L RQTDL+ A A
Sbjct: 68  RGPGLDEGLKVLSEIKSEFGVPVVTDVHEVSQAAPTAEVCDILQVPAFLARQTDLIAAVA 127

Query: 156 QTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTS 215
            TG  INVKK QF+SP ++ N+++KL   G  +V+ CERG+ FGY+ LV DM  I  M  
Sbjct: 128 ATGAAINVKKPQFMSPSQVKNLVEKLKECGNSNVMLCERGSCFGYDNLVVDMLGIRTMRE 187

Query: 216 MG--VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
                PVIFD +H++Q      + SGG R  +  L ++ +A+GIAG+FLE H DPDNA  
Sbjct: 188 NSGDAPVIFDVTHALQIRDATADASGGRRSQVAELGRSGLAVGIAGLFLEAHPDPDNAKC 247

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           DGP+ + +  L + L+Q+ A+D ++K +
Sbjct: 248 DGPSALPLDRLKEFLTQMKAVDDLVKGM 275


>gi|126439440|ref|YP_001060224.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 668]
 gi|126218933|gb|ABN82439.1| 3-deoxy-8-phosphooctulonate synthase [Burkholderia pseudomallei
           668]
          Length = 281

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 120/270 (44%), Positives = 171/270 (63%), Gaps = 2/270 (0%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
              VT  N   FVL  G   +ES D    +  +  A+ + L I  V+K+SFDKANRSS+ 
Sbjct: 6   SPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIH 65

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RGVGL +G +IF ++K ++G P++TDVH  +Q   +A+  D+LQ+PA L RQTDL+ A
Sbjct: 66  SYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVA 125

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            A+ G+ +NVKK QF+SP ++ +++ K    G   V+ CERG+SFGY+ LV DM     M
Sbjct: 126 IAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQM 185

Query: 214 TSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
                G PVIFD +HS+Q     G+ SGG R+ ++ LA+A +A+GIAG+FLE H DPD A
Sbjct: 186 AETTGGCPVIFDVTHSLQWRDPLGDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRA 245

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
             DGP+ + +  L   LSQ+ AID ++K +
Sbjct: 246 RCDGPSALPLHQLEGFLSQMKAIDDLVKRM 275


>gi|284007352|emb|CBA72728.1| 2-dehydro-3-deoxyphosphooctulonate aldolase [Arsenophonus nasoniae]
          Length = 284

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 119/268 (44%), Positives = 170/268 (63%), Gaps = 2/268 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           + +  +N   FVL  G   +ES D A  I E    +   LNI  V+K+SFDKANRSS+  
Sbjct: 9   DDIKVANNLPFVLFGGMNVLESRDLAMKICEHYVTVTDKLNIPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG GL +G +IF+++K+ +G  ++TDVH   Q   +A+ VD++Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGLDEGMKIFQEIKQTFGVKVITDVHEPAQAAPVAEVVDVIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QF+SP +M NI++K    G + V+ C+RG +FGY+ LV DM    +M 
Sbjct: 129 AKTGAVINVKKPQFISPGQMGNIVEKFKEAGNEKVILCDRGVNFGYDNLVVDMLGFNVMM 188

Query: 215 S--MGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
           +   G PVIFD +H++Q     G+ S G R  +  LA+A +A+G+AG+FLE H DP NA 
Sbjct: 189 NVSKGSPVIFDVTHALQCRDPFGSASSGRRAQVAELARAGMAVGLAGLFLEAHPDPTNAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIKP 300
            DGP+ + +  L   L Q+ AID ++K 
Sbjct: 249 CDGPSALPLTKLAPFLEQVKAIDDLVKS 276


>gi|152980539|ref|YP_001352222.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Janthinobacterium sp.
           Marseille]
 gi|166199036|sp|A6SVC5|KDSA_JANMA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|151280616|gb|ABR89026.1| 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase)
           [Janthinobacterium sp. Marseille]
          Length = 281

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 119/269 (44%), Positives = 168/269 (62%), Gaps = 2/269 (0%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
             ++   N   FVL  G   +ES D A    E+   +   L I  V+K+SFDKANRSS+ 
Sbjct: 5   NGEIKVDNAAPFVLFGGINVLESRDLAMRSCEEYVRVTGKLGIPYVFKASFDKANRSSIH 64

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RG GL++G  IF D+KK +G P++TDVH   Q +  A+ +D+LQ+PA L RQTDL+ A
Sbjct: 65  SYRGPGLEEGLRIFEDVKKTFGVPLITDVHEPYQAKIAAEVIDVLQLPAFLARQTDLVVA 124

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            AQTGRVIN+KK QFLSP +M NI++K    G   ++ C+RGT FGY+ LV DM    +M
Sbjct: 125 LAQTGRVINIKKPQFLSPPQMLNIVEKFREAGNDKLILCDRGTCFGYDNLVVDMLGFGVM 184

Query: 214 TSMG--VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
             +   +P+IFD +H++QQ    G  SGG R+ +  LA+A + +G+AG+FLE H DP  A
Sbjct: 185 KKVTGNLPIIFDVTHALQQRDSLGTASGGRREQVADLARAGMGVGLAGLFLEAHPDPKVA 244

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
             DGP+ + +  L   L+QL  +D ++K 
Sbjct: 245 KCDGPSALPLDKLEPFLAQLKQLDDLVKS 273


>gi|293606165|ref|ZP_06688529.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Achromobacter piechaudii
           ATCC 43553]
 gi|292815425|gb|EFF74542.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Achromobacter piechaudii
           ATCC 43553]
          Length = 285

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 118/266 (44%), Positives = 169/266 (63%), Gaps = 2/266 (0%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           +  +N++ FVL  G   +ES D A    E+   +   L I  V+K+SFDKANRSS+   R
Sbjct: 12  IRCANDRPFVLFGGINVLESLDLALRACEEYQRVTTKLGIPYVFKASFDKANRSSIHSYR 71

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G GL++G +IF  +KK++G P++TDVH   Q   +A+  DILQ+PA L RQTDL+ A A+
Sbjct: 72  GPGLEEGMKIFEAVKKEFGVPVITDVHEPWQAAPVAEVADILQLPAFLARQTDLVVALAK 131

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSM 216
           T RV+N+KK QFLSP +M NI++K    G   ++ C+RGTSFGY+ LV DM    +M  +
Sbjct: 132 TQRVVNIKKPQFLSPTQMLNIVEKFTEAGNDKLILCDRGTSFGYDNLVVDMLGFGVMKKV 191

Query: 217 --GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
               P+IFD +H++QQ       SGG R  +  LA+A +A+G+AG+FLE H DP NA  D
Sbjct: 192 SGNRPLIFDVTHALQQRSALDAASGGRRAQVAELARAGMAVGLAGLFLEAHPDPRNAKCD 251

Query: 275 GPNMINIKDLPKLLSQLLAIDKIIKP 300
           GP+ + +  L   L+QL  +D ++K 
Sbjct: 252 GPSALPLDKLEPFLTQLKQLDDLVKS 277


>gi|226939475|ref|YP_002794548.1| KdsA [Laribacter hongkongensis HLHK9]
 gi|254807749|sp|C1DCC2|KDSA_LARHH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase; AltName:
           Full=3-deoxy-D-manno-octulosonic acid 8-phosphate
           synthase; AltName: Full=KDO-8-phosphate synthase;
           Short=KDO 8-P synthase; Short=KDOPS; AltName:
           Full=Phospho-2-dehydro-3-deoxyoctonate aldolase
 gi|226714401|gb|ACO73539.1| KdsA [Laribacter hongkongensis HLHK9]
          Length = 283

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 129/267 (48%), Positives = 170/267 (63%), Gaps = 6/267 (2%)

Query: 40  SNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVG 99
             +Q   LIAGPC IE    A   A +L  +   L +  +YKSS+DKANRSS    RG G
Sbjct: 9   GLDQPLFLIAGPCVIEGEQFAIDTAGQLKEMAGRLGLPFIYKSSYDKANRSSDQSFRGFG 68

Query: 100 LKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGR 159
           +  G  I   +KK+ G P+LTDVHT ++    A  VD+LQ PA LCRQTD + A A TG+
Sbjct: 69  IDAGLTILDKVKKQVGVPVLTDVHTAEEAPLAASVVDVLQTPAFLCRQTDFIRAVAATGK 128

Query: 160 VINVKKGQFLSPWEMHNILQKLHA------HGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            +N+KKGQFL+P +M N++ K              ++ CERG SFGYN LV+DMRS+ IM
Sbjct: 129 PVNIKKGQFLAPGDMLNVVAKARHGAREAGFDGDTIMVCERGASFGYNNLVSDMRSLAIM 188

Query: 214 TSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPS 273
              G PV++DA+HSVQ PG  G  SGG+R+++  LA+AAVA GIAGIF+ETH DP  A S
Sbjct: 189 RGTGCPVVYDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGIAGIFMETHPDPCKALS 248

Query: 274 DGPNMINIKDLPKLLSQLLAIDKIIKP 300
           DGPN   +  L  LL+ L+ +D+++K 
Sbjct: 249 DGPNAWPLPRLYDLLATLVELDRLVKS 275


>gi|260911764|ref|ZP_05918336.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella sp. oral taxon 472
           str. F0295]
 gi|260634090|gb|EEX52208.1| 3-deoxy-8-phosphooctulonate synthase [Prevotella sp. oral taxon 472
           str. F0295]
          Length = 250

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 120/247 (48%), Positives = 165/247 (66%)

Query: 46  VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGRE 105
             IAGPC IES +  + +AEKL  I + L + +++K+SFDKANR+S++  RG GL++G E
Sbjct: 4   TFIAGPCVIESQELLYTVAEKLVEINKKLKVDIIFKASFDKANRTSISSFRGPGLERGLE 63

Query: 106 IFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKK 165
           +  ++K KYG  +LTD+H   Q EA+   VD+LQIPA LCRQTDLL  AA+TG+V+N+KK
Sbjct: 64  MLANVKSKYGLKLLTDIHESHQAEAVGQIVDVLQIPAFLCRQTDLLVTAAKTGKVVNIKK 123

Query: 166 GQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDAS 225
            QFLS  +M   ++K    GA +V   ERG +FGYN LV D R+IP M  +   VI D +
Sbjct: 124 AQFLSGPDMKYPVEKAKEAGAAEVWLTERGNTFGYNNLVVDFRNIPDMKEIVPTVIMDCT 183

Query: 226 HSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLP 285
           HSVQ+PG  G  +GG+R+++  +A AA A G  G F E H +PD   SDGPNM+ +  L 
Sbjct: 184 HSVQRPGAMGGKTGGDRRFVPAMALAAKAFGATGYFFEVHPNPDKGLSDGPNMLELDKLE 243

Query: 286 KLLSQLL 292
            L++ LL
Sbjct: 244 GLIADLL 250


>gi|167920281|ref|ZP_02507372.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei BCC215]
          Length = 281

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 119/270 (44%), Positives = 170/270 (62%), Gaps = 2/270 (0%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
              VT  N   FVL  G   +ES D    +  +  A+ + L I  V+K+SFDKANRSS+ 
Sbjct: 6   SPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYAAVTRKLGIPFVFKASFDKANRSSIH 65

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RGVGL +G +IF ++K ++G P++TDVH  +Q   +A+  D+LQ+PA L RQTDL+ A
Sbjct: 66  SYRGVGLDEGLKIFAEVKARFGVPVITDVHEVEQAAPVAEIADVLQVPAFLARQTDLVVA 125

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            A+ G+ +NVKK QF+SP ++ +++ K    G   V+ CERG+SFGY+ LV DM     M
Sbjct: 126 IAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQM 185

Query: 214 TSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
                G PVIFD +HS+Q      + SGG R+ ++ LA+A +A+GIAG+FLE H DPD A
Sbjct: 186 AETTGGCPVIFDVTHSLQCRDPLDDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRA 245

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
             DGP+ + +  L   LSQ+ AID ++K +
Sbjct: 246 RCDGPSALPLHQLEGFLSQMKAIDDLVKRM 275


>gi|167895674|ref|ZP_02483076.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Burkholderia
           pseudomallei 7894]
          Length = 281

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 119/270 (44%), Positives = 170/270 (62%), Gaps = 2/270 (0%)

Query: 34  KNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLA 93
              VT  N   FVL  G   +ES D    +  +  A+ + L I  V+K+SFDKANRSS+ 
Sbjct: 6   SPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYAAVTRKLGIPFVFKASFDKANRSSIH 65

Query: 94  GKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTA 153
             RGVGL +G +IF ++K ++G P++TDVH  +Q   +A+  D+LQ+PA L RQTDL+ A
Sbjct: 66  SYRGVGLDEGLKIFAEVKARFGVPVITDVHEVEQAAPVAEIADVLQVPAFLARQTDLVVA 125

Query: 154 AAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIM 213
            A+ G+ +NVKK QF+SP ++ +++ K    G   V+ CERG+SFGY+ LV DM     M
Sbjct: 126 IAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQM 185

Query: 214 TSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
                G PVIFD +HS+Q      + SGG R+ ++ LA+A +A+GIAG+FLE H DPD A
Sbjct: 186 AETTGGCPVIFDVTHSLQCRDPLDDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRA 245

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
             DGP+ +