RPSBLAST alignment for GI: 254780669 and conserved domain: PRK13398

>gnl|CDD|184028 PRK13398, PRK13398, 3-deoxy-7-phosphoheptulonate synthase; Provisional. Length = 266
 Score =  130 bits (328), Expect = 5e-31
 Identities = 76/269 (28%), Positives = 141/269 (52%), Gaps = 39/269 (14%)

Query: 42  EQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLK 101
            +  ++IAGPC +ES +    +AEKL  +   +  G  +K       R+S    +G+G +
Sbjct: 25  GEEKIIIAGPCAVESEEQMVKVAEKLKELGVHMLRGGAFKP------RTSPYSFQGLGEE 78

Query: 102 KGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVI 161
            G +I +++  KY  P++T+V   +  E +AD  D+LQI +   +  +LL    +T + I
Sbjct: 79  -GLKILKEVGDKYNLPVVTEVMDTRDVEEVADYADMLQIGSRNMQNFELLKEVGKTKKPI 137

Query: 162 NVKKGQFLSPWEMHNILQK-LHA------HGAKDVLFCERGT----SFGYNTLVTDMRSI 210
            +K+G       M   L++ L+A       G ++V+ CERG     ++  NTL  D+ ++
Sbjct: 138 LLKRG-------MSATLEEWLYAAEYIMSEGNENVVLCERGIRTFETYTRNTL--DLAAV 188

Query: 211 PIMTSMG-VPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPD 269
            ++  +  +P+I D SH+            G R+ ++P+AKAA+A G  G+ +E H +P+
Sbjct: 189 AVIKELSHLPIIVDPSHAT-----------GRRELVIPMAKAAIAAGADGLMIEVHPEPE 237

Query: 270 NAPSDGPNMINIKDLPKLLSQLLAIDKII 298
            A SD    +N +++ +L+ +L  + K +
Sbjct: 238 KALSDARQTLNFEEMKELVDELKPMAKAL 266