RPSBLAST alignment for GI: 254780669 and conserved domain: COG2876

>gnl|CDD|32703 COG2876, AroA, 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]. Length = 286
 Score =  131 bits (331), Expect = 2e-31
 Identities = 75/258 (29%), Positives = 124/258 (48%), Gaps = 25/258 (9%)

Query: 45  FVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR 104
             +IAGPC +ES +     AE + A       G  +K       R+S    +G+G + G 
Sbjct: 46  LRVIAGPCSVESEEQVRETAESVKAAGAKALRGGAFKP------RTSPYSFQGLGEE-GL 98

Query: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVK 164
           ++ +    + G P++T+V   +  EA A+  DILQ+ A   +   LL    +  + + +K
Sbjct: 99  KLLKRAADETGLPVVTEVMDVRDVEAAAEYADILQVGARNMQNFALLKEVGRQNKPVLLK 158

Query: 165 KGQFLSPWEMHNILQKLHAHGAKDVLFCERG----TSFGYNTLVTDMRSIPIMTSMG-VP 219
           +G   +  E  N  + + +HG  +V+ CERG         NTL  D+ ++PI+     +P
Sbjct: 159 RGLSATIEEWLNAAEYILSHGNGNVILCERGIRTFEKATRNTL--DISAVPILKQETHLP 216

Query: 220 VIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMI 279
           VI D SH+            G R  + PLAKAA+A G  G+ +E H DP+ A SD    +
Sbjct: 217 VIVDPSHA-----------TGRRDLVEPLAKAAIAAGADGLMIEVHPDPEKALSDAKQQL 265

Query: 280 NIKDLPKLLSQLLAIDKI 297
             ++  +L+ +L A+   
Sbjct: 266 TPEEFEELVKELRALADA 283