RPSBLAST alignment of GI: 254780669 and protein with PDBid: 3nvt

>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} Length = 385
 Score =  258 bits (660), Expect = 1e-69
 Identities = 69/268 (25%), Positives = 126/268 (47%), Gaps = 22/268 (8%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +   N    V + GPC +ES++    +AE + A      + L+   +F    R+S   
Sbjct: 134 KGLPIGNG-EPVFVFGPCSVESYEQVAAVAESIKAKG----LKLIRGGAFKP--RTSPYD 186

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            +G+GL+ G +I + +  +YG  +++++ T    E   D VD++QI A   +  +LL AA
Sbjct: 187 FQGLGLE-GLKILKRVSDEYGLGVISEIVTPADIEVALDYVDVIQIGARNMQNFELLKAA 245

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTS--FGYNTLVTDMRSIPI 212
            +  + I +K+G   +  E     + + + G   ++ CERG            D+ ++PI
Sbjct: 246 GRVDKPILLKRGLSATIEEFIGAAEYIMSQGNGKIILCERGIRTYEKATRNTLDISAVPI 305

Query: 213 MTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
           +     +PV+ D +HS            G +  ++P AKAA+AI   G+  E H DP  A
Sbjct: 306 LKKETHLPVMVDVTHST-----------GRKDLLLPCAKAALAIEADGVMAEVHPDPAVA 354

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            SD    ++I +  +  + +LA + +  
Sbjct: 355 LSDSAQQMDIPEFEEFWNAILASNLVPH 382